


| Basic Information | |
|---|---|
| Family ID | F060177 |
| Family Type | Metagenome |
| Number of Sequences | 133 |
| Average Sequence Length | 38 residues |
| Representative Sequence | TTLSDGDKRLVLAMIRKMATLIPPPAAKKLIVRRPTA |
| Number of Associated Samples | 117 |
| Number of Associated Scaffolds | 133 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.25 % |
| % of genes from short scaffolds (< 2000 bps) | 86.47 % |
| Associated GOLD sequencing projects | 111 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (54.135 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (27.068 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.579 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.880 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 23.08% β-sheet: 0.00% Coil/Unstructured: 76.92% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 133 Family Scaffolds |
|---|---|---|
| PF00005 | ABC_tran | 25.56 |
| PF00664 | ABC_membrane | 12.78 |
| PF01507 | PAPS_reduct | 5.26 |
| PF03061 | 4HBT | 3.01 |
| PF02517 | Rce1-like | 2.26 |
| PF06271 | RDD | 1.50 |
| PF03486 | HI0933_like | 1.50 |
| PF00072 | Response_reg | 0.75 |
| PF08238 | Sel1 | 0.75 |
| PF03681 | Obsolete Pfam Family | 0.75 |
| PF00903 | Glyoxalase | 0.75 |
| PF04820 | Trp_halogenase | 0.75 |
| PF00160 | Pro_isomerase | 0.75 |
| PF12704 | MacB_PCD | 0.75 |
| PF12697 | Abhydrolase_6 | 0.75 |
| PF07690 | MFS_1 | 0.75 |
| PF00009 | GTP_EFTU | 0.75 |
| PF02559 | CarD_CdnL_TRCF | 0.75 |
| PF01425 | Amidase | 0.75 |
| COG ID | Name | Functional Category | % Frequency in 133 Family Scaffolds |
|---|---|---|---|
| COG0493 | NADPH-dependent glutamate synthase beta chain or related oxidoreductase | Amino acid transport and metabolism [E] | 3.01 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 3.01 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 2.26 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 2.26 |
| COG0029 | Aspartate oxidase | Coenzyme transport and metabolism [H] | 1.50 |
| COG0446 | NADPH-dependent 2,4-dienoyl-CoA reductase, sulfur reductase, or a related oxidoreductase | Lipid transport and metabolism [I] | 1.50 |
| COG0492 | Thioredoxin reductase | Posttranslational modification, protein turnover, chaperones [O] | 1.50 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 1.50 |
| COG1053 | Succinate dehydrogenase/fumarate reductase, flavoprotein subunit | Energy production and conversion [C] | 1.50 |
| COG1249 | Dihydrolipoamide dehydrogenase (E3) component of pyruvate/2-oxoglutarate dehydrogenase complex or glutathione oxidoreductase | Energy production and conversion [C] | 1.50 |
| COG1714 | Uncharacterized membrane protein YckC, RDD family | Function unknown [S] | 1.50 |
| COG2072 | Predicted flavoprotein CzcO associated with the cation diffusion facilitator CzcD | Inorganic ion transport and metabolism [P] | 1.50 |
| COG2081 | Predicted flavoprotein YhiN | General function prediction only [R] | 1.50 |
| COG2509 | FAD-dependent dehydrogenase | General function prediction only [R] | 1.50 |
| COG3634 | Alkyl hydroperoxide reductase subunit AhpF | Defense mechanisms [V] | 1.50 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.75 |
| COG0652 | Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family | Posttranslational modification, protein turnover, chaperones [O] | 0.75 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 54.14 % |
| All Organisms | root | All Organisms | 45.86 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_101307964 | Not Available | 789 | Open in IMG/M |
| 3300001661|JGI12053J15887_10499608 | Not Available | 580 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100275558 | Not Available | 1568 | Open in IMG/M |
