Basic Information | |
---|---|
Family ID | F060198 |
Family Type | Metagenome |
Number of Sequences | 133 |
Average Sequence Length | 50 residues |
Representative Sequence | MLALTLLVAIAALVAWALLIFGGVTTAGVTHLLLAVGIVLLVRWWALRA |
Number of Associated Samples | 117 |
Number of Associated Scaffolds | 133 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 90.91 % |
% of genes near scaffold ends (potentially truncated) | 16.54 % |
% of genes from short scaffolds (< 2000 bps) | 88.72 % |
Associated GOLD sequencing projects | 110 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.75 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (58.647 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (12.030 % of family members) |
Environment Ontology (ENVO) | Unclassified (29.323 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (33.835 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 55.84% β-sheet: 0.00% Coil/Unstructured: 44.16% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.75 |
Powered by PDBe Molstar |
SCOP family | SCOP domain | Representative PDB | TM-score |
---|---|---|---|
a.62.1.0: automated matches | d6ygia_ | 6ygi | 0.85669 |
a.2.17.3: VPS37 C-terminal domain-like | d2f66c1 | 2f66 | 0.84154 |
a.25.3.0: automated matches | d2vs0a_ | 2vs0 | 0.83592 |
a.25.1.1: Ferritin | d2fjca1 | 2fjc | 0.82638 |
a.102.1.0: automated matches | d3qrya_ | 3qry | 0.81949 |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 133 Family Scaffolds |
---|---|---|
PF01242 | PTPS | 24.06 |
PF02397 | Bac_transf | 21.80 |
PF01227 | GTP_cyclohydroI | 7.52 |
PF00106 | adh_short | 3.01 |
PF00535 | Glycos_transf_2 | 0.75 |
PF00685 | Sulfotransfer_1 | 0.75 |
COG ID | Name | Functional Category | % Frequency in 133 Family Scaffolds |
---|---|---|---|
COG0720 | 6-pyruvoyl-tetrahydropterin synthase | Coenzyme transport and metabolism [H] | 24.06 |
COG2148 | Sugar transferase involved in LPS biosynthesis (colanic, teichoic acid) | Cell wall/membrane/envelope biogenesis [M] | 21.80 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 58.65 % |
Unclassified | root | N/A | 41.35 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2199352024|deeps__Contig_188396 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1064 | Open in IMG/M |
3300000891|JGI10214J12806_12545005 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 784 | Open in IMG/M |
3300002568|C688J35102_119988907 | Not Available | 837 | Open in IMG/M |
3300003321|soilH1_10022797 | All Organisms → cellular organisms → Bacteria | 1719 | Open in IMG/M |
3300003321|soilH1_10048849 | All Organisms → cellular organisms → Bacteria | 1810 | Open in IMG/M |
3300003323|rootH1_10257397 | All Organisms → cellular organisms → Bacteria | 1017 | Open in IMG/M |
3300003990|Ga0055455_10031076 | All Organisms → cellular organisms → Bacteria | 1381 | Open in IMG/M |
3300004020|Ga0055440_10013757 | All Organisms → cellular organisms → Bacteria | 1502 | Open in IMG/M |
3300004157|Ga0062590_100203012 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium HGW-Gemmatimonadetes-1 | 1435 | Open in IMG/M |
3300004463|Ga0063356_100366351 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1832 | Open in IMG/M |
3300004479|Ga0062595_100819622 | Not Available | 770 | Open in IMG/M |
3300004479|Ga0062595_100822542 | Not Available | 769 | Open in IMG/M |
3300004479|Ga0062595_100885345 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
3300004643|Ga0062591_101067066 | Not Available | 775 | Open in IMG/M |
3300004778|Ga0062383_10070386 | All Organisms → cellular organisms → Bacteria | 1431 | Open in IMG/M |
3300004781|Ga0062379_10084601 | Not Available | 710 | Open in IMG/M |
3300005175|Ga0066673_10785325 | Not Available | 545 | Open in IMG/M |
3300005434|Ga0070709_10150311 | All Organisms → cellular organisms → Bacteria | 1609 | Open in IMG/M |
3300005439|Ga0070711_100088384 | All Organisms → cellular organisms → Bacteria | 2226 | Open in IMG/M |
3300005439|Ga0070711_100718866 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 842 | Open in IMG/M |
3300005440|Ga0070705_100253403 | All Organisms → cellular organisms → Bacteria | 1237 | Open in IMG/M |
3300005445|Ga0070708_100189170 | All Organisms → cellular organisms → Bacteria | 1925 | Open in IMG/M |
3300005455|Ga0070663_100822642 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium HGW-Gemmatimonadetes-1 | 798 | Open in IMG/M |
