| Basic Information | |
|---|---|
| Family ID | F060238 |
| Family Type | Metagenome |
| Number of Sequences | 133 |
| Average Sequence Length | 41 residues |
| Representative Sequence | EVVSGDLLHDNTNLQEIKSGLQPGQQVVTNALVLDHVLAQ |
| Number of Associated Samples | 108 |
| Number of Associated Scaffolds | 133 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.25 % |
| % of genes from short scaffolds (< 2000 bps) | 93.98 % |
| Associated GOLD sequencing projects | 101 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.14 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (90.977 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (9.774 % of family members) |
| Environment Ontology (ENVO) | Unclassified (34.586 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.128 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 41.18% β-sheet: 0.00% Coil/Unstructured: 58.82% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.14 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 133 Family Scaffolds |
|---|---|---|
| PF00873 | ACR_tran | 97.74 |
| PF02321 | OEP | 0.75 |
| PF12700 | HlyD_2 | 0.75 |
| COG ID | Name | Functional Category | % Frequency in 133 Family Scaffolds |
|---|---|---|---|
| COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 1.50 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 90.98 % |
| All Organisms | root | All Organisms | 9.02 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.77% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 9.02% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 7.52% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 6.77% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 6.77% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 6.02% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 6.02% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 5.26% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 4.51% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.51% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.51% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.76% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.26% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.26% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.26% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 2.26% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 2.26% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 2.26% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.50% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.50% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.50% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.75% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.75% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.75% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.75% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.75% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.75% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.75% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.75% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.75% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006642 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009617 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_100 | Environmental | Open in IMG/M |