| 3300004091|Ga0062387_100004725 | All Organisms → cellular organisms → Bacteria | 4367 | Open in IMG/M |
| 3300004091|Ga0062387_100760852 | Not Available | 717 | Open in IMG/M |
| 3300004152|Ga0062386_100454833 | Not Available | 1036 | Open in IMG/M |
| 3300004635|Ga0062388_100555239 | Not Available | 1041 | Open in IMG/M |
| 3300005542|Ga0070732_10829307 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 564 | Open in IMG/M |
| 3300005554|Ga0066661_10370238 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
| 3300005555|Ga0066692_10811657 | Not Available | 575 | Open in IMG/M |
| 3300005575|Ga0066702_10325300 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 936 | Open in IMG/M |
| 3300005602|Ga0070762_10472736 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidipila → unclassified Acidipila → Acidipila sp. | 818 | Open in IMG/M |
| 3300006176|Ga0070765_100048211 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3458 | Open in IMG/M |
| 3300006903|Ga0075426_10394735 | All Organisms → cellular organisms → Bacteria | 1020 | Open in IMG/M |
| 3300009038|Ga0099829_10605514 | Not Available | 911 | Open in IMG/M |
| 3300009088|Ga0099830_10516965 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 975 | Open in IMG/M |
| 3300009088|Ga0099830_11074267 | Not Available | 667 | Open in IMG/M |
| 3300009090|Ga0099827_10467374 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora olivasterospora | 1082 | Open in IMG/M |
| 3300009177|Ga0105248_10100933 | All Organisms → cellular organisms → Bacteria | 3252 | Open in IMG/M |
| 3300009177|Ga0105248_12704311 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300009521|Ga0116222_1547733 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300009522|Ga0116218_1392365 | Not Available | 620 | Open in IMG/M |
| 3300009545|Ga0105237_10987327 | Not Available | 849 | Open in IMG/M |
| 3300009637|Ga0116118_1216081 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 597 | Open in IMG/M |
| 3300009760|Ga0116131_1030953 | Not Available | 1841 | Open in IMG/M |
| 3300010046|Ga0126384_12124643 | Not Available | 539 | Open in IMG/M |
| 3300010047|Ga0126382_10070215 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2144 | Open in IMG/M |
| 3300010048|Ga0126373_11206880 | Not Available | 823 | Open in IMG/M |
| 3300010159|Ga0099796_10243160 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 745 | Open in IMG/M |
| 3300010359|Ga0126376_10988332 | Not Available | 840 | Open in IMG/M |
| 3300010360|Ga0126372_10561150 | Not Available | 1087 | Open in IMG/M |
| 3300010360|Ga0126372_10646412 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1023 | Open in IMG/M |
| 3300010361|Ga0126378_12621250 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300010366|Ga0126379_10980718 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 949 | Open in IMG/M |
| 3300010376|Ga0126381_102470480 | Not Available | 745 | Open in IMG/M |
| 3300010396|Ga0134126_12836493 | Not Available | 525 | Open in IMG/M |
| 3300010398|Ga0126383_11441856 | Not Available | 778 | Open in IMG/M |
| 3300010401|Ga0134121_12507549 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 558 | Open in IMG/M |
| 3300011120|Ga0150983_15451454 | Not Available | 532 | Open in IMG/M |
| 3300011269|Ga0137392_11091307 | Not Available | 655 | Open in IMG/M |
| 3300011271|Ga0137393_10647833 | Not Available | 905 | Open in IMG/M |
| 3300012096|Ga0137389_10820098 | Not Available | 799 | Open in IMG/M |
| 3300012189|Ga0137388_10186166 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1863 | Open in IMG/M |
| 3300012202|Ga0137363_11131248 | Not Available | 666 | Open in IMG/M |
| 3300012203|Ga0137399_10071566 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2602 | Open in IMG/M |