3300005458|Ga0070681_10098490 | All Organisms → cellular organisms → Bacteria | 2870 | Open in IMG/M |
3300005536|Ga0070697_100589307 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 977 | Open in IMG/M |
3300005546|Ga0070696_101701349 | Not Available | 544 | Open in IMG/M |
3300005547|Ga0070693_100108584 | All Organisms → cellular organisms → Bacteria | 1703 | Open in IMG/M |
3300005553|Ga0066695_10545919 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium HGW-Gemmatimonadetes-1 | 705 | Open in IMG/M |
3300005564|Ga0070664_102107718 | Not Available | 535 | Open in IMG/M |
3300005577|Ga0068857_101274602 | Not Available | 713 | Open in IMG/M |
3300005764|Ga0066903_107313996 | Not Available | 571 | Open in IMG/M |
3300005841|Ga0068863_101514066 | Not Available | 679 | Open in IMG/M |
3300005841|Ga0068863_102429067 | Not Available | 534 | Open in IMG/M |
3300005874|Ga0075288_1079439 | Not Available | 534 | Open in IMG/M |
3300005885|Ga0075284_1016192 | Not Available | 887 | Open in IMG/M |
3300005887|Ga0075292_1041600 | Not Available | 651 | Open in IMG/M |
3300006034|Ga0066656_10135791 | All Organisms → cellular organisms → Bacteria | 1527 | Open in IMG/M |
3300006175|Ga0070712_101366688 | Not Available | 618 | Open in IMG/M |
3300006755|Ga0079222_10095750 | All Organisms → cellular organisms → Bacteria | 1544 | Open in IMG/M |
3300006755|Ga0079222_10140841 | All Organisms → cellular organisms → Bacteria | 1352 | Open in IMG/M |
3300006755|Ga0079222_10708352 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
3300006846|Ga0075430_100860343 | Not Available | 747 | Open in IMG/M |
3300006847|Ga0075431_101897186 | Not Available | 551 | Open in IMG/M |
3300006852|Ga0075433_10037341 | All Organisms → cellular organisms → Bacteria | 4190 | Open in IMG/M |
3300006854|Ga0075425_100613756 | All Organisms → cellular organisms → Bacteria | 1251 | Open in IMG/M |
3300006871|Ga0075434_102187429 | Not Available | 557 | Open in IMG/M |
3300006954|Ga0079219_10002982 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 4706 | Open in IMG/M |
3300007076|Ga0075435_101266439 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 646 | Open in IMG/M |
3300009012|Ga0066710_104902913 | Not Available | 501 | Open in IMG/M |
3300009090|Ga0099827_10129991 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium HGW-Gemmatimonadetes-1 | 2039 | Open in IMG/M |
3300009100|Ga0075418_10283973 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium HGW-Gemmatimonadetes-1 | 1763 | Open in IMG/M |
3300009137|Ga0066709_100873388 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium HGW-Gemmatimonadetes-1 | 1308 | Open in IMG/M |
3300010039|Ga0126309_10133454 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1316 | Open in IMG/M |
3300010041|Ga0126312_10525692 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium HGW-Gemmatimonadetes-1 | 848 | Open in IMG/M |
3300010041|Ga0126312_10691431 | Not Available | 736 | Open in IMG/M |
3300010044|Ga0126310_10650390 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 793 | Open in IMG/M |
3300010045|Ga0126311_11876615 | Not Available | 509 | Open in IMG/M |
3300010373|Ga0134128_13066671 | Not Available | 513 | Open in IMG/M |
3300010396|Ga0134126_10696186 | All Organisms → cellular organisms → Bacteria | 1155 | Open in IMG/M |
3300010397|Ga0134124_11221765 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium HGW-Gemmatimonadetes-1 | 772 | Open in IMG/M |
3300011431|Ga0137438_1021687 | All Organisms → cellular organisms → Bacteria | 1850 | Open in IMG/M |
3300011438|Ga0137451_1228995 | Not Available | 587 | Open in IMG/M |
3300011444|Ga0137463_1023875 | All Organisms → cellular organisms → Bacteria | 2206 | Open in IMG/M |
3300012201|Ga0137365_11053617 | Not Available | 588 | Open in IMG/M |
3300012204|Ga0137374_10615192 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium HGW-Gemmatimonadetes-1 | 826 | Open in IMG/M |
3300012208|Ga0137376_11341414 | Not Available | 606 | Open in IMG/M |
3300012212|Ga0150985_120740420 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 769 | Open in IMG/M |
3300012353|Ga0137367_10396674 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium HGW-Gemmatimonadetes-1 | 978 | Open in IMG/M |
3300012355|Ga0137369_10899305 | Not Available | 595 | Open in IMG/M |
3300012668|Ga0157216_10218919 | Not Available | 896 | Open in IMG/M |
3300012917|Ga0137395_10432152 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium HGW-Gemmatimonadetes-1 | 945 | Open in IMG/M |
