NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F060259

Metagenome Family F060259

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F060259
Family Type Metagenome
Number of Sequences 133
Average Sequence Length 48 residues
Representative Sequence ILVGESAISAEMQKRVREMIKTFLERARVKLEGEESLEQEGMLDSPA
Number of Associated Samples 110
Number of Associated Scaffolds 133

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 97.74 %
% of genes from short scaffolds (< 2000 bps) 89.47 %
Associated GOLD sequencing projects 96
AlphaFold2 3D model prediction Yes
3D model pTM-score0.44

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.248 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere
(9.023 % of family members)
Environment Ontology (ENVO) Unclassified
(55.639 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(75.188 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 40.00%    β-sheet: 0.00%    Coil/Unstructured: 60.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.44
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 133 Family Scaffolds
PF02585PIG-L 3.76
PF08335GlnD_UR_UTase 1.50
PF07813LTXXQ 0.75
PF00534Glycos_transf_1 0.75
PF08220HTH_DeoR 0.75

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 133 Family Scaffolds
COG2120N-acetylglucosaminyl deacetylase, LmbE familyCarbohydrate transport and metabolism [G] 3.76
COG3678Periplasmic chaperone Spy, Spy/CpxP familyPosttranslational modification, protein turnover, chaperones [O] 3.01
COG2844UTP:GlnB (protein PII) uridylyltransferaseSignal transduction mechanisms [T] 1.50

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.25 %
UnclassifiedrootN/A0.75 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000787|JGI11643J11755_11648026All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium716Open in IMG/M
3300000955|JGI1027J12803_107835681All Organisms → cellular organisms → Bacteria → Acidobacteria883Open in IMG/M
3300002120|C687J26616_10102323All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium922Open in IMG/M
3300003267|soilL1_10022503All Organisms → cellular organisms → Bacteria → Acidobacteria2900Open in IMG/M
3300003319|soilL2_10003320All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes5823Open in IMG/M
3300004157|Ga0062590_102355604All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300005093|Ga0062594_100649955All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium938Open in IMG/M
3300005294|Ga0065705_10244469All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1218Open in IMG/M
3300005295|Ga0065707_10159811All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1574Open in IMG/M
3300005328|Ga0070676_10223589All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1244Open in IMG/M
3300005331|Ga0070670_101425861All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium635Open in IMG/M
3300005332|Ga0066388_105719928All Organisms → cellular organisms → Bacteria → Acidobacteria629Open in IMG/M
3300005336|Ga0070680_100144539All Organisms → cellular organisms → Bacteria → Acidobacteria1995Open in IMG/M
3300005338|Ga0068868_102283833All Organisms → cellular organisms → Bacteria → Acidobacteria516Open in IMG/M
3300005364|Ga0070673_101403066All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium657Open in IMG/M
3300005367|Ga0070667_101203438All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium709Open in IMG/M
3300005434|Ga0070709_10464435All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium956Open in IMG/M
3300005438|Ga0070701_10146497All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1356Open in IMG/M
3300005438|Ga0070701_10647434All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium705Open in IMG/M
3300005440|Ga0070705_101073695All Organisms → cellular organisms → Bacteria → Acidobacteria657Open in IMG/M
3300005444|Ga0070694_100750880All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium797Open in IMG/M
3300005444|Ga0070694_101641680All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300005456|Ga0070678_100428620All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1154Open in IMG/M