| 3300012203|Ga0137399_11117677 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 663 | Open in IMG/M |
| 3300012203|Ga0137399_11729412 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
| 3300012205|Ga0137362_10189773 | Not Available | 1768 | Open in IMG/M |
| 3300012208|Ga0137376_10250620 | Not Available | 1535 | Open in IMG/M |
| 3300012359|Ga0137385_10042502 | All Organisms → cellular organisms → Bacteria | 4071 | Open in IMG/M |
| 3300012361|Ga0137360_10227036 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1524 | Open in IMG/M |
| 3300012361|Ga0137360_10954836 | Not Available | 739 | Open in IMG/M |
| 3300012363|Ga0137390_10951990 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 812 | Open in IMG/M |
| 3300012582|Ga0137358_10183490 | Not Available | 1428 | Open in IMG/M |
| 3300012917|Ga0137395_10192735 | Not Available | 1415 | Open in IMG/M |
| 3300012924|Ga0137413_11695037 | Not Available | 519 | Open in IMG/M |
| 3300012925|Ga0137419_10091322 | Not Available | 2085 | Open in IMG/M |
| 3300012925|Ga0137419_10704598 | Not Available | 819 | Open in IMG/M |
| 3300012927|Ga0137416_10499512 | Not Available | 1047 | Open in IMG/M |
| 3300012927|Ga0137416_11097571 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 714 | Open in IMG/M |
| 3300012944|Ga0137410_11607143 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidipila → unclassified Acidipila → Acidipila sp. | 570 | Open in IMG/M |
| 3300012944|Ga0137410_11903912 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 527 | Open in IMG/M |
| 3300014166|Ga0134079_10137323 | All Organisms → cellular organisms → Bacteria | 973 | Open in IMG/M |
| 3300014168|Ga0181534_10975475 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
| 3300014654|Ga0181525_10451759 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 709 | Open in IMG/M |
| 3300014968|Ga0157379_11357176 | Not Available | 688 | Open in IMG/M |
| 3300015374|Ga0132255_102224847 | Not Available | 836 | Open in IMG/M |
| 3300016270|Ga0182036_11759324 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300016357|Ga0182032_11177760 | Not Available | 659 | Open in IMG/M |
| 3300016387|Ga0182040_11636293 | Not Available | 549 | Open in IMG/M |
| 3300016404|Ga0182037_11403482 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 618 | Open in IMG/M |
| 3300016404|Ga0182037_11807356 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300016445|Ga0182038_10050966 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2763 | Open in IMG/M |
| 3300017822|Ga0187802_10094397 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1122 | Open in IMG/M |
| 3300017823|Ga0187818_10521084 | Not Available | 534 | Open in IMG/M |
| 3300017929|Ga0187849_1008439 | All Organisms → cellular organisms → Bacteria | 7288 | Open in IMG/M |
| 3300017933|Ga0187801_10147402 | Not Available | 915 | Open in IMG/M |
| 3300017973|Ga0187780_10033891 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3593 | Open in IMG/M |
| 3300018060|Ga0187765_10008632 | All Organisms → cellular organisms → Bacteria | 4496 | Open in IMG/M |
| 3300018085|Ga0187772_10275203 | Not Available | 1148 | Open in IMG/M |
| 3300018085|Ga0187772_11087769 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 586 | Open in IMG/M |
| 3300018088|Ga0187771_11193974 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 645 | Open in IMG/M |
| 3300018090|Ga0187770_10438074 | Not Available | 1029 | Open in IMG/M |
| 3300020170|Ga0179594_10130259 | All Organisms → cellular organisms → Bacteria | 921 | Open in IMG/M |
| 3300020582|Ga0210395_11424134 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
| 3300021046|Ga0215015_10628978 | All Organisms → cellular organisms → Bacteria | 1032 | Open in IMG/M |