| 3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
| 3300009644 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 | Environmental | Open in IMG/M |
| 3300009645 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 | Environmental | Open in IMG/M |
| 3300009646 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150 | Environmental | Open in IMG/M |
| 3300009662 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-060 | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014153 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaG | Environmental | Open in IMG/M |
| 3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
| 3300014160 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaG | Environmental | Open in IMG/M |
| 3300014199 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014496 | Permafrost microbial communities from Stordalen Mire, Sweden - 711E1D metaG | Environmental | Open in IMG/M |
| 3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
| 3300014839 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
| 3300017941 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017988 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaG | Environmental | Open in IMG/M |
| 3300017996 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_40 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018024 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100 | Environmental | Open in IMG/M |
| 3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
| 3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300019788 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300023030 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU2 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025320 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025473 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025500 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025878 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes) | Environmental | Open in IMG/M |
| 3300026281 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes) | Environmental | Open in IMG/M |
| 3300027605 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028036 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 | Host-Associated | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028560 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_2 | Environmental | Open in IMG/M |
| 3300028788 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_2 | Environmental | Open in IMG/M |
| 3300029945 | I_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Host-Associated | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033891 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-1-D | Environmental | Open in IMG/M |
| 3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12270J11330_100154594 | 3300000567 | Peatlands Soil | RLEVVSGDPLAENTNLQEIKRGIQPGQQVVTNALVLDHVLAQ* |