3300005466|Ga0070685_10846673All Organisms → cellular organisms → Bacteria → Acidobacteria677Open in IMG/M
3300005466|Ga0070685_11218749All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium572Open in IMG/M
3300005468|Ga0070707_102068607All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300005543|Ga0070672_101432756All Organisms → cellular organisms → Bacteria → Acidobacteria618Open in IMG/M
3300005545|Ga0070695_100380023All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1065Open in IMG/M
3300005545|Ga0070695_101745971All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium521Open in IMG/M
3300005548|Ga0070665_100098241All Organisms → cellular organisms → Bacteria → Acidobacteria2932Open in IMG/M
3300005548|Ga0070665_101497134All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium683Open in IMG/M
3300005563|Ga0068855_100745115All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1045Open in IMG/M
3300005577|Ga0068857_100151744All Organisms → cellular organisms → Bacteria → Acidobacteria2099Open in IMG/M
3300005577|Ga0068857_101997452All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium569Open in IMG/M
3300005578|Ga0068854_100183052All Organisms → cellular organisms → Bacteria → Acidobacteria1638Open in IMG/M
3300005598|Ga0066706_10646640All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia839Open in IMG/M
3300005617|Ga0068859_100524892All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium1279Open in IMG/M
3300005617|Ga0068859_101557975All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium730Open in IMG/M
3300005618|Ga0068864_100815826All Organisms → cellular organisms → Bacteria → Acidobacteria918Open in IMG/M
3300005840|Ga0068870_10834268All Organisms → cellular organisms → Bacteria → Acidobacteria647Open in IMG/M
3300005841|Ga0068863_101999316All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium590Open in IMG/M
3300005842|Ga0068858_100134891All Organisms → cellular organisms → Bacteria → Acidobacteria2316Open in IMG/M
3300005843|Ga0068860_100167870All Organisms → cellular organisms → Bacteria → Acidobacteria2119Open in IMG/M
3300006173|Ga0070716_101569012All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300006806|Ga0079220_11978790All Organisms → cellular organisms → Bacteria → Acidobacteria519Open in IMG/M
3300006844|Ga0075428_101251913All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium781Open in IMG/M
3300006844|Ga0075428_102603746All Organisms → cellular organisms → Bacteria → Acidobacteria517Open in IMG/M
3300006845|Ga0075421_102679195All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300006846|Ga0075430_100617273All Organisms → cellular organisms → Bacteria895Open in IMG/M
3300006852|Ga0075433_10039796All Organisms → cellular organisms → Bacteria → Acidobacteria4066Open in IMG/M
3300006871|Ga0075434_100829240All Organisms → cellular organisms → Bacteria941Open in IMG/M
3300006871|Ga0075434_102273498All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300006876|Ga0079217_10878241All Organisms → cellular organisms → Bacteria636Open in IMG/M
3300006894|Ga0079215_10568659All Organisms → cellular organisms → Bacteria → Acidobacteria729Open in IMG/M
3300006918|Ga0079216_10033915All Organisms → cellular organisms → Bacteria → Acidobacteria2073Open in IMG/M
3300007255|Ga0099791_10438051All Organisms → cellular organisms → Bacteria → Acidobacteria631Open in IMG/M
3300009100|Ga0075418_10211905All Organisms → cellular organisms → Bacteria → Acidobacteria2062Open in IMG/M
3300009101|Ga0105247_10840488All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium704Open in IMG/M
3300009148|Ga0105243_10117873All Organisms → cellular organisms → Bacteria → Acidobacteria2233Open in IMG/M
3300009148|Ga0105243_10394802All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1283Open in IMG/M
3300009148|Ga0105243_10493442All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1159Open in IMG/M
3300009148|Ga0105243_11068840All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium814Open in IMG/M
3300009148|Ga0105243_11515463All Organisms → cellular organisms → Bacteria → Acidobacteria695Open in IMG/M