| 3300021168|Ga0210406_11212216 | Not Available | 548 | Open in IMG/M |
| 3300021170|Ga0210400_10303198 | Not Available | 1311 | Open in IMG/M |
| 3300021178|Ga0210408_10062066 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2920 | Open in IMG/M |
| 3300021180|Ga0210396_10298602 | Not Available | 1426 | Open in IMG/M |
| 3300021405|Ga0210387_11720304 | Not Available | 530 | Open in IMG/M |
| 3300021405|Ga0210387_11760256 | Not Available | 523 | Open in IMG/M |
| 3300021407|Ga0210383_11123915 | Not Available | 663 | Open in IMG/M |
| 3300021407|Ga0210383_11226683 | Not Available | 629 | Open in IMG/M |
| 3300021433|Ga0210391_10046284 | All Organisms → cellular organisms → Bacteria | 3466 | Open in IMG/M |
| 3300021475|Ga0210392_10946339 | Not Available | 644 | Open in IMG/M |
| 3300021477|Ga0210398_10071837 | Not Available | 2815 | Open in IMG/M |
| 3300021478|Ga0210402_10915816 | Not Available | 803 | Open in IMG/M |
| 3300021478|Ga0210402_11242073 | Not Available | 672 | Open in IMG/M |
| 3300021559|Ga0210409_10391716 | Not Available | 1244 | Open in IMG/M |
| 3300021560|Ga0126371_13825105 | Not Available | 507 | Open in IMG/M |
| 3300024222|Ga0247691_1056698 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 591 | Open in IMG/M |
| 3300024288|Ga0179589_10206312 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 860 | Open in IMG/M |
| 3300025915|Ga0207693_11197173 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 573 | Open in IMG/M |
| 3300026328|Ga0209802_1155930 | All Organisms → cellular organisms → Bacteria | 955 | Open in IMG/M |
| 3300026557|Ga0179587_10060235 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2208 | Open in IMG/M |
| 3300026833|Ga0207728_116095 | Not Available | 681 | Open in IMG/M |
| 3300027643|Ga0209076_1155468 | Not Available | 639 | Open in IMG/M |
| 3300027825|Ga0209039_10080610 | Not Available | 1422 | Open in IMG/M |
| 3300027846|Ga0209180_10751747 | Not Available | 526 | Open in IMG/M |
| 3300027875|Ga0209283_10651994 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 662 | Open in IMG/M |
| 3300027879|Ga0209169_10190598 | Not Available | 1071 | Open in IMG/M |
| 3300027903|Ga0209488_10170616 | Not Available | 1643 | Open in IMG/M |
| 3300027910|Ga0209583_10248426 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 784 | Open in IMG/M |
| 3300028536|Ga0137415_10553409 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 960 | Open in IMG/M |
| 3300028906|Ga0308309_10549181 | Not Available | 1001 | Open in IMG/M |
| 3300031236|Ga0302324_101808709 | Not Available | 776 | Open in IMG/M |
| 3300031720|Ga0307469_10100790 | Not Available | 2027 | Open in IMG/M |
| 3300031837|Ga0302315_10232197 | Not Available | 1091 | Open in IMG/M |
| 3300031890|Ga0306925_11528498 | Not Available | 652 | Open in IMG/M |
| 3300031912|Ga0306921_10027287 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6335 | Open in IMG/M |
| 3300031947|Ga0310909_11643453 | Not Available | 508 | Open in IMG/M |
| 3300031965|Ga0326597_10688779 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1078 | Open in IMG/M |
| 3300032039|Ga0318559_10442982 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 606 | Open in IMG/M |
| 3300032076|Ga0306924_10653346 | Not Available | 1185 | Open in IMG/M |
| 3300032089|Ga0318525_10412187 | Not Available | 692 | Open in IMG/M |
| 3300032094|Ga0318540_10238462 | Not Available | 878 | Open in IMG/M |
| 3300032174|Ga0307470_10304192 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1083 | Open in IMG/M |
| 3300032180|Ga0307471_100173434 | Not Available | 2115 | Open in IMG/M |
| 3300032261|Ga0306920_100630203 | Not Available | 1585 | Open in IMG/M |
| 3300032261|Ga0306920_103105948 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 624 | Open in IMG/M |