| JGI12270J11330_102835212 | 3300000567 | Peatlands Soil | DFVFVPAPDNKFRRLEVVSGDLLSDNLDMQEVKSGIAPGQQLVTNALVLDHVLGQ* |
| JGI12712J15308_100220292 | 3300001471 | Forest Soil | MEVVSGDVLTENASLQEIKSGLKPGQQVVTNALVLDHVLAQ* |
| JGI12635J15846_100691451 | 3300001593 | Forest Soil | VGGDVMPDNSNLQEIKSGLKPGQQVVTNALVLDHVLAQ* |
| JGI12635J15846_103871351 | 3300001593 | Forest Soil | LEVVSGDLLPENVSLQEVKSGLHPGQQVVTNALVLDHVLAQ* |
| JGI12635J15846_104574162 | 3300001593 | Forest Soil | VEVVGGDVLQDNTSVQELKSGLKPGDQVVTNALVLDHVLGQ* |
| JGIcombinedJ26739_1004327991 | 3300002245 | Forest Soil | EVVSGDLLHDNTNLQEIKSGLQPGQQVVTNALVLDHVLAQ* |
| JGIcombinedJ26739_1010351121 | 3300002245 | Forest Soil | GGDLVQENTDLQEIKSGLEPGQQVVTNALVLDHVLAQ* |
| Ga0062387_1009915021 | 3300004091 | Bog Forest Soil | NRFRRVEILGGELLDDNTSLQEVKSGLKPGDQVVTNALVLDHVLGQ* |
| Ga0062386_1003947942 | 3300004152 | Bog Forest Soil | PGNKFRRVEIVSGDLLQENTDLQEVASGLKPGERVVTNALVLDHVLTQ* |
| Ga0070731_104222821 | 3300005538 | Surface Soil | LLADNVNAQEIKSGLKPGQQVVTNALVLDHVIGQ* |
| Ga0070731_105767741 | 3300005538 | Surface Soil | KKFRRLEVVGGDLLTDNTNLQEVKSGLAPGQQVVTNALVLDHVLAQ* |
| Ga0070762_110237602 | 3300005602 | Soil | DLSQENTDLQEIKSGIAPGQQVVTNALVLDHVLAQ* |
| Ga0070763_106959501 | 3300005610 | Soil | GGDLLTENTNLQEVKSGLAPGERVVTNALVLDHVLAQ* |
| Ga0070763_109233991 | 3300005610 | Soil | GDVLNENTSLQEVKSGLKPGDQVITNALVLDHVLAQ* |
| Ga0070764_102051142 | 3300005712 | Soil | RRVEVVAGDLVQSNTSLREIKSGLKPGDQVVTNALVLDHVLAQ* |
| Ga0066903_1075189301 | 3300005764 | Tropical Forest Soil | VGGDLLSDDTSLQEIKSGLQPGQQVVTNALVLDHVLGQ* |
| Ga0075017_1005084051 | 3300006059 | Watersheds | VLNENTSLQEIKSGLKPGQQVVTNALVLDHVLSQ* |
| Ga0075015_1003622712 | 3300006102 | Watersheds | LEVISGDLLPDHMDLQEIKSGLTPGQQVVTNALVLDHVLAQ* |
| Ga0075015_1009794352 | 3300006102 | Watersheds | RDFVFVPAAGNKFRRLEVVGGDLLQDNTSLQEIKSGLKPGDRMVTNALVLDHVLGQ* |
| Ga0075030_1007380091 | 3300006162 | Watersheds | VIGGDLLPENTSLQELTSGLEPGQQVVTNALVLDHVLGQ* |
| Ga0075014_1006265262 | 3300006174 | Watersheds | VLTENTSLQEIKSGLKPGQQVVTNALVLDHVLAQ* |
| Ga0070765_1018680452 | 3300006176 | Soil | LLPEDVSLQEVKSGLQPGQQVVTNALVLDHVLAQ* |
| Ga0075521_101574531 | 3300006642 | Arctic Peat Soil | GELLQDNTNLQEIKSGLKPGQQVVTNALVLDHVLAQ* |
| Ga0116222_11862582 | 3300009521 | Peatlands Soil | VEVVSGDVLSDNTNLQEIKSGLKPGQQVVTNALVLDHVLAQ* |
| Ga0116222_13550151 | 3300009521 | Peatlands Soil | ELLPTNVNLQEIKSGLKPGQQVVTNALVLDHVLAQ* |
| Ga0116220_104745331 | 3300009525 | Peatlands Soil | DKKFRRVEVVSGDVLTENTNLQEIKSGLKPGQEVVTNALVLDHVLAQ* |
| Ga0116123_10118832 | 3300009617 | Peatland | VEVVSGDVLTENTNLQEIKSGLKPGQQVVTNALVLDHVLAQ* |
| Ga0116105_12355832 | 3300009624 | Peatland | SVVSGDVLPDNSNLQEIKSGLKPGEQVVTNALVLDHVLAQ* |
| Ga0116121_12206381 | 3300009644 | Peatland | PDKKFRRLEVVSGDPLAENTNLQEIKRGIQPGQQVVTNALVLDHVLAQ* |
| Ga0116106_11907291 | 3300009645 | Peatland | VLQDHTDLQEIKSGLEPGQQVVTNALVLDHVLAQ* |
| Ga0116132_10875512 | 3300009646 | Peatland | GDVLQDHTDLQEIKSGLKPGQQVVTNALVLDHVLAQ* |
| Ga0105856_10121372 | 3300009662 | Permafrost Soil | FRRVEVISGDLLQDNMTLQEIKSGLEPGQQLVTNALVLDHVLKQ* |
| Ga0116223_106055192 | 3300009839 | Peatlands Soil | APDKKFRRLEVVSGDPLAENTNLQEIKRGIQPGQQVVTNALVLDHVLAQ* |