3300012929|Ga0137404_11600404 | Not Available | 604 | Open in IMG/M |
3300012931|Ga0153915_13202212 | Not Available | 532 | Open in IMG/M |
3300012937|Ga0162653_100043960 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium HGW-Gemmatimonadetes-1 | 679 | Open in IMG/M |
3300012957|Ga0164303_10033943 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 2126 | Open in IMG/M |
3300012957|Ga0164303_10522504 | Not Available | 765 | Open in IMG/M |
3300012957|Ga0164303_11371485 | Not Available | 527 | Open in IMG/M |
3300012958|Ga0164299_10239779 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1076 | Open in IMG/M |
3300012986|Ga0164304_10524523 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 870 | Open in IMG/M |
3300012987|Ga0164307_10245904 | All Organisms → cellular organisms → Bacteria | 1245 | Open in IMG/M |
3300012989|Ga0164305_11780842 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 555 | Open in IMG/M |
3300014314|Ga0075316_1018586 | All Organisms → cellular organisms → Bacteria | 1340 | Open in IMG/M |
3300015371|Ga0132258_12576693 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium HGW-Gemmatimonadetes-1 | 1271 | Open in IMG/M |
3300017695|Ga0180121_10057184 | All Organisms → cellular organisms → Bacteria | 1379 | Open in IMG/M |
3300018000|Ga0184604_10174730 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium HGW-Gemmatimonadetes-1 | 722 | Open in IMG/M |
3300018000|Ga0184604_10223027 | Not Available | 654 | Open in IMG/M |
3300018028|Ga0184608_10015048 | All Organisms → cellular organisms → Bacteria | 2714 | Open in IMG/M |
3300018054|Ga0184621_10144246 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium HGW-Gemmatimonadetes-1 | 857 | Open in IMG/M |
3300018056|Ga0184623_10156552 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium HGW-Gemmatimonadetes-1 | 1053 | Open in IMG/M |
3300018059|Ga0184615_10708015 | Not Available | 511 | Open in IMG/M |
3300018066|Ga0184617_1023303 | All Organisms → cellular organisms → Bacteria | 1400 | Open in IMG/M |
3300018071|Ga0184618_10051542 | All Organisms → cellular organisms → Bacteria | 1498 | Open in IMG/M |
3300018429|Ga0190272_10260444 | All Organisms → cellular organisms → Bacteria | 1310 | Open in IMG/M |
3300018466|Ga0190268_11026994 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium HGW-Gemmatimonadetes-1 | 661 | Open in IMG/M |
3300018920|Ga0190273_10285078 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium HGW-Gemmatimonadetes-1 | 1094 | Open in IMG/M |
3300021080|Ga0210382_10163184 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium HGW-Gemmatimonadetes-1 | 959 | Open in IMG/M |
3300021090|Ga0210377_10789373 | Not Available | 514 | Open in IMG/M |
3300021413|Ga0193750_1039798 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium HGW-Gemmatimonadetes-1 | 1030 | Open in IMG/M |
3300021445|Ga0182009_10468418 | Not Available | 660 | Open in IMG/M |
3300022756|Ga0222622_10275182 | All Organisms → cellular organisms → Bacteria | 1150 | Open in IMG/M |
3300025313|Ga0209431_11243266 | Not Available | 506 | Open in IMG/M |
3300025326|Ga0209342_10638441 | Not Available | 862 | Open in IMG/M |
3300025538|Ga0210132_1028372 | Not Available | 794 | Open in IMG/M |
3300025552|Ga0210142_1004480 | All Organisms → cellular organisms → Bacteria | 2556 | Open in IMG/M |
3300025910|Ga0207684_11361825 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium HGW-Gemmatimonadetes-1 | 582 | Open in IMG/M |
3300025939|Ga0207665_10686516 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium HGW-Gemmatimonadetes-1 | 804 | Open in IMG/M |
3300025945|Ga0207679_12052980 | Not Available | 520 | Open in IMG/M |
3300026020|Ga0208531_1000838 | All Organisms → cellular organisms → Bacteria | 2513 | Open in IMG/M |
3300026088|Ga0207641_11380413 | Not Available | 705 | Open in IMG/M |
3300026095|Ga0207676_10086533 | All Organisms → cellular organisms → Bacteria | 2560 | Open in IMG/M |
3300027716|Ga0209682_10002616 | All Organisms → cellular organisms → Bacteria | 5269 | Open in IMG/M |
3300027735|Ga0209261_10056290 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium HGW-Gemmatimonadetes-1 | 990 | Open in IMG/M |
3300027882|Ga0209590_10646666 | Not Available | 679 | Open in IMG/M |
3300028380|Ga0268265_12523921 | Not Available | 520 | Open in IMG/M |