| 3300032805|Ga0335078_10530221 | All Organisms → cellular organisms → Bacteria | 1504 | Open in IMG/M |
| 3300032828|Ga0335080_10587092 | Not Available | 1173 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 27.07% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.04% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.27% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.27% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.51% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.76% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.01% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.26% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.26% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.26% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.50% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.50% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.50% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.50% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.50% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.50% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.50% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.75% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.75% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.75% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.75% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.75% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.75% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.75% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.75% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.75% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.75% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009637 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 | Environmental | Open in IMG/M |
| 3300009760 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_100 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
| 3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017929 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024222 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK32 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300026833 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 54 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031837 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1013079642 | 3300000364 | Soil | KKYSTTLSEGDKRLVLAMIRKMATLLPAAAAQAKKPLLRRPAL* |
| JGI12053J15887_104996081 | 3300001661 | Forest Soil | SDGDKRLVLAMIRKMATLLPVAAAKKLLVRRPTA* |
| JGIcombinedJ26739_1002755582 | 3300002245 | Forest Soil | FSTTLSEGDKRLVLAMIRKMASLIPPPVAKKPVIRRPATA* |
| Ga0062387_1000047254 | 3300004091 | Bog Forest Soil | RFSTTLSDGDKRLVLAMIRKMATLIPPPVSKKLVIRRATTV* |
| Ga0062387_1007608521 | 3300004091 | Bog Forest Soil | RFSTTLSDGDKRLVLAMIRKMATLIPPPVSKKLVIRRVTTV* |
| Ga0062386_1004548331 | 3300004152 | Bog Forest Soil | LSDGDKRLVLAMIRKMATLLPVQAGQQVRKPVVLRRPTL* |
| Ga0062388_1005552391 | 3300004635 | Bog Forest Soil | KYSNTLSDGDKRLVLAMIRKMAMLLPPPATKKMVVRRPAV* |
| Ga0070732_108293072 | 3300005542 | Surface Soil | KRFSTTLSDGDKRLVLAMIRKMATLVPPPATKKPLARRPTA* |
| Ga0066661_103702384 | 3300005554 | Soil | EIKKYTNTLSEGDKRLVLAMIRKMTTLIPTVAAKKIIARHPTA* |
| Ga0066692_108116572 | 3300005555 | Soil | TTLSDGDKRLVLAMIRKMATLLPVAAAKKLLVRRPTA* |
| Ga0066702_103253001 | 3300005575 | Soil | NTLSDGDKRLVLAMIRKMATLIPPAAVKKIIARRPTA* |
| Ga0070762_104727362 | 3300005602 | Soil | STSLSDGDKRLVLAMIRKMATVIPPPPRKVVQRRTAY* |
| Ga0070765_1000482111 | 3300006176 | Soil | FSTTLSDGDKRLVLAMIRKMASLIPPPTAKKPVVRRPATV* |
| Ga0075426_103947353 | 3300006903 | Populus Rhizosphere | TLSDGDKRLVLAMIRKMATMIPPPVRKPLVRRPAV* |