3300009148|Ga0105243_12938229All Organisms → cellular organisms → Bacteria → Acidobacteria517Open in IMG/M
3300009162|Ga0075423_12972619All Organisms → cellular organisms → Bacteria → Acidobacteria519Open in IMG/M
3300009174|Ga0105241_10404365All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1198Open in IMG/M
3300009174|Ga0105241_11027166All Organisms → cellular organisms → Bacteria773Open in IMG/M
3300009174|Ga0105241_12104555All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium558Open in IMG/M
3300009176|Ga0105242_12181882All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium599Open in IMG/M
3300009545|Ga0105237_10454020All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1287Open in IMG/M
3300009553|Ga0105249_12678843All Organisms → cellular organisms → Bacteria571Open in IMG/M
3300010042|Ga0126314_10307217All Organisms → cellular organisms → Bacteria1133Open in IMG/M
3300010042|Ga0126314_11309156All Organisms → cellular organisms → Bacteria → Acidobacteria543Open in IMG/M
3300010371|Ga0134125_13139843All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300010397|Ga0134124_12856795All Organisms → cellular organisms → Bacteria → Acidobacteria527Open in IMG/M
3300010400|Ga0134122_10389572Not Available1227Open in IMG/M
3300010400|Ga0134122_12572808All Organisms → cellular organisms → Bacteria → Acidobacteria559Open in IMG/M
3300010401|Ga0134121_12975267All Organisms → cellular organisms → Bacteria → Acidobacteria521Open in IMG/M
3300012015|Ga0120187_1012353All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium777Open in IMG/M
3300012285|Ga0137370_10646223All Organisms → cellular organisms → Bacteria → Acidobacteria656Open in IMG/M
3300012582|Ga0137358_11004468All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium539Open in IMG/M
3300012927|Ga0137416_10236514All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1485Open in IMG/M
3300012989|Ga0164305_12154322All Organisms → cellular organisms → Bacteria → Acidobacteria512Open in IMG/M
3300013296|Ga0157374_10370329All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1426Open in IMG/M
3300013306|Ga0163162_10889967All Organisms → cellular organisms → Bacteria1004Open in IMG/M
3300014745|Ga0157377_10212404All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1234Open in IMG/M
3300014968|Ga0157379_11599754All Organisms → cellular organisms → Bacteria → Acidobacteria636Open in IMG/M
3300015371|Ga0132258_11174952All Organisms → cellular organisms → Bacteria → Acidobacteria1940Open in IMG/M
3300015372|Ga0132256_102978475All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium569Open in IMG/M
3300015374|Ga0132255_100747921All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1455Open in IMG/M
3300018422|Ga0190265_12472607All Organisms → cellular organisms → Bacteria618Open in IMG/M
3300018432|Ga0190275_13344002All Organisms → cellular organisms → Bacteria → Acidobacteria519Open in IMG/M
3300018466|Ga0190268_11186441All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium631Open in IMG/M
3300018476|Ga0190274_12846035All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium580Open in IMG/M
3300021445|Ga0182009_10460202All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium665Open in IMG/M
3300024290|Ga0247667_1018992All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1337Open in IMG/M
3300025904|Ga0207647_10800289All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium507Open in IMG/M
3300025908|Ga0207643_10718699All Organisms → cellular organisms → Bacteria → Acidobacteria646Open in IMG/M
3300025910|Ga0207684_10163984All Organisms → cellular organisms → Bacteria → Acidobacteria1914Open in IMG/M
3300025911|Ga0207654_10697387All Organisms → cellular organisms → Bacteria → Acidobacteria729Open in IMG/M
3300025917|Ga0207660_10239685All Organisms → cellular organisms → Bacteria → Acidobacteria1428Open in IMG/M
3300025926|Ga0207659_11231443All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium643Open in IMG/M
3300025930|Ga0207701_10849509All Organisms → cellular organisms → Bacteria767Open in IMG/M
3300025933|Ga0207706_10552564All Organisms → cellular organisms → Bacteria → Acidobacteria991Open in IMG/M