3300028718|Ga0307307_10051824 | All Organisms → cellular organisms → Bacteria | 1204 | Open in IMG/M |
3300028799|Ga0307284_10343471 | Not Available | 604 | Open in IMG/M |
3300028803|Ga0307281_10415969 | Not Available | 516 | Open in IMG/M |
3300028809|Ga0247824_10135049 | All Organisms → cellular organisms → Bacteria | 1319 | Open in IMG/M |
(restricted) 3300031197|Ga0255310_10231006 | Not Available | 522 | Open in IMG/M |
(restricted) 3300031248|Ga0255312_1123133 | Not Available | 639 | Open in IMG/M |
(restricted) 3300031248|Ga0255312_1170922 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium HGW-Gemmatimonadetes-1 | 544 | Open in IMG/M |
3300031548|Ga0307408_101033900 | Not Available | 759 | Open in IMG/M |
3300031548|Ga0307408_101618195 | Not Available | 615 | Open in IMG/M |
3300031548|Ga0307408_102122285 | Not Available | 542 | Open in IMG/M |
3300031824|Ga0307413_11849248 | Not Available | 541 | Open in IMG/M |
3300031824|Ga0307413_12167276 | Not Available | 504 | Open in IMG/M |
3300031938|Ga0308175_100012048 | All Organisms → cellular organisms → Bacteria | 6555 | Open in IMG/M |
3300031965|Ga0326597_11009132 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 840 | Open in IMG/M |
3300032002|Ga0307416_100067989 | All Organisms → cellular organisms → Bacteria | 2942 | Open in IMG/M |
3300032421|Ga0310812_10069553 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1397 | Open in IMG/M |
3300033486|Ga0316624_12052599 | Not Available | 531 | Open in IMG/M |
3300034817|Ga0373948_0195800 | Not Available | 525 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 12.03% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.27% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.77% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 6.02% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.26% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 4.51% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 3.76% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.76% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.76% |
Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 3.01% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 3.01% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.01% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 3.01% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 3.01% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 2.26% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.26% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.26% |
Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 2.26% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.50% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.50% |
Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 1.50% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.50% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.50% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.50% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 1.50% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.75% |
Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.75% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.75% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.75% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.75% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.75% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.75% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.75% |
Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.75% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.75% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.75% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.75% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.75% |
Sugarcane Root And Bulk Soil | Host-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil | 0.75% |
Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.75% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2199352024 | Bare-fallow DEEP SOIL | Environmental | Open in IMG/M |
3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300003321 | Sugarcane bulk soil Sample H1 | Environmental | Open in IMG/M |
3300003323 | Sugarcane root Sample H1 | Host-Associated | Open in IMG/M |
3300003990 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2 | Environmental | Open in IMG/M |