| Ga0099829_106055141 | 3300009038 | Vadose Zone Soil | TLSEGDKRLVLAMIRKMATMIPPVAVKKLVVRRPMA* |
| Ga0099830_105169651 | 3300009088 | Vadose Zone Soil | YSSTLSDGDKRLVLAMIRKMATLIPPPPRRPTQRRSVF* |
| Ga0099830_110742672 | 3300009088 | Vadose Zone Soil | DKRLVLAMIRKMATLLPTQAAAQAKKPMLRRPSL* |
| Ga0099827_104673742 | 3300009090 | Vadose Zone Soil | SDGDKRLVLAMIRKMATLIPPPVAKKLIVRRPTV* |
| Ga0105248_101009331 | 3300009177 | Switchgrass Rhizosphere | SEGDKRLVLAMIRKMASLIPPPTAVKKPVIRRPTV* |
| Ga0105248_127043112 | 3300009177 | Switchgrass Rhizosphere | YSSTLSEGDKRLVLAMIRKMATMIPPPVRKPLVRRPAV* |
| Ga0116222_15477331 | 3300009521 | Peatlands Soil | TLSDGDKRLVLAMIRKMATLLPAQAGQQVRKPLLRRPTL* |
| Ga0116218_13923651 | 3300009522 | Peatlands Soil | TLSDGDKRLVLAMIRKMATIAPPPQPVRKAVAPRRHAY* |
| Ga0105237_109873271 | 3300009545 | Corn Rhizosphere | EGDKRLVLAMIRKMASLIPPPTAVKKPVIRRPTV* |
| Ga0116118_12160811 | 3300009637 | Peatland | KYSTTLSDGDKRLVLAMIRKMAVIIPPPPVRKPMARRSAF* |
| Ga0116131_10309532 | 3300009760 | Peatland | LSDGDKRLVLAMIRKMATLLPVQAGQQMRKPVLRRPTL* |
| Ga0126384_121246431 | 3300010046 | Tropical Forest Soil | NTLSDGDKRLVLAMVRKMATLLPPNAAVVKKMIARRPTA* |
| Ga0126382_100702151 | 3300010047 | Tropical Forest Soil | KYSNTLSEGDKRLVLAMIRKMATLIPPVAAAKKIMARRPTA* |
| Ga0126373_112068801 | 3300010048 | Tropical Forest Soil | EGDKRLVLAMIRKMATLLPAQAAQAKKAVVRRPSL* |
| Ga0099796_102431602 | 3300010159 | Vadose Zone Soil | LSDGDKRLVLVMIRKMATLVPPPAPKKPLLRRPTA* |
| Ga0126376_109883321 | 3300010359 | Tropical Forest Soil | STTLSEGDKRLVLAMIRKMATLLPAQAAQAKKPMLRRPSL* |
| Ga0126372_105611501 | 3300010360 | Tropical Forest Soil | VEIKRYSNTLSEGDKRLVLAMIRKMATLIPTGAAVAKKVIARRPTA* |
| Ga0126372_106464123 | 3300010360 | Tropical Forest Soil | YSSTLSEGDKRLVLAMIRKMATMLPPPARKPVARRPMA* |
| Ga0126378_126212501 | 3300010361 | Tropical Forest Soil | TLSDGDKRLVLAMIRKMATMVPPPVRKPMVRRPSL* |
| Ga0126379_109807181 | 3300010366 | Tropical Forest Soil | TLSEGDKRLVLAMIRKMATLLPTQAVKKLVARRPTA* |
| Ga0126381_1024704801 | 3300010376 | Tropical Forest Soil | EGDKRLVLAMIRKKATLLPAAAAHAKKPLLRRPAL* |
| Ga0134126_128364932 | 3300010396 | Terrestrial Soil | TLSEGDKRLVLAMIRKMASLIPPPTAVKKPVIRRPTV* |
| Ga0126383_114418561 | 3300010398 | Tropical Forest Soil | TSLSDGDKRLVLAMIRKMASLITAGPPTVKKAIARRPVA* |
| Ga0134121_125075492 | 3300010401 | Terrestrial Soil | SDGDKRLVLAMIRKMATLIPPPATKKAVVRRPTA* |
| Ga0150983_154514541 | 3300011120 | Forest Soil | EIKCFITTLSDGDMRLVLAMIRKMTTLIPPPTTKKLVIRRPTV* |
| Ga0137392_110913071 | 3300011269 | Vadose Zone Soil | KYSTTLSEGDKRLVLAMIRKMATLLPTHAAAQAKKPMLRRPSL* |
| Ga0137393_106478332 | 3300011271 | Vadose Zone Soil | LSDGDKRLVLAMIRKMATLVPPAAVKKPLVRRPSA* |
| Ga0137389_108200982 | 3300012096 | Vadose Zone Soil | STTLSDGDKRLVLAMIRKMATLIPPPAVKKLFVRRPAV* |
| Ga0137388_101861661 | 3300012189 | Vadose Zone Soil | LSDGDKRLVLAMIRKMASLIPPPVRKPLVRRPTA* |
| Ga0137363_111312481 | 3300012202 | Vadose Zone Soil | STTLSDGDKRLVLAMIRKMATLIPPPAPKKLIVRRPTV* |
| Ga0137399_100715663 | 3300012203 | Vadose Zone Soil | YSTTLSDGDKRLVLAMIRKMATLLPVAAAKKMLVRRPTA* |
| Ga0137399_111176771 | 3300012203 | Vadose Zone Soil | FSTTLSDGDKRLVLAMIRKMATLVPPPTAKKPLVRRPTA* |
| Ga0137399_117294121 | 3300012203 | Vadose Zone Soil | TLSEGDKRLVLAMIRKMATVMPPPTRKPLARRSAY* |
| Ga0137362_101897732 | 3300012205 | Vadose Zone Soil | STTLSDGDKRLVLAMIRKMATLLPVAAAKKLLVRRPTA* |
| Ga0137376_102506201 | 3300012208 | Vadose Zone Soil | TLSDGDKRLVLAMIRKMATLIPPPAAKKMIVRRPTA* |
| Ga0137385_100425021 | 3300012359 | Vadose Zone Soil | STSLSDGDKRLVLAMIRKMASLIPPPTRKPAVRRTAF* |
| Ga0137360_102270361 | 3300012361 | Vadose Zone Soil | TLSDGDKRLVLAMIRKMATLLPPPAPKKLIVRRPTA* |
| Ga0137360_109548362 | 3300012361 | Vadose Zone Soil | SDGDKRLVLAMIRKMATLLPPPAPKKLIVRRPTA* |