3300025933|Ga0207706_11471705All Organisms → cellular organisms → Bacteria → Acidobacteria557Open in IMG/M
3300025934|Ga0207686_11379207All Organisms → cellular organisms → Bacteria → Acidobacteria580Open in IMG/M
3300025935|Ga0207709_10308866All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1179Open in IMG/M
3300025939|Ga0207665_11573136All Organisms → cellular organisms → Bacteria → Acidobacteria522Open in IMG/M
3300025960|Ga0207651_11087807All Organisms → cellular organisms → Bacteria716Open in IMG/M
3300025960|Ga0207651_12001664All Organisms → cellular organisms → Bacteria → Acidobacteria520Open in IMG/M
3300025972|Ga0207668_11188361All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium685Open in IMG/M
3300025981|Ga0207640_11023702All Organisms → cellular organisms → Bacteria → Acidobacteria727Open in IMG/M
3300026035|Ga0207703_10138653All Organisms → cellular organisms → Bacteria → Acidobacteria2109Open in IMG/M
3300026078|Ga0207702_10085466All Organisms → cellular organisms → Bacteria2749Open in IMG/M
3300026089|Ga0207648_10083178All Organisms → cellular organisms → Bacteria → Acidobacteria2792Open in IMG/M
3300026095|Ga0207676_10798491All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium921Open in IMG/M
3300026095|Ga0207676_11368483All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium703Open in IMG/M
3300026095|Ga0207676_12111915All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300026121|Ga0207683_11506923All Organisms → cellular organisms → Bacteria → Acidobacteria621Open in IMG/M
3300027424|Ga0209984_1070136All Organisms → cellular organisms → Bacteria → Acidobacteria523Open in IMG/M
3300027691|Ga0209485_1007185All Organisms → cellular organisms → Bacteria → Acidobacteria2300Open in IMG/M
3300028379|Ga0268266_11756341All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium595Open in IMG/M
3300028380|Ga0268265_11219215All Organisms → cellular organisms → Bacteria → Acidobacteria750Open in IMG/M
3300028380|Ga0268265_11246825All Organisms → cellular organisms → Bacteria742Open in IMG/M
3300028792|Ga0307504_10270956All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium629Open in IMG/M
(restricted) 3300031150|Ga0255311_1140092All Organisms → cellular organisms → Bacteria → Acidobacteria535Open in IMG/M
3300031731|Ga0307405_11676913All Organisms → cellular organisms → Bacteria → Acidobacteria562Open in IMG/M
3300031852|Ga0307410_11152164All Organisms → cellular organisms → Bacteria → Acidobacteria674Open in IMG/M
3300031901|Ga0307406_10098238All Organisms → cellular organisms → Bacteria → Acidobacteria1988Open in IMG/M
3300031911|Ga0307412_10264195All Organisms → cellular organisms → Bacteria → Acidobacteria1343Open in IMG/M
3300031995|Ga0307409_102975226All Organisms → cellular organisms → Bacteria → Acidobacteria500Open in IMG/M
3300032002|Ga0307416_100454896All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1334Open in IMG/M
3300032005|Ga0307411_11412648All Organisms → cellular organisms → Bacteria → Acidobacteria637Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere9.02%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere9.02%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere6.77%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere6.77%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere6.77%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere5.26%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere5.26%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.51%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil3.76%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil3.76%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere3.76%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.01%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere3.01%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.26%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere2.26%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil1.50%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere1.50%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.50%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil1.50%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.50%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.50%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.50%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere1.50%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.50%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.50%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.50%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.75%
TerrestrialEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial0.75%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.75%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.75%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.75%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil0.75%
Sandy SoilEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil0.75%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.75%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.75%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.75%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.75%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000787Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300002120Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2EnvironmentalOpen in IMG/M
3300003267Sugarcane bulk soil Sample L1EnvironmentalOpen in IMG/M
3300003319Sugarcane bulk soil Sample L2EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005295Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3EnvironmentalOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005466Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006876Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200EnvironmentalOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300006918Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100EnvironmentalOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010042Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105BEnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300012015Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C3.rep1EnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018432Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 TEnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300024290Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK08EnvironmentalOpen in IMG/M
3300025904Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300027424Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027691Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028792Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_SEnvironmentalOpen in IMG/M
3300031150 (restricted)Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH4_T0_E4EnvironmentalOpen in IMG/M
3300031731Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1Host-AssociatedOpen in IMG/M
3300031852Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3Host-AssociatedOpen in IMG/M
3300031901Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2Host-AssociatedOpen in IMG/M
3300031911Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1Host-AssociatedOpen in IMG/M
3300031995Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2Host-AssociatedOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300032005Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
JGI11643J11755_1164802613300000787SoilVELRRKHAKDLHRFAILVGEGRISAXMQXRVREMXQTFLEXARVKLEGEXPLEPEGMLDQPA*
JGI1027J12803_10783568113300000955SoilAILVGESAISAEMQKRVREMIKTFLERARVKLEGEAPIEQEPVLDSAV*
C687J26616_1010232323300002120SoilALVGETAISTEMQKRVRTMIKVFLERARVKLEGESGEPEGSLQTVP*
soilL1_1002250333300003267Sugarcane Root And Bulk SoilRISAEMQKRVREMIKTFLERARVKLEAEESLDAEGMLDSPA*
soilL2_1000332043300003319Sugarcane Root And Bulk SoilEMQKRVREMIVTFLERARVKLEGEDGGNLEQDAMLDQPA*
Ga0062590_10235560413300004157SoilESAISAEMQKRVREMIKTFLERARVKLEGEEPLEQEAMADSPA*
Ga0062594_10064995523300005093SoilGRISAEMQKRVREMIVTFLERARVKLETEEPLEQEGLLDSPA*
Ga0065705_1024446913300005294Switchgrass RhizosphereHARELHRLAALVGEGAISSEMQKRVAEMIKTFLERAQAKLEGESALEQEATS*
Ga0065707_1015981123300005295Switchgrass RhizosphereARELHRLAALVGEGAISSEMQKRVAEMIKTFLERAQAKLEGESALEQEATS*