3300004020 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D2 | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300004778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh | Environmental | Open in IMG/M |
3300004781 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare2Fresh | Environmental | Open in IMG/M |
3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005874 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404 | Environmental | Open in IMG/M |
3300005885 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_401 | Environmental | Open in IMG/M |
3300005887 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_403 | Environmental | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300011431 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT157_2 | Environmental | Open in IMG/M |
3300011438 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT500_2 | Environmental | Open in IMG/M |
3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
3300012668 | Arctic soils microbial communities. Combined Assembly of 23 SPs | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
3300012937 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t5i015 | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300014314 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleA_D2 | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300017695 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ540 (21.06) (version 2) | Environmental | Open in IMG/M |
3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
3300018059 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coex | Environmental | Open in IMG/M |
3300018066 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1 | Environmental | Open in IMG/M |
3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
3300021090 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redo | Environmental | Open in IMG/M |
3300021413 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c1 | Environmental | Open in IMG/M |
3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300025313 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes) | Environmental | Open in IMG/M |
3300025326 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_2 (SPAdes) | Environmental | Open in IMG/M |
3300025538 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025552 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026020 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_403 (SPAdes) | Environmental | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027716 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare2Fresh (SPAdes) | Environmental | Open in IMG/M |
3300027735 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare1Fresh (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
3300028803 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120 | Environmental | Open in IMG/M |
3300028809 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48 | Environmental | Open in IMG/M |
3300031197 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH1_T0_E1 | Environmental | Open in IMG/M |
3300031248 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH5_T0_E5 | Environmental | Open in IMG/M |
3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
3300032421 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3 | Environmental | Open in IMG/M |
3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
deeps_03562710 | 2199352024 | Soil | MMALTLVTAIVSLVAWAVLIFGGITTSGVTHLLLALGTVLLVRWWALRG |
JGI10214J12806_125450051 | 3300000891 | Soil | MLPLTLAGAILALLAWAFIIFGGIATSGVTHLLLAVGTVLLVRWWALRA* |
C688J35102_1199889072 | 3300002568 | Soil | MLPQLSLIVSIVALVAWAFLIFGGVTTSGVTHLLLAVGTVLFVRWWALRA* |
soilH1_100227973 | 3300003321 | Sugarcane Root And Bulk Soil | MASTSLAPTLLAGLAALISWAILIFGGITSSGVTHLLLAVGTVLLVRWWALRT* |
soilH1_100488493 | 3300003321 | Sugarcane Root And Bulk Soil | MALLFVALAALVAWAILIFGGITTSGVTHLLLAVGTVLIVRWWALRA* |
rootH1_102573972 | 3300003323 | Sugarcane Root And Bulk Soil | MSALTLALAALVAWAILIFGGITTSGVTHLLLAVGTVLIVRWWALRA* |
Ga0055455_100310763 | 3300003990 | Natural And Restored Wetlands | MLSPLTLIVSIVALVAWAFLIFGGVTTSGVTHLLLAVGTVLFVRWWALRA* |
Ga0055440_100137572 | 3300004020 | Natural And Restored Wetlands | MPAPTFLAAIVAIVAWAILVFGGVTTSGVTHLLLALGAVLLVRWWALRA* |
Ga0062590_1002030121 | 3300004157 | Soil | MASTLLTPTLLAGLAALITWAWLIFGGVTTAGVTHLLLAVGSVLLVRWWALRA* |
Ga0063356_1003663513 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MLPLTLAGAILALLAWAFLIFGGITTSGVTHLLLAVGTVLLVRWWALRA* |