| Ga0137390_109519901 | 3300012363 | Vadose Zone Soil | TLSDGDKRLVLAMIRKMATMIPPPARKPLIRRTAV* |
| Ga0137358_101834902 | 3300012582 | Vadose Zone Soil | KKYSTTLSEGDKRLVLAMIRKMATLLPAQAAQAKKPMLRRPSL* |
| Ga0137395_101927352 | 3300012917 | Vadose Zone Soil | YSTTLSDGDKRLVLAMIRKMATLLPPPAPKKLIVRRPTA* |
| Ga0137413_116950371 | 3300012924 | Vadose Zone Soil | LSDGDKRLVLAMIRKMATLLPPPAPKKLIVRRPTA* |
| Ga0137419_100913221 | 3300012925 | Vadose Zone Soil | LSDGDKRLVLAMIRKMATLVPPPTTKKPLARRPTA* |
| Ga0137419_107045981 | 3300012925 | Vadose Zone Soil | STTLSDGDKRLVLAMIRKMATLVPPPAAKKPLARRPTA* |
| Ga0137416_104995121 | 3300012927 | Vadose Zone Soil | LSDGDKRLVLAMIRKMATLIPPPAPKKLIVRRPTA* |
| Ga0137416_110975712 | 3300012927 | Vadose Zone Soil | STTLSDGDKRLVLAMIRKMATLVPPPAAKKPLVRRPTA* |
| Ga0137410_116071432 | 3300012944 | Vadose Zone Soil | LSDGDKRLVLAMIRKMATVIPPPPRKIIARRTAY* |
| Ga0137410_119039121 | 3300012944 | Vadose Zone Soil | STTLSEGDKRLVLAMIRKMATLLPTQAAAQAKKAILRRPSL* |
| Ga0134079_101373231 | 3300014166 | Grasslands Soil | SEGDKRLVLAMIRKMATLLPVQAAKKLVARRTTA* |
| Ga0181534_109754751 | 3300014168 | Bog | TLSDGDKRLVLAMIRKMATVIPPPPRKVAPRRTAF* |
| Ga0181525_104517591 | 3300014654 | Bog | TLSDGDKRLVLAMIRKMASLIPPTPPARKAAPRRNAF* |
| Ga0157379_113571763 | 3300014968 | Switchgrass Rhizosphere | LSDGDKRLVLAMIRKMASLIPPPTAKKPVVRRPVTV* |
| Ga0132255_1022248471 | 3300015374 | Arabidopsis Rhizosphere | EGDKRLVLAMIRKMASLIPPPTAVKKQIVRRPTV* |
| Ga0182036_117593241 | 3300016270 | Soil | KKYSTTLSEGDKRLVLAMIRKMATLLPAQAAQAKKTTMRRPSL |
| Ga0182032_111777601 | 3300016357 | Soil | EGDKRLVLAMIRKMATLLPAQAAQAKKTVMRRPSL |
| Ga0182040_116362931 | 3300016387 | Soil | TTLSEGDKRLVLAMIRKMATLLPAAAAQAKKPVLRRPAL |
| Ga0182037_114034821 | 3300016404 | Soil | TLSDGDKRLVLAMIRKMATMIPPPVRKPLVRRPAV |
| Ga0182037_118073561 | 3300016404 | Soil | YSTTLSEGDKRLVLAMIRKMATLLPAQAAQAKKPVMRRPSL |
| Ga0182038_100509661 | 3300016445 | Soil | TLSDGDKRLVLAMIRKMATLLPAQAQQAKKAVVRRASL |
| Ga0187802_100943972 | 3300017822 | Freshwater Sediment | YSTTLSDGDKRLVLAMIRKMAAVIPPPVRKPVQRRTAY |
| Ga0187818_105210842 | 3300017823 | Freshwater Sediment | TTLSDGDKRLVLAMIRKMATLLPAAAAAKKLVVRRPTA |
| Ga0187849_10084391 | 3300017929 | Peatland | TTLSDGDKRLVLAMIRKMATLLPVQAGQQMRKPVLRRPTL |
| Ga0187801_101474022 | 3300017933 | Freshwater Sediment | LSEGDKRLVLAMIRKMATLIPAQAAQAKKPVLRRPSL |
| Ga0187780_100338911 | 3300017973 | Tropical Peatland | LSDGDKRLVLAMIRKMATLLPPAVAKKLIARRPAV |
| Ga0187765_100086321 | 3300018060 | Tropical Peatland | YSSTLSDGDKRLVLAMIRKMATLVPAVARKAVARRPMA |
| Ga0187772_102752032 | 3300018085 | Tropical Peatland | DGDKRLVLAMIRKMATLIPAQAAQAKKPMLRRPTL |
| Ga0187772_110877692 | 3300018085 | Tropical Peatland | KRYSTTLSDENKRLVLAMIRKMATVVPSQRKAAARRVSF |
| Ga0187771_111939741 | 3300018088 | Tropical Peatland | KKYSTTLSDGDKRLVLAMIRKMATLLPVQAGQQARKPIPRRPGL |
| Ga0187770_104380741 | 3300018090 | Tropical Peatland | TLSEGDKRLVLAMIRKMATLLPAQAAQAKRQPLRRPSL |
| Ga0179594_101302592 | 3300020170 | Vadose Zone Soil | TTLSDGDKRLVLAMIRKMATLLPPPAPKKLIVRRPTA |
| Ga0210395_114241342 | 3300020582 | Soil | TLSDGDKRLVLAMIRKMATLVPPPTAKKPIVRRPTA |
| Ga0215015_106289781 | 3300021046 | Soil | RYTTTLSDGDKRLVLAMIRKMASLIPPPVRKPVMRRQTA |
| Ga0210406_112122162 | 3300021168 | Soil | YSTTLSEGDKRLVLAMIRKMATLLPAAAAQAKKPLLRRPAL |
| Ga0210400_103031982 | 3300021170 | Soil | TLSDGDKRLVLAMIRKMATLIPPPAVKKLFVRRPAV |
| Ga0210408_100620663 | 3300021178 | Soil | STTLSDGDKRLVLAMIRKMATLLPPTSVVKKALVRRPTA |
| Ga0210396_102986021 | 3300021180 | Soil | TTLSEGDKRLVLAMIRKMATLLPAQAAAQAKKPILRRPSL |
| Ga0210387_117203042 | 3300021405 | Soil | TLSEGDKRLVLAMIRKMATLLPTQAAAQAKKPMLRRPSL |
| Ga0210387_117602562 | 3300021405 | Soil | TTLSEGDKRLVLAMIRKMATLLPAAAAQAKKPLLRRPAL |