Ga0070676_1022358913300005328Miscanthus RhizosphereVGEGRINAEMQKRVREMIVTFLERARVQLEGEEGGNLEQDAMLDQPA*
Ga0070670_10142586113300005331Switchgrass RhizosphereKHAKELHRFATLVGEGRISAEMQKRVREMIITFLERARVKLEGEEGGNLEQDAMIDQPA*
Ga0066388_10571992823300005332Tropical Forest SoilRRKHAKDLHRFAILVGESAISAEMQKRVREMIKTFLERARVKLEGEEPLEQEPVMLDSPA
Ga0070680_10014453923300005336Corn RhizosphereEGRINAEMQKRVREMIVTFLERARVQLEGEEGGNLEQDAMLDQPA*
Ga0068868_10228383323300005338Miscanthus RhizosphereISSEMQKRVREMIKTFLERAREKLETETSVDQEALADSPA*
Ga0070673_10140306613300005364Switchgrass RhizosphereRKHAKDLHRFAVLVGEGRISSEMQKRVREMIKTFLERAREKLETEPGLEQEPILDTPA*
Ga0070667_10120343813300005367Switchgrass RhizosphereVGEGRISAEMQDRVREMIKTFLERARVKLEGETSVDPEPILDTPA*
Ga0070709_1046443513300005434Corn, Switchgrass And Miscanthus RhizosphereKHAKDLHRFAILVGEGRISSEMQKRVREMIKTFLERAREKLETETSVDQEALADSPA*
Ga0070701_1014649713300005438Corn, Switchgrass And Miscanthus RhizosphereQHAKDLHRFAILVGESAISSEMQKRVREMIKTFLERARVKLEAETGDQEPILDTPA*
Ga0070701_1064743413300005438Corn, Switchgrass And Miscanthus RhizosphereRFATLVGEGRISAEMQKRVREMIITFLERARVKLEGEEGGNLEQDAMIDQPA*
Ga0070705_10107369513300005440Corn, Switchgrass And Miscanthus RhizosphereSAEMQKRVREMIKTFLERARVKLEAEESLDSEGMLDSPA*
Ga0070694_10075088013300005444Corn, Switchgrass And Miscanthus RhizosphereRRPHARDLHRFAALVGESAISSEMQKRVSEMIKTFLERARVKLEGESSLEQEA*
Ga0070694_10164168013300005444Corn, Switchgrass And Miscanthus RhizosphereTLVGEGRISAEMQKRVREMIITFLERARVKLEGEEGGNLEQDAMIDQPA*
Ga0070678_10042862013300005456Miscanthus RhizosphereILVGESAISSEMQKRVKEMIKTFLERARVKLETEPVIEQEPILDSPA*
Ga0070685_1084667323300005466Switchgrass RhizosphereLVGEGRISAEMQKRVREMIVTFLERARVKLETEEPLEQEGLLDSPA*
Ga0070685_1121874923300005466Switchgrass RhizosphereELRRKHAKDLHRFAVLVGEGRISSEMQKRVREMIKTFLERAREKLETEPGLEQEPILDTPA*
Ga0070707_10206860723300005468Corn, Switchgrass And Miscanthus RhizosphereSAEMQKRVREMIKTFLERARVKLEGEEPLDQEAMLDSPA*
Ga0070672_10143275623300005543Miscanthus RhizosphereDLHRFAMLLGESAISAEMQKRVREMIKTFLARAQERLESETLPEQEPALDTAS*
Ga0070695_10038002313300005545Corn, Switchgrass And Miscanthus RhizosphereKDLHRFAILVGEGRISSEMQKRVREMIKTFLERAREKLETETSVDQEALADSPA*
Ga0070695_10174597113300005545Corn, Switchgrass And Miscanthus RhizosphereLRRKHAKDLHRFAILVGEGRISSEMQKRVREMIKTFLERAREKLETDPSVDQEVLADSPA
Ga0070665_10009824113300005548Switchgrass RhizosphereSSEMQKRVKEMIKTFLERARVKLETEPVIEQEPILDSPA*
Ga0070665_10149713413300005548Switchgrass RhizosphereFAVLVGEGRISSEMQKRVREMIKTFLERAREKLETEPGLEQEPILDTPA*
Ga0068855_10074511513300005563Corn RhizosphereHAKDLHRFAILVGEGAISAEMQKRVREMIKTFLERARVKLETEEPLEQEGLLDSPA*
Ga0068857_10015174423300005577Corn RhizosphereISNEMQKRVREMIKTFLERARVKLEEEPEQDELLESPA*
Ga0068857_10199745213300005577Corn RhizosphereVELRRAHARELHRLAALVGEGAISSEMQKRVAEMIKTFLERAQAKLEGESTLEQEATS*
Ga0068854_10018305223300005578Corn RhizosphereFAVLLGESAISAEMQKRVREMIKTFLVRAQERLENETLPEQEPALDTAS*
Ga0066706_1064664033300005598SoilDLHRLAALVGEGAISAEMQKRVREMIKIFLERAQAKLEGETGCEQEAV*
Ga0068859_10052489223300005617Switchgrass RhizosphereSHARDLHRFAALVGEGAISSEMQKRVSEMIKTFLERARVKLEGESNLEQEA*
Ga0068859_10155797513300005617Switchgrass RhizosphereFAILVGESAISAEMQKRVREMIKTFLERARVKLEELEGEEPMEQGEMLDSPA*
Ga0068864_10081582623300005618Switchgrass RhizosphereGESAISSEMQKRVREMIKTFLERARVKLESEPVIEQEPILDSPA*
Ga0068870_1083426823300005840Miscanthus RhizosphereESAISSEMQKRVKEMIKTFLERARVKLETEPVIEQEPILDSPA*
Ga0068863_10199931613300005841Switchgrass RhizosphereRISNEMQKRVREMIKTFLERARVKLEEEPEQEEMLESPA*
Ga0068858_10013489113300005842Switchgrass RhizosphereQKRVREMIVTFLERARVKLEAEEPLEQEGLLDSPA*
Ga0068860_10016787013300005843Switchgrass RhizosphereKRVKEMIKTFLERARVKLETEPVIEQEPILDSPA*
Ga0070716_10156901213300006173Corn, Switchgrass And Miscanthus RhizosphereLHRLAILVGEGRISIEMQKRVREMIKTFLERARVKLEGEELDQEPLLDSPA*
Ga0079220_1197879023300006806Agricultural SoilEMQKRVREMIKTFLERARVKLETEEPLDSEGMLDSPA*
Ga0075428_10125191313300006844Populus RhizosphereKRVREMIKTFLERARVKLEEEGGNLDQEAMLDQPA*
Ga0075428_10260374613300006844Populus RhizosphereSAEMQKRVREMIKTFLERARVKLEGEESLEQEAMLDSPA*
Ga0075421_10267919513300006845Populus RhizosphereKDLHRFAILVGEGRISAEMQKRVREMIQTFLERARVKLEGEQPLEPEGMLDQPA*
Ga0075430_10061727313300006846Populus RhizosphereSAEMQKRVREMIKTFLERARVKLEGEETLDQEAMLDSPA*
Ga0075433_1003979613300006852Populus RhizosphereHRFAILVGESAISAEMQKRVREMIKTFLERARVKLEGEEPLDLEPIEQEA*
Ga0075434_10082924023300006871Populus RhizosphereRRKHAKDLHRFAILVGEGRISSEMQKRVREMIKTFLERAREKLETETSVDQEALADSPA*
Ga0075434_10227349813300006871Populus RhizosphereVGESAISSEMQKRVKEMIKTFLERARVKLETEPVIEQEPILDSPA*
Ga0079217_1087824123300006876Agricultural SoilAKELHRFAVLVGEGRINAEMQKRVREMIVTFLERARVKLEGEEPLEQEAMLDQPA*
Ga0079215_1056865923300006894Agricultural SoilEMQKRVREMIKTFLERARVKLEGEEPLEQEAMADSPA*
Ga0079216_1003391513300006918Agricultural SoilSAISAEMQKRVREMIKTFLERARVKLEGEEPLEQEAMADSPA*
Ga0099791_1043805123300007255Vadose Zone SoilDLHRLAILLGEGAISAEMQKRVREMIKTFLERARVKLEGESVDPEAVLDSAV*
Ga0075418_1021190523300009100Populus RhizosphereEMQKRVREMIKTFLERARVKLEGEESLEQEGMLDSPA*
Ga0105247_1084048813300009101Switchgrass RhizosphereVGEGRISNEMQKRVREMIKTFLERARVKLEEEPEQEEMLESPA*
Ga0105243_1011787323300009148Miscanthus RhizosphereISNEMQKRVREMIKTFLERARVKLEEEPEQEEMLESPA*
Ga0105243_1039480213300009148Miscanthus RhizosphereAHARELHRLAALVGEGAISSEMQKRAAEMIKTFLERAQAKLEGESALEQEATS*
Ga0105243_1049344213300009148Miscanthus RhizosphereLHRFAILVGEGRISSEMQKRVREMIKTFLERAREKLETDPSVDQEVLADSPA*
Ga0105243_1106884013300009148Miscanthus RhizosphereILVGEGRISAEMQKRVREMIKTFLERARVKLEAEESLDLDSEGMLDSPA*
Ga0105243_1151546313300009148Miscanthus RhizosphereISAEMQKRVREMIVTFLERARVKLETEEPLEQEGLLDSPA*
Ga0105243_1293822913300009148Miscanthus RhizosphereSAISAEMQKRVREMIKTFLERARVKLEELEGEEPMEQGDMLDSPA*
Ga0075423_1297261923300009162Populus RhizosphereAISAEMQKRVREMIKTFLERARVKLEAEESLDSEGMLDSPA*
Ga0105241_1040436523300009174Corn RhizosphereEGRISSEMQKRVREMIKTFLERAREKLETETSVDQEALADSPA*
Ga0105241_1102716633300009174Corn RhizosphereKHAKELHRFAVLVGESAISAEMQKRVREMIKTFLERARVKLEGEELDQEPLLDSPA*
Ga0105241_1210455523300009174Corn RhizosphereLVGEGRISNEMQKRVREMIKTFLERARVKLEEEPEQEEMLESPA*
Ga0105242_1218188213300009176Miscanthus RhizosphereFAALVGEGAISSEMQKRVSEMIKTFLERARVKLEGESNLEQEA*
Ga0105237_1045402013300009545Corn RhizosphereDLHRFAILVGEGRISSEMQKRVREMIKTFLERAREKLETETSVDPEVLADSPA*
Ga0105249_1267884313300009553Switchgrass RhizosphereEMQKRVREMIQTFLERARVKLEGEQPMEPEGMLDQPA*
Ga0126314_1030721723300010042Serpentine SoilLHRFAILVGEGAISAEMQKRVREMIKTFLERARVKLEGEEPLEQEAMLDSPA*
Ga0126314_1130915613300010042Serpentine SoilDLHRFAILVGEGAISAEMQKRVREMIKTFLERARVKLEGEESLEQEAMLDSPA*
Ga0134125_1313984323300010371Terrestrial SoilHARDLHRFAALVGEGAISSEMQKRVSEMIKTFLERARVKLEGESSVELEA*
Ga0134124_1285679523300010397Terrestrial SoilTISAEMQKRVREMIKTFLERARVKLEGEEQIDQTEMLDSPA*
Ga0134122_1038957223300010400Terrestrial SoilSAEMQKRVREMIKTFLARAQERLEDETLPEQEPALDTAS*
Ga0134122_1257280813300010400Terrestrial SoilAILVGEGRISNEMQKRVREMIKTFLERARVKLEAEESLDSEGMLDSPA*
Ga0134121_1297526723300010401Terrestrial SoilHARDLHRFAVLLGESAISAEMQKRVREMIKTFLARAQERLEDETLPEQEPALDTAS*
Ga0120187_101235313300012015TerrestrialRLAVLLGESAISAEMQKRVSEMIKTFLERARVKLEGETLNEQEAEAV*
Ga0137370_1064622313300012285Vadose Zone SoilEGAISAEMQKRVGEMIRTFLERARVKLESLESDTVLDPEAEAI*
Ga0137358_1100446823300012582Vadose Zone SoilEMQKRVRDMIKTFLERARVKLEGENSCDPEAVLDSAV*
Ga0137416_1023651413300012927Vadose Zone SoilQHVELRRPHARDLHRFAALVGEGAISSEMQKRVSEMIKTFLERARVKLEGEASLEQEA*
Ga0164305_1215432223300012989SoilEMQKRVREMIKTFLERAREKLETETSVDQEALADSPA*
Ga0157374_1037032923300013296Miscanthus RhizosphereVGEGRISAEMQKRVREMIKTFLERARVKLEAEESLDLDSEGMLDSPA*
Ga0163162_1088996723300013306Switchgrass RhizosphereRRKHAKDLHRFAILVGESTISAEMQKRVREMIKTFLERARVKLEEEPEQEEMLESPA*
Ga0157377_1021240423300014745Miscanthus RhizosphereAEMQKRVREMIITFLERARVKLEGEEGGNLEQDAMIDQPA*
Ga0157379_1159975413300014968Switchgrass RhizosphereRLAILVGEGRISAEMQKRVREMIKTFLERARVKLEAEESLDSEGMLDSPA*
Ga0132258_1117495213300015371Arabidopsis RhizosphereGESAISSEMQKRVREMIKTFLERARVKLEAEPGDQEPILDTPA*
Ga0132256_10297847523300015372Arabidopsis RhizosphereHRFAVLVGESAISAEMQKRVREMIKTFLERARVKLEGEESLEQEPLLDSPA*
Ga0132255_10074792123300015374Arabidopsis RhizosphereRKHAKDLHRFAILVGESAISSEMQKRVREMIKTFLERARVKLEAEPAIEQEPILDSPA*
Ga0190265_1247260713300018422SoilQHVELRRSHARDLHRLAALIGEGAISSEMQKRVSEMIKTFLERARVKLEGESLGEQEAEA
Ga0190275_1334400213300018432SoilKDLHRFAILVGESAISAEMQKRVREMIKTFLERARVKLEGEESLEQEAMLDSPA
Ga0190268_1118644123300018466SoilRFAILVGEGRISAEMQKRVREMIVTFLERARVKLEGEEPLEQDAMLDQPA
Ga0190274_1284603513300018476SoilEMQKRVREMIKTFLERARVKLEEESLEQEAMLDSPA
Ga0182009_1046020213300021445SoilAEMQKRVREMIKTFLERARVKLEGDEQIESEGMLDSPA
Ga0247667_101899213300024290SoilEGRISNEMQKRVREMIKTFLERARVKLETEEPIEPDGLLDSPA
Ga0207647_1080028923300025904Corn RhizosphereGRISSEMQKRVREMIKTFLERAREKLETEPGLEQEPILDTPA
Ga0207643_1071869913300025908Miscanthus RhizosphereESAISSEMQKRVKEMIKTFLERARVKLETEPVIEQEPILDSPA
Ga0207684_1016398413300025910Corn, Switchgrass And Miscanthus RhizosphereAILVGESAISGEMQKRVREMIKTFLERARVKLEGEESLEQEAMADSPA
Ga0207654_1069738713300025911Corn RhizosphereLAILVGEGRISAEMQKRVREMIKTFLERARVKLEEEPEQEEMLESPA
Ga0207660_1023968523300025917Corn RhizosphereRFAMLLGESAISAEMQKRVREMIKTFLARAQERLESDTLPEQEPALDPAS
Ga0207659_1123144313300025926Miscanthus RhizosphereLHRFATLVGEGRISAEMQKRVREMIITFLERARVKLEGEEGGNLEQDAMIDQPA
Ga0207701_1084950913300025930Corn, Switchgrass And Miscanthus RhizosphereAILVGEGRINAEMQKRVREMIVTFLERARVQLEGEEGGNLEQDAMLDQPA
Ga0207706_1055256413300025933Corn RhizosphereLVGEGRISAEMQDRVREMIKTFLERARVKLESETSVDPEPILDTPA
Ga0207706_1147170523300025933Corn RhizosphereELHRFATLVGEGRISAEMQKRVREMIITFLERARVKLEGEEGGNLEQDAMIDQPA
Ga0207686_1137920713300025934Miscanthus RhizosphereRKHARDLHRFAVLLGESAISAEMQKRVREMIKTFLVRAQERLENETLPEQEPALDTAS
Ga0207709_1030886623300025935Miscanthus RhizosphereSAEMQKRVREMIKTFLERARVKLEGEETLDQEAMLDSPA
Ga0207665_1157313623300025939Corn, Switchgrass And Miscanthus RhizosphereLVGESAISAEMQKRVREMIKTFLERARVKLEGEELDQEPLLDSPA
Ga0207651_1108780713300025960Switchgrass RhizosphereQKRVREMIKTFLVRAQERLENETLPEQEPALDTAS
Ga0207651_1200166423300025960Switchgrass RhizosphereGESAISAEMQKRVREMIKTFLERARVKLEELEGEEPIDQAEMLDSPA
Ga0207668_1118836123300025972Switchgrass RhizosphereGEGRISAEMQDRVREMIKTFLERARVKLEGETSVDPEPILDTPA
Ga0207640_1102370223300025981Corn RhizosphereDLHRFAVLLGESAISAEMQKRVREMIKTFLVRAQERLENETLPEQEPALDTAS
Ga0207703_1013865323300026035Switchgrass RhizosphereLHRLAILVGEGRISAEMQKRVREMIKTFLERARVKLEAEESLDLDSEGMLDSPA
Ga0207702_1008546623300026078Corn RhizosphereKHAKDLHRFAILVGEGRISSEMQKRVREMIKTFLERAREKLETETSVDPEVLADSPA
Ga0207648_1008317823300026089Miscanthus RhizosphereARDLHRFAVLLGESAISAEMQKRVREMIKTFLVRAQERLENETLPEQEPALDTAS
Ga0207676_1079849113300026095Switchgrass RhizosphereGETAISAEMQKRVREMIKTFLERARVKLEALEGEESLEQEPLLDSPA
Ga0207676_1136848323300026095Switchgrass RhizosphereMEPHRLAILVGEGRISNEMQKRVREMIKTFLERARVKLEEEPEQEELLESPA
Ga0207676_1211191513300026095Switchgrass RhizosphereELRRKHAKDLHRFAVLVGEGRINAEMQKRVREMIKTFLERARVKLEGEEGDLDQEGMLDQPA
Ga0207683_1150692313300026121Miscanthus RhizosphereILVGESAISSEMQKRVKEMIKTFLERARVKLETEPVIEQEPILDSPA
Ga0209984_107013613300027424Arabidopsis Thaliana RhizosphereISAEMQKRVREMIKTFLARAQERLESDTLPEQEPALDTAS
Ga0209485_100718523300027691Agricultural SoilQKRVHEMIKTFLERARVKLEGEEPLEQEAMADSPA
Ga0268266_1175634113300028379Switchgrass RhizosphereVGEGRISAEMQDRVREMIKTFLERARVKLEGETSVDPEPILDTPA
Ga0268265_1121921523300028380Switchgrass RhizosphereHRLAILVGEGRISAEMQKRVREMIKTFLERARVKLEAEESLDLDSEGMLDSPA
Ga0268265_1124682523300028380Switchgrass RhizosphereISAEMQKRVREMIKTFLARAQERLESETLPEQEPALDTAS
Ga0307504_1027095623300028792SoilRPHARDLHRFAALVGEGAISSEMQKRVGEMIKTFLERARVKLEGESAVEQEAATFCRS
(restricted) Ga0255311_114009223300031150Sandy SoilRKHAKDLHRFAILVGEGAISSEMQKRVREMIKTFLERARVKLEAESVIEQEPILDTPA
Ga0307405_1167691313300031731RhizosphereLHRFAILVGESAISNEMQKRVREMIKTFLERARVKLEGEEPLEQEAMLDSPA
Ga0307410_1115216423300031852RhizosphereILVGESAISNEMQKRVREMIKTFLERARVKLEGEEPLEQEAMLDSPA
Ga0307406_1009823823300031901RhizosphereKDLHRFAILVGESAISAEMQKRVREMIKTFLERARVKLEGEETIEQEAMADSPA
Ga0307412_1026419513300031911RhizosphereMQKRVREMIKTFLERARVKLEGEETIEQEAMADSPA
Ga0307409_10297522613300031995RhizosphereAISNEMQKRVREMIKTFLERARVKLEGEETIEQEAMADSPA
Ga0307416_10045489613300032002RhizosphereDLHRFAILVGEGAISAEMQKRVREMIKTFLERARVKLETEEPLDQEAILDSPA
Ga0307411_1141264823300032005RhizosphereILVGESAISAEMQKRVREMIKTFLERARVKLEGEESLEQEGMLDSPA

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.