| Ga0074046_107755692 | 3300010339 | Bog Forest Soil | GDVLTENMSLQEIMSGLKPGQQVVTNALVLDHVLAQ* |
| Ga0126381_1046204222 | 3300010376 | Tropical Forest Soil | VVGGDLLSDDTSLQEIKSGLQPGQQVVTNALVLDHVLGQ* |
| Ga0136449_1034069842 | 3300010379 | Peatlands Soil | FVFVPAPDKKFRRLEVVGGDLLPQNTSLQEIKSGLKPGQLVVTNALVLDHVIAQ* |
| Ga0126369_135547622 | 3300012971 | Tropical Forest Soil | SGDLQQDDTGLQEIKSGIQPGQQVVTNALVLDHVLGQ* |
| Ga0181527_11306801 | 3300014153 | Bog | GELLPDNKELQEIKKGLDPGQRVVANALVLDHALGQ* |
| Ga0181527_13848472 | 3300014153 | Bog | VSGDVLPNDTSLQEIKSGLQPGQQVVTNSLVLDHVLAQ* |
| Ga0181518_102166491 | 3300014156 | Bog | ELLPDNKELQEIKKGLEPGQQVVAKALVLDHALGQ* |
| Ga0181517_101290582 | 3300014160 | Bog | RVEVVSGDVLDDNTSLQEVRSGLEPGQQLVKDALVLDHVLGQ* |
| Ga0181535_103500072 | 3300014199 | Bog | GDVLSENTSLQEIKSGLKPGQQVVTNALVLDHVLAQ* |
| Ga0181526_103924962 | 3300014200 | Bog | FRRVEVVGGVLLTDNVNLQEVKSGLQPGQQVVTNALVLDHVLAQ* |
| Ga0182011_103787782 | 3300014496 | Fen | FRRVEVVGGDVLSNDTSMQEIKSGLEPGQEVVTNSLVLDHVLAQ* |
| Ga0181525_101078251 | 3300014654 | Bog | APDKKFRRVEVVGGDLLTENTNLQEIKSGIGPGQQVVTNALVLDHVLAQ* |
| Ga0182027_112462141 | 3300014839 | Fen | DLLTDNVNLQEIKSGLQPGQQVVTNALVLDHVLAQ* |
| Ga0182041_118422402 | 3300016294 | Soil | FVPVADKKFRRIEVVGGDLLKEDTKLQEIKSGLMPGQKVVTNALVLDHVLTQ |
| Ga0182035_121965172 | 3300016341 | Soil | FRRLEVVSGDLQQDDTGLQEIKSGIQPGQQVVTNALVLDHVLGQ |
| Ga0187802_101054481 | 3300017822 | Freshwater Sediment | RDFVFVPAPENKFRRLEVVSGDLLADNTELQEIKSGLKSGQQVVTNALVLDHVLAQ |
| Ga0187825_102801201 | 3300017930 | Freshwater Sediment | RVEVQGGDLLPENTSLQEIRSGLQPGQRVVTNALVLDHVLGQ |
| Ga0187814_104139341 | 3300017932 | Freshwater Sediment | EVVGGDLLTDNTSLQEVKSGLKPGDQVVTNALVLDHVLGQ |
| Ga0187801_104761462 | 3300017933 | Freshwater Sediment | AADKKFRRLEVVSGGLLPDNMSMQEIKSGLEPGQEVVTNALVLDHVLAQ |
| Ga0187801_105026442 | 3300017933 | Freshwater Sediment | FRRVEVVSGDLLPENLTLQEIKSGLNPGAHVVSNALVLDHVLGQ |
| Ga0187853_100467431 | 3300017940 | Peatland | GDVVQDHTDLQEIKSGLEPGQQVVTNALVLDHVLAQ |
| Ga0187850_100818992 | 3300017941 | Peatland | GDVLPDNTNLQEIKSGLKPGQQVVTNALVLDHVLAQ |
| Ga0187850_102320741 | 3300017941 | Peatland | RLEVVSGELLPDNMNLQEIKTGLRPGQQVVTNALVLDQVLSQ |
| Ga0187808_103093101 | 3300017942 | Freshwater Sediment | KKFRRVEVVSGDLLTDNTSLQEVKSGLKPGDQVVTNALVLDHVLGQ |
| Ga0187819_107788321 | 3300017943 | Freshwater Sediment | VPAPENKFRRVEVVSGDLLQNDTSLQEIRSGLKPGDQVVTNALVLDHVIGQ |
| Ga0187847_107139631 | 3300017948 | Peatland | VEVVSGDVLQDHTDLQEIKSGLEPGQQVVTNALVLDHVLAQ |
| Ga0187779_113842041 | 3300017959 | Tropical Peatland | VEVVGGDLLESDKTHQEIKSGIEPGQRVVSNALVLDHVLAQ |
| Ga0187777_102706531 | 3300017974 | Tropical Peatland | FRRVEVVGGELLNENTSLQEVKAGLKPGDRVVTNALVLDHVLGQ |
| Ga0181520_109101291 | 3300017988 | Bog | GDLLPDNVELQEVKSGLKPGDQVVTNALVLDHVLAQ |
| Ga0187891_12453972 | 3300017996 | Peatland | RRLEVVSGDPLAENTNLQEIKRGIQPGQQVVTNALVLDHVLAQ |
| Ga0187805_103133222 | 3300018007 | Freshwater Sediment | EVVSGDVLTENTSLQEIKSGLKPGQQVVTNALVLDHVLAQ |
| Ga0187810_104882992 | 3300018012 | Freshwater Sediment | EVVSGDLLPTNMNLQEIKSGLKPGQQVVTNALVLDHVLAQ |
| Ga0187881_101837521 | 3300018024 | Peatland | RLEVVSGDPLAENTNLQEIKRGIQPGQQVVTNALVLDHVLAQ |