Ga0062595_1008196222 | 3300004479 | Soil | MASTLLAPSLVAGVAALIIWAVLIFGGITSSGVTHLLLAVGTVLLVRWWALRA* |
Ga0062595_1008225421 | 3300004479 | Soil | MASTLLAPTLLAGLAALIIWAVLVYGGITSSGVTHLLLAVGTVLLVRWWALRG* |
Ga0062595_1008853452 | 3300004479 | Soil | MASTLLAPTLIAGVAALIMWAVLIFGGITSSGVTHLLLALGTVLLVRWWALRG* |
Ga0062591_1010670662 | 3300004643 | Soil | VILASTLLAPTLLAGAAALIAWAFLIFGGVTSSGVTHLLLAVGTVLLVRWWALRG* |
Ga0062383_100703862 | 3300004778 | Wetland Sediment | MLPLTLLGAIVALVAWAFIIFGGVATSGVTHLLLAIGTVLLVRWWALRA* |
Ga0062379_100846012 | 3300004781 | Wetland Sediment | MTKATLAGAIAALVAWAFLIFGGVTSAGVTHLLLAVGTVLLVRWWALRA* |
Ga0066673_107853251 | 3300005175 | Soil | MLALTLLVAIAALVAWALLIFGGVTTAGVTHLLLAVGIVLLVRWWALRA* |
Ga0070709_101503111 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MMALTLVTAIVSLVAWAVLIFGGITTSGVTHLLLALGTVLLVRWWALRV* |
Ga0070711_1000883842 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | VESTDEDEPIMASTLLAPTLIAGILALLAWAILIFGGITSSGVTHLLLAVGTVLLVRWWALRA* |
Ga0070711_1007188661 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MMALTLVTAIVSLVAWAVLIFGGITTSGVTHLLLAVGTVLLVRWWALRV* |
Ga0070705_1002534031 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MLPQLTLIVAIVALVAWAFLIFGGVTTSGVTHLLLAVGTVLFVRWWALRA* |
Ga0070708_1001891702 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MLAPTLLLAIAALVAWALLIFGGVTTAGVTHLLLAVGIVLLVRWWALRA* |
Ga0070663_1008226422 | 3300005455 | Corn Rhizosphere | MLPQLTLIVSIAALLAWAFLIFGGVTTSGVTHLLLAVGTVLFVRWWALRA* |
Ga0070681_100984901 | 3300005458 | Corn Rhizosphere | MLPQLTLIVSIAALLAWAFLIFGGVTTSGVTHLLLAVGTVLFVRWW |
Ga0070697_1005893072 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MALTLLAAIVSLAAWALLIFGGMTTSGVTHLLLAVGTVLLVRWWALRA* |
Ga0070696_1017013491 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | VILASTLLAPTLLAGAAALIAWAFLIFGGVTSSGVTHLLLAVGTV |
Ga0070693_1001085843 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MMAPTLLTAVVALLAWVVLVFGRVTTSGVTHLLLAIAAVCFVRWWALRA* |
Ga0066695_105459191 | 3300005553 | Soil | MLAPTLLLAIAALVAWALLIFGGVTTAGVTHLLLAVGIVLLVRWWAL |
Ga0070664_1013344492 | 3300005564 | Corn Rhizosphere | MLPLTLAGAILALLAWAFLIFGGITTSGVTHLLLAVGTVL |
Ga0070664_1021077182 | 3300005564 | Corn Rhizosphere | MASTLLAPTLLAGLAALIAWAWLIFGGVTSAGVTHLLLAVGSVLLVRWWALRA* |
Ga0068857_1012746021 | 3300005577 | Corn Rhizosphere | MASTLLAPTLLAGLAALIAWAWLIFGGVTTSGVTHLLLAVGSVLLVRWWALRA* |
Ga0066903_1073139962 | 3300005764 | Tropical Forest Soil | QTESTDKAEPIMASTFVTPTLLAGILALLTWAILIFGGITSSGVTHLLLAVGTVLLVRWWALRA* |
Ga0068863_1015140662 | 3300005841 | Switchgrass Rhizosphere | LLAGLAALIAWAWLIFGGVTTSGVTHLLLAVGSVLLVRWWALRA* |
Ga0068863_1024290672 | 3300005841 | Switchgrass Rhizosphere | MASTLLTPTLLAGLAALITWAWLIFGGVTTAGVTHLLLAAGSVLLVRWWALRA* |
Ga0075288_10794392 | 3300005874 | Rice Paddy Soil | MLALTLLAAVASLVAWAVLIFGGVTTRPVTHLLLALGTILLVRWWALRD* |
Ga0075284_10161922 | 3300005885 | Rice Paddy Soil | MALLFVALAALVAWAVLIFGGIATSGATPLLLAVGTVLIVRWWALRA* |
Ga0075292_10416002 | 3300005887 | Rice Paddy Soil | MALLFVALTALVAWAVLIFGGITTSGATHLLLAVGTVLIVRWWALRA* |
Ga0066656_101357912 | 3300006034 | Soil | MLAPTLLVAIAALVAWALLIFGGVTTAGVTHLLLAVGIVLLVRWWALRA* |
Ga0070712_1013666881 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MASTLLTSTLVAAITALVAWAFLIFGGLTTSGVTHLLLAVGSVLLVRWWALRA* |
Ga0079222_100957502 | 3300006755 | Agricultural Soil | MAPRLLGPTLFVAITALIAWAVLIFGGITSSGVTHLLLAVGTVLLVRWWALRV* |
Ga0079222_101408413 | 3300006755 | Agricultural Soil | ASTLLAPSLVAGVAALIIWAVLIFGGITSSGVTHLLLAVGTVLLVRWWALRA* |
Ga0079222_107083522 | 3300006755 | Agricultural Soil | MDEDERIMASTLLAPTLLAGLAALILWAVLVFGGITSSGVTHLLLAVGTVLLVRWWALRA |
Ga0075430_1008603431 | 3300006846 | Populus Rhizosphere | MAPTLLAALVALVAWAVLLFGGITTSGVTHLLLAIGTVLLVRWWALRA* |
Ga0075431_1018971861 | 3300006847 | Populus Rhizosphere | TLRIARTLIMAPTLLAALVALVAWAVLLFGGITTSGVTHLLLAIGTVLLVRWWALRA* |
Ga0075433_100373415 | 3300006852 | Populus Rhizosphere | MASTLLTPTLLTAIAALVAWALLIFGGVTSSGVTHLLLPVGTVLLVRWWALRA* |
Ga0075425_1006137562 | 3300006854 | Populus Rhizosphere | MASTLLTPTLLTAIAALVAWALLIFGGVASSGVTHLLLPVGTVLLVRWWALRA* |
Ga0075434_1021874291 | 3300006871 | Populus Rhizosphere | VILASTLLAPTLLAALVALLAWAILIFGGVTTSGVTHLLLAVGSVLLVRWWALRA* |
Ga0079219_100029823 | 3300006954 | Agricultural Soil | MASTLLAPSLLAGVAALIIWAVLIFGGITSSGVTHLLLAVGTVLLVRWWALRA* |
Ga0075435_1012664393 | 3300007076 | Populus Rhizosphere | VILASTLLAPTLLAALVALLAWAILIFGGVTTSGVTHLLLAVGSVLLVR |
Ga0066710_1049029131 | 3300009012 | Grasslands Soil | MLAPTLLVAIAALVAWALLIFGGVTTAGVTHLLLAVGIVLLVRWWALRA |
Ga0099827_101299913 | 3300009090 | Vadose Zone Soil | MPSLTLVAAVVALIAWAFLIFGGVATAGVTHLLLALGSVLLVRWWALRA* |
Ga0075418_102839733 | 3300009100 | Populus Rhizosphere | MAPTLLAALVALVAWAVLIFGGITTSGVTHLLLAIGTVLLVRWWALRA* |
Ga0066709_1008733882 | 3300009137 | Grasslands Soil | MPSLTLVAAVVALVAWAFLIFGGVTTAGVTHLLLALGSVLLVRWWALRA* |
Ga0126309_101334542 | 3300010039 | Serpentine Soil | MLPQLPLIVSIVALVAWAFLIFGGVTTSGVTHLLLAIGAVLFVRWWALRA* |
Ga0126312_105256922 | 3300010041 | Serpentine Soil | MAPTLLAAIVALLAWAVLLFGGITTSGVTHLLLAVGTILLVRWWALRA* |
Ga0126312_106914312 | 3300010041 | Serpentine Soil | MLLLTLLGAIIALVAWSFIIFGGVATSGVTHLLLAAGTVLLVRWWALRA* |
Ga0126310_106503901 | 3300010044 | Serpentine Soil | MASTLLLAIGALVAWTVLIFGSITTSGVTHLLLAVGTVLLVRWWALRA* |
Ga0126311_118766151 | 3300010045 | Serpentine Soil | MMLLTLFGGIAALVAWAFITFGGVAASGVTHLLLAVGTVLLVRWWALRA* |
Ga0134128_130666711 | 3300010373 | Terrestrial Soil | MASTLLAPSLVVGVAALIIWAVLIFGGITSSGVTHLLLAVGT |
Ga0134126_106961862 | 3300010396 | Terrestrial Soil | MRRMMAPTLLTAVVALLAWVVLVFGRVTTSGVTHLLLAIAAVCFVRWWALRA* |
Ga0134124_112217651 | 3300010397 | Terrestrial Soil | MASTLLAPTLLAGLAALIAWAWLIFGGVTTSGVTHLLLAVGSVLLVRWWALRACCCSGLRVPCG |
Ga0137438_10216872 | 3300011431 | Soil | MLPHLTLIVSIVALVAWAFLIFGGVTTSGVTHLLLAVGTVLFVRWWALRA* |
Ga0137451_12289951 | 3300011438 | Soil | MLPQLTLIVSIVALVAWAFLIFGGVTTSGVTHLLLAAGTVLLVRWWALRA* |
Ga0137463_10238752 | 3300011444 | Soil | MLPQLTLIVSIVALVAWAFLIFGGVTTSGVTHLLLAVGTVLFVRWWALRA* |
Ga0137365_110536171 | 3300012201 | Vadose Zone Soil | MPSLTLVAAVVALVTWAFLIFGGVTTAGVTHLLLALGSVLLVRWWALRA* |
Ga0137374_106151921 | 3300012204 | Vadose Zone Soil | MMAPTLLAAIAALVAWVLLIFGGVTTSGVTHLLLAVGTVLLVRWWALRA* |
Ga0137376_113414142 | 3300012208 | Vadose Zone Soil | MPSLTLVAALVALVTWAFLIFGGVTTAGVTHLLLALGSVLLVRWWALRA* |
Ga0150985_1207404201 | 3300012212 | Avena Fatua Rhizosphere | MMAPTLLMALAALLAWAVLIFGGITTAGVTHLLLAVGSVLLVRWWALRA* |
Ga0137367_103966742 | 3300012353 | Vadose Zone Soil | MPSLTLVAAVVALVAWAFLIFGGVTNAGVTHLLLALGSVLLVRWWALRA* |
Ga0137369_108993051 | 3300012355 | Vadose Zone Soil | MPSLTLVTAVVALVAWAFLIFGGVTTAGVTHLLLALGSVLLVRWWALRA* |
Ga0157216_102189192 | 3300012668 | Glacier Forefield Soil | MAPTLLLALVALIAWAVLLFGGVTTSGVTHLLLTAGTILLVRWWALRA* |
Ga0137395_104321521 | 3300012917 | Vadose Zone Soil | MPLLTLVAAVVALITWAFLIFGGVTTAGVTHLLLALGSVLLVRWWALRA |
Ga0137404_116004041 | 3300012929 | Vadose Zone Soil | MALTLLAAIISLVAWALLIFGGMTTSGVTHLLLAVGTVLLVRWWALRA* |
Ga0153915_132022121 | 3300012931 | Freshwater Wetlands | MLAPTLLAALVAIVAWAILVFAGITTAGVTHLLLALGTVLLVRWWALRA* |
Ga0162653_1000439602 | 3300012937 | Soil | MLPRLTLIVSIVALVAWAILIFGGVTTSGVTHLLLALGTVLFVRWWALRA |
Ga0164303_100339431 | 3300012957 | Soil | TAVILASTLLAPTLLAALVALLAWAILIFGGVTTSGVTHLLLAVGSVLLVRWWALRA* |
Ga0164303_105225042 | 3300012957 | Soil | MASTLLAPTLIAGILALLAWAILIFGGITSSGVTHLLLAVGTVLLVRWWALRA* |
Ga0164303_113714851 | 3300012957 | Soil | MASTLLAPTLLAGLAALIAWAFLVFGGVTTSGVTHLLLAVGSVLLVRWRALRA* |
Ga0164299_102397792 | 3300012958 | Soil | MASTLLALTLLAGLAALIAWAWLVFGGVTTSGVTHLLLAAGSVLLVRWWALRA* |
Ga0164304_105245232 | 3300012986 | Soil | MASTLLAPTLLAGLAALIAWAWLVFGGVTTSGVTHLLLAAGSVLLVRWWALRA* |
Ga0164307_102459041 | 3300012987 | Soil | LTFTLVAAITALVTWAFLIFGGLTTSGVTHLLLAVGSVLLVRWWALRA* |
Ga0164305_117808421 | 3300012989 | Soil | MASRLLAPTLLAGLAALIAWAFLVFGGVTTSGVTHLLLALGSVLLVRWWALRA* |
Ga0075316_10185862 | 3300014314 | Natural And Restored Wetlands | MLALTLLAAVASLVAWAVLIFGGVTTLPVTHLLLAVGTILLVRWWALRA* |
Ga0132258_125766932 | 3300015371 | Arabidopsis Rhizosphere | MASTLLTFTLVAAITALVTWAFLIFGGLTTSGVTHLLLAVGSVLLVRWWALRA* |
Ga0180121_100571843 | 3300017695 | Polar Desert Sand | MMAPTLLTAIVTLVAWTILVFGGVVTSGVTHLLLALGTVLLVRWWALRA |
Ga0184604_101747302 | 3300018000 | Groundwater Sediment | MLPQLTLIVSIVALVAWAFIIFGGVATSGVTHLLLAIGTVLLVRWWALRA |
Ga0184604_102230272 | 3300018000 | Groundwater Sediment | CDMMALTLLTAIIAIAAWAVLLFGGITTSGVTHLLLAVGTVLLVRWWALRA |
Ga0184608_100150484 | 3300018028 | Groundwater Sediment | MLPHLTLIVSIVALVAWAFLIFGGVTTSGVTHLLLAVGTVLFVRWWALRA |
Ga0184621_101442461 | 3300018054 | Groundwater Sediment | MLPHLTLIVSIVALVAWAFLIFGGVTTSGVTHLLLAVGTGLLVRLWALRA |
Ga0184623_101565523 | 3300018056 | Groundwater Sediment | MLPHLTLIVSIVALVAWAFLIFGGVTTSGVTHLLLAVGTVLLVRWWALRA |
Ga0184615_107080151 | 3300018059 | Groundwater Sediment | MLPLTLLGAIVALVAWAFIIFGGVATSGVTHLLLAISTVLFVRWWALRA |
Ga0184617_10233031 | 3300018066 | Groundwater Sediment | MLPQLTLIVSIVALVAWAFLIFGGVTTSGVTHLLLAVGTVLFVRWWALRA |
Ga0184618_100515422 | 3300018071 | Groundwater Sediment | MLPQLTLIVSIVALVAWGFLIFGGVTTSGVTHLLLAVGTVLFVRWWALRA |
Ga0190272_102604441 | 3300018429 | Soil | MLPHLTLIVSIVALVAWAFLIFGGVTTSGVTHSLLAVGTVLFVRWWALRA |
Ga0190268_110269941 | 3300018466 | Soil | MMAPTLLTAIVALVAWAVLIFGGLTTSGVTHLLLAVGTLLLVR |
Ga0190273_102850782 | 3300018920 | Soil | MLPLALSMTLPLTLLAGILALVAWAFIIFGGIAASGVTHLLLAVGTVLLVRWWALRA |
Ga0210382_101631841 | 3300021080 | Groundwater Sediment | MPSLTLVVAVVALIAWAFLIFGGVTTAGATHLLLALGSGLLVRWWALRA |
Ga0210377_107893732 | 3300021090 | Groundwater Sediment | MLPQLTLIVSLVALVAWAFLIFGGVTTSGVTHLLLAAGTVLLVRWWALRA |
Ga0193750_10397981 | 3300021413 | Soil | MLAPTLLIAIVALFAWAVLIFGGVTSAGVTHLLLAVGIVLLVRWWALRA |
Ga0182009_104684181 | 3300021445 | Soil | MASTLLAPTLLAGLAALIIWAVLVYGGITSSGVTHLLLAVGTVLLVRWWALRG |
Ga0222622_102751821 | 3300022756 | Groundwater Sediment | MLPQLTLIVSIVALVAWAFLIFGGVTSSGVTHLLLAVGTVLLVRWWALRA |
Ga0209431_112432662 | 3300025313 | Soil | MTKATLAGAIAALVAWAFLIFGGVTDSGVTHLLLAVGSVLLVRWWALRA |
Ga0209342_106384411 | 3300025326 | Soil | MTKATLAGAIAALVAWAFLIFGGVTDSGVTHLLLAVGSVLLVRWWALR |
Ga0210132_10283722 | 3300025538 | Natural And Restored Wetlands | MPAPTFLAAIVAIVAWAILVFGGVTTSGVTHLLLALGAVLLVRWWALRA |
Ga0210142_10044801 | 3300025552 | Natural And Restored Wetlands | MLSPLTLIVSIVALVAWAFLIFGGVTTSGVTHLLLAVGTVLFVRWWALRA |
Ga0207684_113618252 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MLAPTLLLAIAALVAWALLIFGGVTTAGVTHLLLAVGIVLLVRWW |
Ga0207665_106865161 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MLAPTLLVAIAALVAWAWLIFGGVTTAAVTHLLLAVGIVLLVRWWALRA |
Ga0207679_120529801 | 3300025945 | Corn Rhizosphere | MASTLLAPTLLAGLAALIAWAWLIFGGVTSAGVTHLLLAVGSVLLVRWWALRA |
Ga0208531_10008381 | 3300026020 | Rice Paddy Soil | MALLFVALTALVAWAVLIFGGITTSGATHLLLAVGTVLIVRWWALRA |
Ga0207641_113804132 | 3300026088 | Switchgrass Rhizosphere | WIMASTLLAPTLLAGLAALIAWAWLIFGGVTTSGVTHLLLAVGSVLLVRWWALRA |
Ga0207676_100865332 | 3300026095 | Switchgrass Rhizosphere | MASTLLAPTLLAGLAALIAWAWLIFGGVTTSGVTHLLLAVGSVLLVRWWALRA |
Ga0209682_100026166 | 3300027716 | Wetland Sediment | MTKATLVGAIAALVAWAFLIFGGVTSAGVTHLLLAVGTVLLVRWWALRA |
Ga0209261_100562901 | 3300027735 | Wetland Sediment | MTKATLAGAIAALVAWAFLIFGGVTSAGVTHLLLAVGTVLLVRWWALRA |
Ga0209590_106466661 | 3300027882 | Vadose Zone Soil | MPSLTLVAAVVALIAWAFLIFGGVATAGVTHLLLALGSVLLVRWWALRA |
Ga0268265_125239211 | 3300028380 | Switchgrass Rhizosphere | MLPQLSLIVSIVALVAWAFLIFGGVTTSGVTHLLLAVGTVLFVRWWALRA |
Ga0307307_100518242 | 3300028718 | Soil | SERGVYMPSLTLIAAVVALVVWAFLIFGGVTTAGVTHLLLAVGSVLLVRWWALRA |
Ga0307284_103434711 | 3300028799 | Soil | MPSLTLIAAVVALVVWAFLIFGGVTTAGVTHLLLAVGSVLLVRWWALRA |
Ga0307281_104159691 | 3300028803 | Soil | MLPQLTLIVSLVALVAWAFLIFGGVTTSGVTHLLLAAGTVLFVRWWALRA |
Ga0247824_101350492 | 3300028809 | Soil | MMSLTLLGGIAALVAWAFIIFGGVATSGVTHLLLAVGTVLLVRWWALRA |
(restricted) Ga0255310_102310061 | 3300031197 | Sandy Soil | MLALTLLGAIVALVAWVVLVFGGVSSSGVTHLLLAAGTMLFVRWWALRA |
(restricted) Ga0255312_11231331 | 3300031248 | Sandy Soil | MLALTLLGAIVALVAWVILVFGGVSSSGVTHLLLAAGTMLFVRWWALRA |
(restricted) Ga0255312_11709222 | 3300031248 | Sandy Soil | MLPQLTLIVAIVALVAWAFLIFGGVTTSGVTHLLLAVGTVLFVR |
Ga0307408_1010339002 | 3300031548 | Rhizosphere | MLLLTLIAAIAALVAWSFIIFGGVSSAGVTHLLLALGTVLLVRWWALRA |
Ga0307408_1016181952 | 3300031548 | Rhizosphere | MSALTLVASVASLAAWALLIFGGVTTAAVTHLLLAAGTILFVRWWALRA |
Ga0307408_1021222851 | 3300031548 | Rhizosphere | MLPLTLAGAILALLAWAFLIFGGITTSGVTHLLLAVGTVLLVRWWALRA |
Ga0307413_118492481 | 3300031824 | Rhizosphere | MLALTLLAAVVSLVVWAVLIFGGVTTLPITHLLLAIGTILFVRWWALRA |
Ga0307413_121672761 | 3300031824 | Rhizosphere | MLLLTLIAAVAALVAWSFIIFGGVSSAGVTHLLLALGTVLLVRWWALRA |
Ga0308175_1000120488 | 3300031938 | Soil | MESTDEDEPIMASTLLAPTLLAGLTALILWAVLIFGGITSSGVTHLLLAVGTVLLVRWWALRG |
Ga0326597_110091321 | 3300031965 | Soil | MTTATLPAAIAALVAWAFLIFGGVTDSGVTHLLLAVGSVLLVRWWALRA |
Ga0307416_1000679892 | 3300032002 | Rhizosphere | MSALTLVASVASLAAWALLIFSGVTTAAVTHLLLAAGTILLVRWWALRA |
Ga0310812_100695532 | 3300032421 | Soil | MASTLLAPTLLAGLAALIAWAWLIFGGVTSAGVTPLLLAVGSVLLVRWWALRA |
Ga0316624_120525992 | 3300033486 | Soil | LAPTLLAALVAIVAWAILVFGGITTAGVTHLLLALGTVLLVRWWALRA |
Ga0373948_0195800_105_257 | 3300034817 | Rhizosphere Soil | MLPQLTLIISIVALVAWAFLIFGGVTTSGVTHLLLAVGTVLFVRWWALRA |
⦗Top⦘ |