| Ga0210383_111239151 | 3300021407 | Soil | LSEGDKRLVLAMIRKMATLLPAAAAQAKKPVLRRPAL |
| Ga0210383_112266832 | 3300021407 | Soil | TKRFSTTLSDGDKRLVLAMIRKMASLIPPPVAKKPVVRRPATV |
| Ga0210391_100462844 | 3300021433 | Soil | GDKRLVLAMIRKMATLLPTQAAAQAKKPMLRRPSL |
| Ga0210392_109463392 | 3300021475 | Soil | LSEGDKRLVLAMIRKMATLLPTQAAAQAKKPMLRRPSL |
| Ga0210398_100718373 | 3300021477 | Soil | TTLSDGDKRLVLAMIRKMATLLPAQAAQAKKAVVRRPSL |
| Ga0210402_109158161 | 3300021478 | Soil | FSTTLSDGDKRLVLAMIRKMATLIPPPVTKKLVIRRPTV |
| Ga0210402_112420731 | 3300021478 | Soil | FSTTLSEGDKRLVLAMIRKMASLIPPPVSKKTIIRRTATV |
| Ga0210409_103917161 | 3300021559 | Soil | KKYSTTLSDGDKRLVLAMIRKMATLLPVAAAKKVLVRRPTA |
| Ga0126371_138251051 | 3300021560 | Tropical Forest Soil | TLSDGDKRLVLAMIRKMATLIPAQAAQAKKPMLRRPSL |
| Ga0247691_10566981 | 3300024222 | Soil | RYSSTLSDGDKRLVLAMIRKMATMLPPPVRKPVARRPMA |
| Ga0179589_102063122 | 3300024288 | Vadose Zone Soil | KYSTTLSEGDKRLVLAMIRKMATLLPTQAAAQAKNPMLRRPSL |
| Ga0207693_111971732 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | YSSTLSDGDKRLVLAMIRKMATMIPPPVRKPLVRRPAV |
| Ga0209802_11559301 | 3300026328 | Soil | TTLSDGDKRLVLAMIRKMATLIPPPAAKKFIVRRPTA |
| Ga0179587_100602351 | 3300026557 | Vadose Zone Soil | TTLSDGDKRLVLAMIRKMATLIPPPAAKKLIVRRPTA |
| Ga0207728_1160952 | 3300026833 | Tropical Forest Soil | LSEGDKRLVLAMIRKMATLIPAQAAAAKKPVLRRPSL |
| Ga0209076_11554682 | 3300027643 | Vadose Zone Soil | YSTTLSDGDKRLVLAMIRKMATLIPPPAPKKLIVRRPTA |
| Ga0209039_100806102 | 3300027825 | Bog Forest Soil | KKYSTTLSDGDKRLVLAMIRKMATLLPVQAGQQVRKPVVLRRPTL |
| Ga0209180_107517471 | 3300027846 | Vadose Zone Soil | FSTTLSDGDKRLVLAMIRKMATLVPPPAAKKPLARRPTA |
| Ga0209283_106519941 | 3300027875 | Vadose Zone Soil | TNTLSDGNKRLVLAMIRKMATLIPPPARKVVVRRTTV |
| Ga0209169_101905982 | 3300027879 | Soil | STTLSDGDKRLVLAMIRKMATLIPPPTTKKLVIRRTTTA |
| Ga0209488_101706161 | 3300027903 | Vadose Zone Soil | KRCSTTLSDGDKRLVLAMIRKMATLVPPPTAKKPIIRRPTA |
| Ga0209583_102484262 | 3300027910 | Watersheds | FSTTLSDGDKRLVLAMIRKMATLVPPPTTKKPLARRPTA |
| Ga0137415_105534092 | 3300028536 | Vadose Zone Soil | STTLSDGDKRLVLAMIRKMATLVPPPAAKKPLVRRPTA |
| Ga0308309_105491811 | 3300028906 | Soil | YSTTLSEGDKRLVLAMIRKMATLLPAQAAQSKKPILRRPSL |
| Ga0302324_1018087091 | 3300031236 | Palsa | STTLSDGDKRLVLAMIRKMAIILPPPVARKPLPRRSAF |
| Ga0307469_101007902 | 3300031720 | Hardwood Forest Soil | LSDGDKRLVLAMIRKMATLLPVAAAKKLLVRRPTA |
| Ga0302315_102321971 | 3300031837 | Palsa | LSDGDKRLVVAMIRKMATILPPPGPKKVVVARRMTA |
| Ga0306925_115284982 | 3300031890 | Soil | KKYSTTLSEGDKRLVLAMIRKMATLLPAQAAQAKKPVMRRPSL |
| Ga0306921_100272878 | 3300031912 | Soil | RYSSTLSDGDKRLVLAMIRKMATMVPPPVRKPMVRRPAL |
| Ga0310909_116434531 | 3300031947 | Soil | LSEGDKRLVLAMIRKMATLLPAQAAQAKKPVMRRPSL |
| Ga0326597_106887791 | 3300031965 | Soil | SLSDGDKRLVLAMIRKMASLIPPPARKAVARRSVL |
| Ga0318559_104429821 | 3300032039 | Soil | KKYSTTLSEGDKRLVLAMIRKMATLLPAQAVKKLVARRPTV |
| Ga0306924_106533461 | 3300032076 | Soil | KYSTTLSEGDKRLVLAMIRKMATLLPAQAAQAKKTAMRRPSL |
| Ga0318525_104121872 | 3300032089 | Soil | TTLSEGDKRLVLAMIRKMATLLPAQAAQAKKPVMRRPSL |
| Ga0318540_102384622 | 3300032094 | Soil | LSDGDKRLVLAMIRKMATLLPAQAQQAKKAVVRRASL |
| Ga0307470_103041923 | 3300032174 | Hardwood Forest Soil | KRFSTTLSDGDKRLVLAMIRKMATLIPPPAAKKALVRRPTA |
| Ga0307471_1001734341 | 3300032180 | Hardwood Forest Soil | LSEGDKRLVLAMIRKMATLLPAQAAQTKKPAMRRPAL |
| Ga0306920_1006302031 | 3300032261 | Soil | EGDKRLVLAMIRKMATLLPAQAAQSKKAVMRRPAL |
| Ga0306920_1031059482 | 3300032261 | Soil | MPQLDASDGDKRLALAIIRKMATMIPPLRKPLERRPAI |
| Ga0335078_105302213 | 3300032805 | Soil | RYSSTLSDENKRLVLAMIRKMATVVPAQRKAAVRRVSF |
| Ga0335080_105870922 | 3300032828 | Soil | KYSTTLSEGDKRLVLAMIRKMATLLPTQAAAQAKKTVLRRPSL |
| ⦗Top⦘ |