| Ga0187867_100700362 | 3300018033 | Peatland | EVVGGDVLQDHTDLQEIKSGLEPGQQVVTNALVLDHVLAQ |
| Ga0187867_106880542 | 3300018033 | Peatland | VEVVGGDVLQDHTDLQEIKSGLEPGQQVVTNALVLDHVLAQ |
| Ga0187875_100191931 | 3300018035 | Peatland | GDVLQDHTDLQEIKSGLEPGQQVVTNALVLDHVLAQ |
| Ga0187875_103207611 | 3300018035 | Peatland | GNKFRRVEVVGGDVLNDNTNLQEVKSGLKPGDQVIINALVLDHVLGQ |
| Ga0187883_104641101 | 3300018037 | Peatland | PDKKFRRVEVVSGDVLTENTNLQEIKSGLKPGQQVVTTALVLDHVLAQ |
| Ga0187890_101481272 | 3300018044 | Peatland | EDKKFRRLEVVSGELLPDNMNLQEIKTGLRPGQHVVTNALVLDQVLSQ |
| Ga0187766_107566602 | 3300018058 | Tropical Peatland | VEVVGGDLLPENKDLQEIKSGLKPGQQLVSNALVLDHVIAQ |
| Ga0187766_111723272 | 3300018058 | Tropical Peatland | VEVVSGDLLSTNMSLQEVKSGLKPGQQVVTNALVLDHVLSQ |
| Ga0187770_113224801 | 3300018090 | Tropical Peatland | GDLVADNLSLQEIKSGLQPGQQVVTNALVLDHVLAQ |
| Ga0187770_114333412 | 3300018090 | Tropical Peatland | VEVVSGDVLPDNMSLQEIKSGLQPGQQVVTNALVLDHALAQ |
| Ga0182028_11021031 | 3300019788 | Fen | VSGDVLQDHTDLQEIKSGLEPGQQVVTNALVLDHVLAQ |
| Ga0210401_108657572 | 3300020583 | Soil | GGDLLADNVSMQEIKSGLEPGQQVVTNALVLDHVLGQ |
| Ga0210400_108330071 | 3300021170 | Soil | SGDLLDNNTNLQEIKSGLGPGQQVVTNALVLDHVLGQ |
| Ga0210400_114159102 | 3300021170 | Soil | GDLLANNVTLQEVKSGLEPGQQVVTNALVLDHVLGQ |
| Ga0210408_107686042 | 3300021178 | Soil | GDLLQSNTNLQEIKSGLAPGQQVVTNALVLDHVLAQ |
| Ga0210393_116969061 | 3300021401 | Soil | FVPAPDKKFRRVEVVGGDLLQENTDLQEIKSGIAPGQRVVTNALVLDHVLAQ |
| Ga0210389_110973791 | 3300021404 | Soil | DLLNDNTSLQEIKSGLTPGQQVVTNALVLDHVLGQ |
| Ga0210384_103356051 | 3300021432 | Soil | EVVSGDVLTENTNLQEIKSGLKPGQQVVTNALVLDHVLAQ |
| Ga0210384_104907181 | 3300021432 | Soil | GGDLLPDNVSLQEIKSGLEPGQRVVTNALVLDHVLAQ |
| Ga0210390_102164742 | 3300021474 | Soil | AGKKFRRVEVVGGDLLTENTNLQEVKSGIRPGEQVVTNALVLDHVLGQ |
| Ga0210390_108973882 | 3300021474 | Soil | GDVLQNNTDLQEVKSGLKPGDQVVTNALVLDHVLGQ |
| Ga0210392_107430732 | 3300021475 | Soil | SGDSLANNLQEITSGLKPGQRVVTNALVLEHTIDQ |
| Ga0210402_100459334 | 3300021478 | Soil | VSGDVLTENTNLQEIKSGLKPGQQVVTNALVLDHVLAQ |
| Ga0210402_103064562 | 3300021478 | Soil | RRLEVVGGDLLPENTDMQEIRSGLAPGQQVVTNALVLDHVLAQ |
| Ga0224561_10022421 | 3300023030 | Soil | DVLTENTNLQEIKSGLKPGQQVVTNALVLDHVLAQ |
| Ga0137417_11368071 | 3300024330 | Vadose Zone Soil | PAPDKKFRRLRLEVVSGDLLPDNSNLQEIKSGLKPGRQVVGNALVLDHVLAQ |
| Ga0209171_103375651 | 3300025320 | Iron-Sulfur Acid Spring | FRRVEVVSGDVLTENTNLQEIKSGLKPGQPVVTNALVLDHVLAQ |
| Ga0208190_10541542 | 3300025473 | Peatland | KFRRLEVVSGELLPDNMNLQEIKTGLRPGQHVVTNALVLDQVLSQ |
| Ga0208686_10572762 | 3300025500 | Peatland | VEVVSGDVLTENTNLQEIKSGLKPGQQVVTNALVLDHVLAQ |
| Ga0209584_101530282 | 3300025878 | Arctic Peat Soil | GELLQDNTNLQEIKSGLKPGQQVVTNALVLDHVLAQ |
| Ga0209863_100811641 | 3300026281 | Prmafrost Soil | PAPDKKFRRVDVVSGDLLPDNMNLQEIKSGLEPGQQLVTNALVLDHVLNQ |
| Ga0209329_10791121 | 3300027605 | Forest Soil | RVEVVAGRALEGNLQEIKSGLEPGQELVADALVLDHALEQ |
| Ga0209422_10141181 | 3300027629 | Forest Soil | VFVPTQDKKFRRVEVVSGELFSDNTSMQEIKSGLKPGQKVVTNALVLDHVLAQ |
| Ga0209448_103175401 | 3300027783 | Bog Forest Soil | PAPGKKFRRVEVVGGDLLPDNVNLQEVKSGLAPGEQVVTNALVLDHVLAQ |
| Ga0209517_101352462 | 3300027854 | Peatlands Soil | VYVPAPDKKFRRVEVVAGDLLIEDTNLQEIKSGLKPGDQVVTNALILDHVLSQ |
| Ga0209167_106109541 | 3300027867 | Surface Soil | RRVEVVGGDLVQDNTNLQEIKSGLEPGQQVVTNALVLDHVLGQ |
| Ga0209624_103565322 | 3300027895 | Forest Soil | RVEVVGGDLLPENLNLQEIKSGLEPGQQVVTNALVLDHVLAQ |
| Ga0209698_113282451 | 3300027911 | Watersheds | EVVSGDLLADNMTVQEIKSGLQPGQQVVTNALVLDHALAQ |
| Ga0265355_10094432 | 3300028036 | Rhizosphere | LEVVSGDVLTENTSLQEIRSGLKPGQQVVTNALVLDHVLAQ |
| Ga0209526_101632551 | 3300028047 | Forest Soil | VVSGDVLPDNTNLQEIRSGLKPGQQVVTNALVLDHVLAQ |
| Ga0302144_102960911 | 3300028560 | Bog | APGAKFRRVEVVSGDLLDNDTNMQEIRSGLEPGERVVTNALVLDHVLGQ |
| Ga0302189_101713162 | 3300028788 | Bog | PAPGAKFRRVEVVSGDLLDNDTNMQEIRSGLEPGERVVTNALVLDHVLGQ |
| Ga0311330_101812941 | 3300029945 | Bog | VIGGDLLADDGNMQEVKSGLQPGQQVVTNALVLDHVLAQ |
| Ga0311371_109489031 | 3300029951 | Palsa | GDLVQENTNLQEIRSGLEPGQQVVTNALVLDHVLAQ |
| Ga0170824_1072164711 | 3300031231 | Forest Soil | GGDLLSANVNMQEIKSGLEPGQQVVTNALVLDHVLAQ |
| Ga0170824_1222480261 | 3300031231 | Forest Soil | VEVVGGDLLQENTSLQEISSGLEPGQQVVTNALVLDHVLGQ |
| Ga0265342_105758152 | 3300031712 | Rhizosphere | DLVQENTSLQEISSGLEPGQQVVTNALVLDHVLGQ |
| Ga0265342_106350661 | 3300031712 | Rhizosphere | FVYVPAPDRKFRRVEVVGGDLLSDNTSMQEVKSGLNPGDQVVTNALTLDHVLSQ |
| Ga0307474_111890452 | 3300031718 | Hardwood Forest Soil | YVPAAGKKFRRVEVVGGDLLTGNTNLQEVKSGIKPGEQVVTNALVLDHVLGQ |
| Ga0307477_108648291 | 3300031753 | Hardwood Forest Soil | FRRLEVVSGDLLPDNMQEIRSGIAPGQQLVTNALILDHVIAQ |
| Ga0307475_114288711 | 3300031754 | Hardwood Forest Soil | RVEVVGGDLLSANVNMQEIKSGLEPGQQVVTNALVLDHVLAQ |
| Ga0307478_107126742 | 3300031823 | Hardwood Forest Soil | RRVEVVSGELLSDNTSMQEIKSGLKPGQQVVTNALVLDHVLAQ |
| Ga0307478_110266872 | 3300031823 | Hardwood Forest Soil | VSGDVLQNNTDLQEVKSGLKPGDQVVTNALVLDHVLGQ |
| Ga0307479_103683271 | 3300031962 | Hardwood Forest Soil | EVVSGDVLTENTNLQEIKSGLRPGQQVVTNALVLDHVLAQ |
| Ga0306924_123257451 | 3300032076 | Soil | VSGDLLAGNTQLQEIKSGLTPGQQVITNALVLDHVLSQ |
| Ga0311301_114859392 | 3300032160 | Peatlands Soil | RSGDVLTENTSLQEIKSGLKPGQQVVTNALVLDHVLAQ |
| Ga0335082_107535731 | 3300032782 | Soil | GDLLAENTSLQEIKSGLQPGQQVVTNALVLDKVLGQ |
| Ga0335082_112854742 | 3300032782 | Soil | VEVVGGDVLQDNTSLQEIKSGIQPGQQVVTNALVLDHVLGQ |
| Ga0335079_110688261 | 3300032783 | Soil | VSGDLLQENTSLQEIKSGLEPGQQVVTNALVLDHVLAQ |
| Ga0335078_116567852 | 3300032805 | Soil | EVVGGDLLSDNVNLQEVRSGLQPGQQVVTNALVLDHVLAQ |
| Ga0335078_127371672 | 3300032805 | Soil | EVVGGDLLSDNVNLQEIKTGIGPGQKVVTNALVLDHVLGQ |
| Ga0335081_107646142 | 3300032892 | Soil | VSGDLLQDNTSLQEIKSGLQPGQQVVTNALVLDHVLAQ |
| Ga0335081_109694542 | 3300032892 | Soil | FRRLEVLGGDLSPDDGTMQEIKRGLEPGQPVVTNALVLDHVLAQ |
| Ga0335077_117129762 | 3300033158 | Soil | GGDLLADNTTLQEIKSGLSPGQQVVSNALVLDHVLAQ |
| Ga0334811_118471_1_108 | 3300033891 | Soil | DVLTDNVTLQEVASGLQPGQQVVTNALVLDHVLTQ |
| Ga0370515_0285496_1_129 | 3300034163 | Untreated Peat Soil | RLSVVSGDVLPDNSNLQEIKSGLKPGEQVVTNALVLDHVLAQ |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |