Metagenome Family F060177

Basic Information
Family ID	F060177
Family Type	Metagenome
Number of Sequences	133
Average Sequence Length	38 residues
Representative Sequence	TTLSDGDKRLVLAMIRKMATLIPPPAAKKLIVRRPTA
Number of Associated Samples	117
Number of Associated Scaffolds	133

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	0.00 %
% of genes near scaffold ends (potentially truncated)	99.25 %
% of genes from short scaffolds (< 2000 bps)	86.47 %
Associated GOLD sequencing projects	111
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.40

Most Common Taxonomy
Group	Unclassified (54.135 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (27.068 % of family members)
Environment Ontology (ENVO)	Unclassified (31.579 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (51.880 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 23.08% β-sheet: 0.00% Coil/Unstructured: 76.92%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 133 Family Scaffolds
PF00005	ABC_tran	25.56
PF00664	ABC_membrane	12.78
PF01507	PAPS_reduct	5.26
PF03061	4HBT	3.01
PF02517	Rce1-like	2.26
PF06271	RDD	1.50
PF03486	HI0933_like	1.50
PF00072	Response_reg	0.75
PF08238	Sel1	0.75
PF03681	Obsolete Pfam Family	0.75
PF00903	Glyoxalase	0.75
PF04820	Trp_halogenase	0.75
PF00160	Pro_isomerase	0.75
PF12704	MacB_PCD	0.75
PF12697	Abhydrolase_6	0.75
PF07690	MFS_1	0.75
PF00009	GTP_EFTU	0.75
PF02559	CarD_CdnL_TRCF	0.75
PF01425	Amidase	0.75

COG ID	Name	Functional Category	% Frequency in 133 Family Scaffolds
COG0493	NADPH-dependent glutamate synthase beta chain or related oxidoreductase	Amino acid transport and metabolism [E]	3.01
COG0654	2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases	Energy production and conversion [C]	3.01
COG1266	Membrane protease YdiL, CAAX protease family	Posttranslational modification, protein turnover, chaperones [O]	2.26
COG4449	Predicted protease, Abi (CAAX) family	General function prediction only [R]	2.26
COG0029	Aspartate oxidase	Coenzyme transport and metabolism [H]	1.50
COG0446	NADPH-dependent 2,4-dienoyl-CoA reductase, sulfur reductase, or a related oxidoreductase	Lipid transport and metabolism [I]	1.50
COG0492	Thioredoxin reductase	Posttranslational modification, protein turnover, chaperones [O]	1.50
COG0644	Dehydrogenase (flavoprotein)	Energy production and conversion [C]	1.50
COG1053	Succinate dehydrogenase/fumarate reductase, flavoprotein subunit	Energy production and conversion [C]	1.50
COG1249	Dihydrolipoamide dehydrogenase (E3) component of pyruvate/2-oxoglutarate dehydrogenase complex or glutathione oxidoreductase	Energy production and conversion [C]	1.50
COG1714	Uncharacterized membrane protein YckC, RDD family	Function unknown [S]	1.50
COG2072	Predicted flavoprotein CzcO associated with the cation diffusion facilitator CzcD	Inorganic ion transport and metabolism [P]	1.50
COG2081	Predicted flavoprotein YhiN	General function prediction only [R]	1.50
COG2509	FAD-dependent dehydrogenase	General function prediction only [R]	1.50
COG3634	Alkyl hydroperoxide reductase subunit AhpF	Defense mechanisms [V]	1.50
COG0154	Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase	Translation, ribosomal structure and biogenesis [J]	0.75
COG0652	Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family	Posttranslational modification, protein turnover, chaperones [O]	0.75

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.14 %
All Organisms	root	All Organisms	45.86 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.14 %
cellular organisms	root	All Organisms → cellular organisms	45.86 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.14 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	45.86 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.14 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	30.08 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1.50 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.75 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.14 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	12.78 %
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	7.52 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.75 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	0.75 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.75 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.14 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	12.78 %
Acidobacteriales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales	6.77 %
Bryobacterales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales	0.75 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.75 %
unclassified Chloroflexi	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi	0.75 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.75 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.14 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	12.78 %
Acidobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	6.77 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	0.75 %
Solibacteraceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae	0.75 %
Micromonosporales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales	0.75 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.75 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.14 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	12.78 %
Acidipila	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidipila	1.50 %
Candidatus Sulfopaludibacter	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter	0.75 %
Micromonosporaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae	0.75 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	0.75 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.75 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.14 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	12.78 %
unclassified Acidipila	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidipila → unclassified Acidipila	1.50 %
unclassified Candidatus Sulfopaludibacter	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter	0.75 %
Micromonospora	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora	0.75 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	0.75 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.75 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.14 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	12.78 %
Acidipila sp.	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidipila → unclassified Acidipila → Acidipila sp.	1.50 %
Candidatus Sulfopaludibacter sp. SbA4	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4	0.75 %
Micromonospora olivasterospora	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora olivasterospora	0.75 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	0.75 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.75 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000364\|INPhiseqgaiiFebDRAFT_101307964	Not Available	789	Open in IMG/M
3300001661\|JGI12053J15887_10499608	Not Available	580	Open in IMG/M
3300002245\|JGIcombinedJ26739_100275558	Not Available	1568	Open in IMG/M
3300004091\|Ga0062387_100004725	All Organisms → cellular organisms → Bacteria	4367	Open in IMG/M
3300004091\|Ga0062387_100760852	Not Available	717	Open in IMG/M
3300004152\|Ga0062386_100454833	Not Available	1036	Open in IMG/M
3300004635\|Ga0062388_100555239	Not Available	1041	Open in IMG/M
3300005542\|Ga0070732_10829307	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	564	Open in IMG/M
3300005554\|Ga0066661_10370238	All Organisms → cellular organisms → Bacteria	877	Open in IMG/M
3300005555\|Ga0066692_10811657	Not Available	575	Open in IMG/M
3300005575\|Ga0066702_10325300	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	936	Open in IMG/M
3300005602\|Ga0070762_10472736	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidipila → unclassified Acidipila → Acidipila sp.	818	Open in IMG/M
3300006176\|Ga0070765_100048211	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	3458	Open in IMG/M
3300006903\|Ga0075426_10394735	All Organisms → cellular organisms → Bacteria	1020	Open in IMG/M
3300009038\|Ga0099829_10605514	Not Available	911	Open in IMG/M
3300009088\|Ga0099830_10516965	All Organisms → cellular organisms → Bacteria → Acidobacteria	975	Open in IMG/M
3300009088\|Ga0099830_11074267	Not Available	667	Open in IMG/M
3300009090\|Ga0099827_10467374	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora olivasterospora	1082	Open in IMG/M
3300009177\|Ga0105248_10100933	All Organisms → cellular organisms → Bacteria	3252	Open in IMG/M
3300009177\|Ga0105248_12704311	All Organisms → cellular organisms → Bacteria	566	Open in IMG/M
3300009521\|Ga0116222_1547733	All Organisms → cellular organisms → Bacteria	508	Open in IMG/M
3300009522\|Ga0116218_1392365	Not Available	620	Open in IMG/M
3300009545\|Ga0105237_10987327	Not Available	849	Open in IMG/M
3300009637\|Ga0116118_1216081	All Organisms → cellular organisms → Bacteria → Acidobacteria	597	Open in IMG/M
3300009760\|Ga0116131_1030953	Not Available	1841	Open in IMG/M
3300010046\|Ga0126384_12124643	Not Available	539	Open in IMG/M
3300010047\|Ga0126382_10070215	All Organisms → cellular organisms → Bacteria → Proteobacteria	2144	Open in IMG/M
3300010048\|Ga0126373_11206880	Not Available	823	Open in IMG/M
3300010159\|Ga0099796_10243160	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	745	Open in IMG/M
3300010359\|Ga0126376_10988332	Not Available	840	Open in IMG/M
3300010360\|Ga0126372_10561150	Not Available	1087	Open in IMG/M
3300010360\|Ga0126372_10646412	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1023	Open in IMG/M
3300010361\|Ga0126378_12621250	All Organisms → cellular organisms → Bacteria	576	Open in IMG/M
3300010366\|Ga0126379_10980718	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	949	Open in IMG/M
3300010376\|Ga0126381_102470480	Not Available	745	Open in IMG/M
3300010396\|Ga0134126_12836493	Not Available	525	Open in IMG/M
3300010398\|Ga0126383_11441856	Not Available	778	Open in IMG/M
3300010401\|Ga0134121_12507549	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	558	Open in IMG/M
3300011120\|Ga0150983_15451454	Not Available	532	Open in IMG/M
3300011269\|Ga0137392_11091307	Not Available	655	Open in IMG/M
3300011271\|Ga0137393_10647833	Not Available	905	Open in IMG/M
3300012096\|Ga0137389_10820098	Not Available	799	Open in IMG/M
3300012189\|Ga0137388_10186166	All Organisms → cellular organisms → Bacteria → Acidobacteria	1863	Open in IMG/M
3300012202\|Ga0137363_11131248	Not Available	666	Open in IMG/M
3300012203\|Ga0137399_10071566	All Organisms → cellular organisms → Bacteria → Acidobacteria	2602	Open in IMG/M
3300012203\|Ga0137399_11117677	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4	663	Open in IMG/M
3300012203\|Ga0137399_11729412	All Organisms → cellular organisms → Bacteria → Acidobacteria	514	Open in IMG/M
3300012205\|Ga0137362_10189773	Not Available	1768	Open in IMG/M
3300012208\|Ga0137376_10250620	Not Available	1535	Open in IMG/M
3300012359\|Ga0137385_10042502	All Organisms → cellular organisms → Bacteria	4071	Open in IMG/M
3300012361\|Ga0137360_10227036	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	1524	Open in IMG/M
3300012361\|Ga0137360_10954836	Not Available	739	Open in IMG/M
3300012363\|Ga0137390_10951990	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	812	Open in IMG/M
3300012582\|Ga0137358_10183490	Not Available	1428	Open in IMG/M
3300012917\|Ga0137395_10192735	Not Available	1415	Open in IMG/M
3300012924\|Ga0137413_11695037	Not Available	519	Open in IMG/M
3300012925\|Ga0137419_10091322	Not Available	2085	Open in IMG/M
3300012925\|Ga0137419_10704598	Not Available	819	Open in IMG/M
3300012927\|Ga0137416_10499512	Not Available	1047	Open in IMG/M
3300012927\|Ga0137416_11097571	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	714	Open in IMG/M
3300012944\|Ga0137410_11607143	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidipila → unclassified Acidipila → Acidipila sp.	570	Open in IMG/M
3300012944\|Ga0137410_11903912	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	527	Open in IMG/M
3300014166\|Ga0134079_10137323	All Organisms → cellular organisms → Bacteria	973	Open in IMG/M
3300014168\|Ga0181534_10975475	All Organisms → cellular organisms → Bacteria → Acidobacteria	510	Open in IMG/M
3300014654\|Ga0181525_10451759	All Organisms → cellular organisms → Bacteria → Acidobacteria	709	Open in IMG/M
3300014968\|Ga0157379_11357176	Not Available	688	Open in IMG/M
3300015374\|Ga0132255_102224847	Not Available	836	Open in IMG/M
3300016270\|Ga0182036_11759324	All Organisms → cellular organisms → Bacteria	524	Open in IMG/M
3300016357\|Ga0182032_11177760	Not Available	659	Open in IMG/M
3300016387\|Ga0182040_11636293	Not Available	549	Open in IMG/M
3300016404\|Ga0182037_11403482	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	618	Open in IMG/M
3300016404\|Ga0182037_11807356	All Organisms → cellular organisms → Bacteria	546	Open in IMG/M
3300016445\|Ga0182038_10050966	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2763	Open in IMG/M
3300017822\|Ga0187802_10094397	All Organisms → cellular organisms → Bacteria → Acidobacteria	1122	Open in IMG/M
3300017823\|Ga0187818_10521084	Not Available	534	Open in IMG/M
3300017929\|Ga0187849_1008439	All Organisms → cellular organisms → Bacteria	7288	Open in IMG/M
3300017933\|Ga0187801_10147402	Not Available	915	Open in IMG/M
3300017973\|Ga0187780_10033891	All Organisms → cellular organisms → Bacteria → Acidobacteria	3593	Open in IMG/M
3300018060\|Ga0187765_10008632	All Organisms → cellular organisms → Bacteria	4496	Open in IMG/M
3300018085\|Ga0187772_10275203	Not Available	1148	Open in IMG/M
3300018085\|Ga0187772_11087769	All Organisms → cellular organisms → Bacteria → Acidobacteria	586	Open in IMG/M
3300018088\|Ga0187771_11193974	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	645	Open in IMG/M
3300018090\|Ga0187770_10438074	Not Available	1029	Open in IMG/M
3300020170\|Ga0179594_10130259	All Organisms → cellular organisms → Bacteria	921	Open in IMG/M
3300020582\|Ga0210395_11424134	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	505	Open in IMG/M
3300021046\|Ga0215015_10628978	All Organisms → cellular organisms → Bacteria	1032	Open in IMG/M
3300021168\|Ga0210406_11212216	Not Available	548	Open in IMG/M
3300021170\|Ga0210400_10303198	Not Available	1311	Open in IMG/M
3300021178\|Ga0210408_10062066	All Organisms → cellular organisms → Bacteria → Acidobacteria	2920	Open in IMG/M
3300021180\|Ga0210396_10298602	Not Available	1426	Open in IMG/M
3300021405\|Ga0210387_11720304	Not Available	530	Open in IMG/M
3300021405\|Ga0210387_11760256	Not Available	523	Open in IMG/M
3300021407\|Ga0210383_11123915	Not Available	663	Open in IMG/M
3300021407\|Ga0210383_11226683	Not Available	629	Open in IMG/M
3300021433\|Ga0210391_10046284	All Organisms → cellular organisms → Bacteria	3466	Open in IMG/M
3300021475\|Ga0210392_10946339	Not Available	644	Open in IMG/M
3300021477\|Ga0210398_10071837	Not Available	2815	Open in IMG/M
3300021478\|Ga0210402_10915816	Not Available	803	Open in IMG/M
3300021478\|Ga0210402_11242073	Not Available	672	Open in IMG/M
3300021559\|Ga0210409_10391716	Not Available	1244	Open in IMG/M
3300021560\|Ga0126371_13825105	Not Available	507	Open in IMG/M
3300024222\|Ga0247691_1056698	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	591	Open in IMG/M
3300024288\|Ga0179589_10206312	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	860	Open in IMG/M
3300025915\|Ga0207693_11197173	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	573	Open in IMG/M
3300026328\|Ga0209802_1155930	All Organisms → cellular organisms → Bacteria	955	Open in IMG/M
3300026557\|Ga0179587_10060235	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	2208	Open in IMG/M
3300026833\|Ga0207728_116095	Not Available	681	Open in IMG/M
3300027643\|Ga0209076_1155468	Not Available	639	Open in IMG/M
3300027825\|Ga0209039_10080610	Not Available	1422	Open in IMG/M
3300027846\|Ga0209180_10751747	Not Available	526	Open in IMG/M
3300027875\|Ga0209283_10651994	All Organisms → cellular organisms → Bacteria → Acidobacteria	662	Open in IMG/M
3300027879\|Ga0209169_10190598	Not Available	1071	Open in IMG/M
3300027903\|Ga0209488_10170616	Not Available	1643	Open in IMG/M
3300027910\|Ga0209583_10248426	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	784	Open in IMG/M
3300028536\|Ga0137415_10553409	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	960	Open in IMG/M
3300028906\|Ga0308309_10549181	Not Available	1001	Open in IMG/M
3300031236\|Ga0302324_101808709	Not Available	776	Open in IMG/M
3300031720\|Ga0307469_10100790	Not Available	2027	Open in IMG/M
3300031837\|Ga0302315_10232197	Not Available	1091	Open in IMG/M
3300031890\|Ga0306925_11528498	Not Available	652	Open in IMG/M
3300031912\|Ga0306921_10027287	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	6335	Open in IMG/M
3300031947\|Ga0310909_11643453	Not Available	508	Open in IMG/M
3300031965\|Ga0326597_10688779	All Organisms → cellular organisms → Bacteria → Acidobacteria	1078	Open in IMG/M
3300032039\|Ga0318559_10442982	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	606	Open in IMG/M
3300032076\|Ga0306924_10653346	Not Available	1185	Open in IMG/M
3300032089\|Ga0318525_10412187	Not Available	692	Open in IMG/M
3300032094\|Ga0318540_10238462	Not Available	878	Open in IMG/M
3300032174\|Ga0307470_10304192	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	1083	Open in IMG/M
3300032180\|Ga0307471_100173434	Not Available	2115	Open in IMG/M
3300032261\|Ga0306920_100630203	Not Available	1585	Open in IMG/M
3300032261\|Ga0306920_103105948	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	624	Open in IMG/M
3300032805\|Ga0335078_10530221	All Organisms → cellular organisms → Bacteria	1504	Open in IMG/M
3300032828\|Ga0335080_10587092	Not Available	1173	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	95.49%
Host-Associated	Host-Associated	4.51%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	84.96%
Aquatic	Environmental → Aquatic	10.53%
Plants	Host-Associated → Plants	4.51%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	83.46%
Freshwater	Environmental → Aquatic → Freshwater	9.77%
Rhizosphere	Host-Associated → Plants → Rhizosphere	3.76%
Peat	Environmental → Terrestrial → Peat	1.50%
Sediment	Environmental → Aquatic → Sediment	0.75%
Rhizoplane	Host-Associated → Plants → Rhizoplane	0.75%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	70.68%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	9.77%
Loam	Environmental → Terrestrial → Soil → Loam	6.77%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	6.02%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	3.76%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	1.50%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	0.75%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	0.75%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	41.35%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	25.56%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog	6.02%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	6.02%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	6.02%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	3.76%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	3.76%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment	2.26%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	1.50%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	1.50%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	0.75%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	0.75%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	0.75%

Habitat	Taxonomy	Distribution
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	27.07%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	15.04%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	8.27%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	8.27%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	4.51%
Bog Forest Soil	Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil	3.76%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	3.76%
Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil	3.01%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment	2.26%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	2.26%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	2.26%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog	1.50%
Peatland	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland	1.50%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	1.50%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	1.50%
Peatlands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil	1.50%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	1.50%
Palsa	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa	1.50%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.50%
Peatland	Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland	0.75%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	0.75%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	0.75%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	0.75%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	0.75%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	0.75%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	0.75%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	0.75%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.75%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.75%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000364	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300001661	Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly)	Environmental	Open in IMG/M
3300002245	Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)	Environmental	Open in IMG/M
3300004091	Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3	Environmental	Open in IMG/M
3300004152	Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3	Environmental	Open in IMG/M
3300004635	Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3	Environmental	Open in IMG/M
3300005542	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1	Environmental	Open in IMG/M
3300005554	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110	Environmental	Open in IMG/M
3300005555	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141	Environmental	Open in IMG/M
3300005575	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151	Environmental	Open in IMG/M
3300005602	Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2	Environmental	Open in IMG/M
3300006176	Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5	Environmental	Open in IMG/M
3300006903	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5	Host-Associated	Open in IMG/M
3300009038	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG	Environmental	Open in IMG/M
3300009088	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG	Environmental	Open in IMG/M
3300009090	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG	Environmental	Open in IMG/M
3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Host-Associated	Open in IMG/M
3300009521	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG	Environmental	Open in IMG/M
3300009522	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG	Environmental	Open in IMG/M
3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Host-Associated	Open in IMG/M
3300009637	Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40	Environmental	Open in IMG/M
3300009760	Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_100	Environmental	Open in IMG/M
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental	Open in IMG/M
3300010047	Tropical forest soil microbial communities from Panama - MetaG Plot_30	Environmental	Open in IMG/M
3300010048	Tropical forest soil microbial communities from Panama - MetaG Plot_11	Environmental	Open in IMG/M
3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Environmental	Open in IMG/M
3300010359	Tropical forest soil microbial communities from Panama - MetaG Plot_15	Environmental	Open in IMG/M
3300010360	Tropical forest soil microbial communities from Panama - MetaG Plot_6	Environmental	Open in IMG/M
3300010361	Tropical forest soil microbial communities from Panama - MetaG Plot_23	Environmental	Open in IMG/M
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental	Open in IMG/M
3300010376	Tropical forest soil microbial communities from Panama - MetaG Plot_28	Environmental	Open in IMG/M
3300010396	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2	Environmental	Open in IMG/M
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental	Open in IMG/M
3300010401	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1	Environmental	Open in IMG/M
3300011120	Combined assembly of Microbial Forest Soil metaT	Environmental	Open in IMG/M
3300011269	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG	Environmental	Open in IMG/M
3300011271	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG	Environmental	Open in IMG/M
3300012096	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG	Environmental	Open in IMG/M
3300012189	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG	Environmental	Open in IMG/M
3300012202	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG	Environmental	Open in IMG/M
3300012203	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG	Environmental	Open in IMG/M
3300012205	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG	Environmental	Open in IMG/M
3300012208	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG	Environmental	Open in IMG/M
3300012359	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG	Environmental	Open in IMG/M
3300012361	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG	Environmental	Open in IMG/M
3300012363	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG	Environmental	Open in IMG/M
3300012582	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG	Environmental	Open in IMG/M
3300012917	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG	Environmental	Open in IMG/M
3300012924	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012925	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012927	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012944	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300014166	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015	Environmental	Open in IMG/M
3300014168	Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG	Environmental	Open in IMG/M
3300014654	Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG	Environmental	Open in IMG/M
3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300016270	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080	Environmental	Open in IMG/M
3300016357	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000	Environmental	Open in IMG/M
3300016387	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176	Environmental	Open in IMG/M
3300016404	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082	Environmental	Open in IMG/M
3300016445	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108	Environmental	Open in IMG/M
3300017822	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2	Environmental	Open in IMG/M
3300017823	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3	Environmental	Open in IMG/M
3300017929	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100	Environmental	Open in IMG/M
3300017933	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1	Environmental	Open in IMG/M
3300017973	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG	Environmental	Open in IMG/M
3300018060	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG	Environmental	Open in IMG/M
3300018085	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG	Environmental	Open in IMG/M
3300018088	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG	Environmental	Open in IMG/M
3300018090	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG	Environmental	Open in IMG/M
3300020170	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300020582	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O	Environmental	Open in IMG/M
3300021046	Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth	Environmental	Open in IMG/M
3300021168	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M	Environmental	Open in IMG/M
3300021170	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M	Environmental	Open in IMG/M
3300021178	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M	Environmental	Open in IMG/M
3300021180	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O	Environmental	Open in IMG/M
3300021405	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O	Environmental	Open in IMG/M
3300021407	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O	Environmental	Open in IMG/M
3300021433	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O	Environmental	Open in IMG/M
3300021475	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O	Environmental	Open in IMG/M
3300021477	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O	Environmental	Open in IMG/M
3300021478	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M	Environmental	Open in IMG/M
3300021559	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M	Environmental	Open in IMG/M
3300021560	Tropical forest soil microbial communities from Panama - MetaG Plot_4	Environmental	Open in IMG/M
3300024222	Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK32	Environmental	Open in IMG/M
3300024288	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal	Environmental	Open in IMG/M
3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300026328	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes)	Environmental	Open in IMG/M
3300026557	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal	Environmental	Open in IMG/M
3300026833	Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 54 (SPAdes)	Environmental	Open in IMG/M
3300027643	Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes)	Environmental	Open in IMG/M
3300027825	Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes)	Environmental	Open in IMG/M
3300027846	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)	Environmental	Open in IMG/M
3300027875	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)	Environmental	Open in IMG/M
3300027879	Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes)	Environmental	Open in IMG/M
3300027903	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)	Environmental	Open in IMG/M
3300027910	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes)	Environmental	Open in IMG/M
3300028536	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300028906	Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)	Environmental	Open in IMG/M
3300031236	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1	Environmental	Open in IMG/M
3300031720	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515	Environmental	Open in IMG/M
3300031837	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_1	Environmental	Open in IMG/M
3300031890	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)	Environmental	Open in IMG/M
3300031912	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)	Environmental	Open in IMG/M
3300031947	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H	Environmental	Open in IMG/M
3300031965	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185	Environmental	Open in IMG/M
3300032039	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21	Environmental	Open in IMG/M
3300032076	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)	Environmental	Open in IMG/M
3300032089	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23	Environmental	Open in IMG/M
3300032094	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25	Environmental	Open in IMG/M
3300032174	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05	Environmental	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M
3300032261	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)	Environmental	Open in IMG/M
3300032805	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2	Environmental	Open in IMG/M
3300032828	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
INPhiseqgaiiFebDRAFT_1013079642	3300000364	Soil	KKYSTTLSEGDKRLVLAMIRKMATLLPAAAAQAKKPLLRRPAL*
JGI12053J15887_104996081	3300001661	Forest Soil	SDGDKRLVLAMIRKMATLLPVAAAKKLLVRRPTA*
JGIcombinedJ26739_1002755582	3300002245	Forest Soil	FSTTLSEGDKRLVLAMIRKMASLIPPPVAKKPVIRRPATA*
Ga0062387_1000047254	3300004091	Bog Forest Soil	RFSTTLSDGDKRLVLAMIRKMATLIPPPVSKKLVIRRATTV*
Ga0062387_1007608521	3300004091	Bog Forest Soil	RFSTTLSDGDKRLVLAMIRKMATLIPPPVSKKLVIRRVTTV*
Ga0062386_1004548331	3300004152	Bog Forest Soil	LSDGDKRLVLAMIRKMATLLPVQAGQQVRKPVVLRRPTL*
Ga0062388_1005552391	3300004635	Bog Forest Soil	KYSNTLSDGDKRLVLAMIRKMAMLLPPPATKKMVVRRPAV*
Ga0070732_108293072	3300005542	Surface Soil	KRFSTTLSDGDKRLVLAMIRKMATLVPPPATKKPLARRPTA*
Ga0066661_103702384	3300005554	Soil	EIKKYTNTLSEGDKRLVLAMIRKMTTLIPTVAAKKIIARHPTA*
Ga0066692_108116572	3300005555	Soil	TTLSDGDKRLVLAMIRKMATLLPVAAAKKLLVRRPTA*
Ga0066702_103253001	3300005575	Soil	NTLSDGDKRLVLAMIRKMATLIPPAAVKKIIARRPTA*
Ga0070762_104727362	3300005602	Soil	STSLSDGDKRLVLAMIRKMATVIPPPPRKVVQRRTAY*
Ga0070765_1000482111	3300006176	Soil	FSTTLSDGDKRLVLAMIRKMASLIPPPTAKKPVVRRPATV*
Ga0075426_103947353	3300006903	Populus Rhizosphere	TLSDGDKRLVLAMIRKMATMIPPPVRKPLVRRPAV*
Ga0099829_106055141	3300009038	Vadose Zone Soil	TLSEGDKRLVLAMIRKMATMIPPVAVKKLVVRRPMA*
Ga0099830_105169651	3300009088	Vadose Zone Soil	YSSTLSDGDKRLVLAMIRKMATLIPPPPRRPTQRRSVF*
Ga0099830_110742672	3300009088	Vadose Zone Soil	DKRLVLAMIRKMATLLPTQAAAQAKKPMLRRPSL*
Ga0099827_104673742	3300009090	Vadose Zone Soil	SDGDKRLVLAMIRKMATLIPPPVAKKLIVRRPTV*
Ga0105248_101009331	3300009177	Switchgrass Rhizosphere	SEGDKRLVLAMIRKMASLIPPPTAVKKPVIRRPTV*
Ga0105248_127043112	3300009177	Switchgrass Rhizosphere	YSSTLSEGDKRLVLAMIRKMATMIPPPVRKPLVRRPAV*
Ga0116222_15477331	3300009521	Peatlands Soil	TLSDGDKRLVLAMIRKMATLLPAQAGQQVRKPLLRRPTL*
Ga0116218_13923651	3300009522	Peatlands Soil	TLSDGDKRLVLAMIRKMATIAPPPQPVRKAVAPRRHAY*
Ga0105237_109873271	3300009545	Corn Rhizosphere	EGDKRLVLAMIRKMASLIPPPTAVKKPVIRRPTV*
Ga0116118_12160811	3300009637	Peatland	KYSTTLSDGDKRLVLAMIRKMAVIIPPPPVRKPMARRSAF*
Ga0116131_10309532	3300009760	Peatland	LSDGDKRLVLAMIRKMATLLPVQAGQQMRKPVLRRPTL*
Ga0126384_121246431	3300010046	Tropical Forest Soil	NTLSDGDKRLVLAMVRKMATLLPPNAAVVKKMIARRPTA*
Ga0126382_100702151	3300010047	Tropical Forest Soil	KYSNTLSEGDKRLVLAMIRKMATLIPPVAAAKKIMARRPTA*
Ga0126373_112068801	3300010048	Tropical Forest Soil	EGDKRLVLAMIRKMATLLPAQAAQAKKAVVRRPSL*
Ga0099796_102431602	3300010159	Vadose Zone Soil	LSDGDKRLVLVMIRKMATLVPPPAPKKPLLRRPTA*
Ga0126376_109883321	3300010359	Tropical Forest Soil	STTLSEGDKRLVLAMIRKMATLLPAQAAQAKKPMLRRPSL*
Ga0126372_105611501	3300010360	Tropical Forest Soil	VEIKRYSNTLSEGDKRLVLAMIRKMATLIPTGAAVAKKVIARRPTA*
Ga0126372_106464123	3300010360	Tropical Forest Soil	YSSTLSEGDKRLVLAMIRKMATMLPPPARKPVARRPMA*
Ga0126378_126212501	3300010361	Tropical Forest Soil	TLSDGDKRLVLAMIRKMATMVPPPVRKPMVRRPSL*
Ga0126379_109807181	3300010366	Tropical Forest Soil	TLSEGDKRLVLAMIRKMATLLPTQAVKKLVARRPTA*
Ga0126381_1024704801	3300010376	Tropical Forest Soil	EGDKRLVLAMIRKKATLLPAAAAHAKKPLLRRPAL*
Ga0134126_128364932	3300010396	Terrestrial Soil	TLSEGDKRLVLAMIRKMASLIPPPTAVKKPVIRRPTV*
Ga0126383_114418561	3300010398	Tropical Forest Soil	TSLSDGDKRLVLAMIRKMASLITAGPPTVKKAIARRPVA*
Ga0134121_125075492	3300010401	Terrestrial Soil	SDGDKRLVLAMIRKMATLIPPPATKKAVVRRPTA*
Ga0150983_154514541	3300011120	Forest Soil	EIKCFITTLSDGDMRLVLAMIRKMTTLIPPPTTKKLVIRRPTV*
Ga0137392_110913071	3300011269	Vadose Zone Soil	KYSTTLSEGDKRLVLAMIRKMATLLPTHAAAQAKKPMLRRPSL*
Ga0137393_106478332	3300011271	Vadose Zone Soil	LSDGDKRLVLAMIRKMATLVPPAAVKKPLVRRPSA*
Ga0137389_108200982	3300012096	Vadose Zone Soil	STTLSDGDKRLVLAMIRKMATLIPPPAVKKLFVRRPAV*
Ga0137388_101861661	3300012189	Vadose Zone Soil	LSDGDKRLVLAMIRKMASLIPPPVRKPLVRRPTA*
Ga0137363_111312481	3300012202	Vadose Zone Soil	STTLSDGDKRLVLAMIRKMATLIPPPAPKKLIVRRPTV*
Ga0137399_100715663	3300012203	Vadose Zone Soil	YSTTLSDGDKRLVLAMIRKMATLLPVAAAKKMLVRRPTA*
Ga0137399_111176771	3300012203	Vadose Zone Soil	FSTTLSDGDKRLVLAMIRKMATLVPPPTAKKPLVRRPTA*
Ga0137399_117294121	3300012203	Vadose Zone Soil	TLSEGDKRLVLAMIRKMATVMPPPTRKPLARRSAY*
Ga0137362_101897732	3300012205	Vadose Zone Soil	STTLSDGDKRLVLAMIRKMATLLPVAAAKKLLVRRPTA*
Ga0137376_102506201	3300012208	Vadose Zone Soil	TLSDGDKRLVLAMIRKMATLIPPPAAKKMIVRRPTA*
Ga0137385_100425021	3300012359	Vadose Zone Soil	STSLSDGDKRLVLAMIRKMASLIPPPTRKPAVRRTAF*
Ga0137360_102270361	3300012361	Vadose Zone Soil	TLSDGDKRLVLAMIRKMATLLPPPAPKKLIVRRPTA*
Ga0137360_109548362	3300012361	Vadose Zone Soil	SDGDKRLVLAMIRKMATLLPPPAPKKLIVRRPTA*
Ga0137390_109519901	3300012363	Vadose Zone Soil	TLSDGDKRLVLAMIRKMATMIPPPARKPLIRRTAV*
Ga0137358_101834902	3300012582	Vadose Zone Soil	KKYSTTLSEGDKRLVLAMIRKMATLLPAQAAQAKKPMLRRPSL*
Ga0137395_101927352	3300012917	Vadose Zone Soil	YSTTLSDGDKRLVLAMIRKMATLLPPPAPKKLIVRRPTA*
Ga0137413_116950371	3300012924	Vadose Zone Soil	LSDGDKRLVLAMIRKMATLLPPPAPKKLIVRRPTA*
Ga0137419_100913221	3300012925	Vadose Zone Soil	LSDGDKRLVLAMIRKMATLVPPPTTKKPLARRPTA*
Ga0137419_107045981	3300012925	Vadose Zone Soil	STTLSDGDKRLVLAMIRKMATLVPPPAAKKPLARRPTA*
Ga0137416_104995121	3300012927	Vadose Zone Soil	LSDGDKRLVLAMIRKMATLIPPPAPKKLIVRRPTA*
Ga0137416_110975712	3300012927	Vadose Zone Soil	STTLSDGDKRLVLAMIRKMATLVPPPAAKKPLVRRPTA*
Ga0137410_116071432	3300012944	Vadose Zone Soil	LSDGDKRLVLAMIRKMATVIPPPPRKIIARRTAY*
Ga0137410_119039121	3300012944	Vadose Zone Soil	STTLSEGDKRLVLAMIRKMATLLPTQAAAQAKKAILRRPSL*
Ga0134079_101373231	3300014166	Grasslands Soil	SEGDKRLVLAMIRKMATLLPVQAAKKLVARRTTA*
Ga0181534_109754751	3300014168	Bog	TLSDGDKRLVLAMIRKMATVIPPPPRKVAPRRTAF*
Ga0181525_104517591	3300014654	Bog	TLSDGDKRLVLAMIRKMASLIPPTPPARKAAPRRNAF*
Ga0157379_113571763	3300014968	Switchgrass Rhizosphere	LSDGDKRLVLAMIRKMASLIPPPTAKKPVVRRPVTV*
Ga0132255_1022248471	3300015374	Arabidopsis Rhizosphere	EGDKRLVLAMIRKMASLIPPPTAVKKQIVRRPTV*
Ga0182036_117593241	3300016270	Soil	KKYSTTLSEGDKRLVLAMIRKMATLLPAQAAQAKKTTMRRPSL
Ga0182032_111777601	3300016357	Soil	EGDKRLVLAMIRKMATLLPAQAAQAKKTVMRRPSL
Ga0182040_116362931	3300016387	Soil	TTLSEGDKRLVLAMIRKMATLLPAAAAQAKKPVLRRPAL
Ga0182037_114034821	3300016404	Soil	TLSDGDKRLVLAMIRKMATMIPPPVRKPLVRRPAV
Ga0182037_118073561	3300016404	Soil	YSTTLSEGDKRLVLAMIRKMATLLPAQAAQAKKPVMRRPSL
Ga0182038_100509661	3300016445	Soil	TLSDGDKRLVLAMIRKMATLLPAQAQQAKKAVVRRASL
Ga0187802_100943972	3300017822	Freshwater Sediment	YSTTLSDGDKRLVLAMIRKMAAVIPPPVRKPVQRRTAY
Ga0187818_105210842	3300017823	Freshwater Sediment	TTLSDGDKRLVLAMIRKMATLLPAAAAAKKLVVRRPTA
Ga0187849_10084391	3300017929	Peatland	TTLSDGDKRLVLAMIRKMATLLPVQAGQQMRKPVLRRPTL
Ga0187801_101474022	3300017933	Freshwater Sediment	LSEGDKRLVLAMIRKMATLIPAQAAQAKKPVLRRPSL
Ga0187780_100338911	3300017973	Tropical Peatland	LSDGDKRLVLAMIRKMATLLPPAVAKKLIARRPAV
Ga0187765_100086321	3300018060	Tropical Peatland	YSSTLSDGDKRLVLAMIRKMATLVPAVARKAVARRPMA
Ga0187772_102752032	3300018085	Tropical Peatland	DGDKRLVLAMIRKMATLIPAQAAQAKKPMLRRPTL
Ga0187772_110877692	3300018085	Tropical Peatland	KRYSTTLSDENKRLVLAMIRKMATVVPSQRKAAARRVSF
Ga0187771_111939741	3300018088	Tropical Peatland	KKYSTTLSDGDKRLVLAMIRKMATLLPVQAGQQARKPIPRRPGL
Ga0187770_104380741	3300018090	Tropical Peatland	TLSEGDKRLVLAMIRKMATLLPAQAAQAKRQPLRRPSL
Ga0179594_101302592	3300020170	Vadose Zone Soil	TTLSDGDKRLVLAMIRKMATLLPPPAPKKLIVRRPTA
Ga0210395_114241342	3300020582	Soil	TLSDGDKRLVLAMIRKMATLVPPPTAKKPIVRRPTA
Ga0215015_106289781	3300021046	Soil	RYTTTLSDGDKRLVLAMIRKMASLIPPPVRKPVMRRQTA
Ga0210406_112122162	3300021168	Soil	YSTTLSEGDKRLVLAMIRKMATLLPAAAAQAKKPLLRRPAL
Ga0210400_103031982	3300021170	Soil	TLSDGDKRLVLAMIRKMATLIPPPAVKKLFVRRPAV
Ga0210408_100620663	3300021178	Soil	STTLSDGDKRLVLAMIRKMATLLPPTSVVKKALVRRPTA
Ga0210396_102986021	3300021180	Soil	TTLSEGDKRLVLAMIRKMATLLPAQAAAQAKKPILRRPSL
Ga0210387_117203042	3300021405	Soil	TLSEGDKRLVLAMIRKMATLLPTQAAAQAKKPMLRRPSL
Ga0210387_117602562	3300021405	Soil	TTLSEGDKRLVLAMIRKMATLLPAAAAQAKKPLLRRPAL
Ga0210383_111239151	3300021407	Soil	LSEGDKRLVLAMIRKMATLLPAAAAQAKKPVLRRPAL
Ga0210383_112266832	3300021407	Soil	TKRFSTTLSDGDKRLVLAMIRKMASLIPPPVAKKPVVRRPATV
Ga0210391_100462844	3300021433	Soil	GDKRLVLAMIRKMATLLPTQAAAQAKKPMLRRPSL
Ga0210392_109463392	3300021475	Soil	LSEGDKRLVLAMIRKMATLLPTQAAAQAKKPMLRRPSL
Ga0210398_100718373	3300021477	Soil	TTLSDGDKRLVLAMIRKMATLLPAQAAQAKKAVVRRPSL
Ga0210402_109158161	3300021478	Soil	FSTTLSDGDKRLVLAMIRKMATLIPPPVTKKLVIRRPTV
Ga0210402_112420731	3300021478	Soil	FSTTLSEGDKRLVLAMIRKMASLIPPPVSKKTIIRRTATV
Ga0210409_103917161	3300021559	Soil	KKYSTTLSDGDKRLVLAMIRKMATLLPVAAAKKVLVRRPTA
Ga0126371_138251051	3300021560	Tropical Forest Soil	TLSDGDKRLVLAMIRKMATLIPAQAAQAKKPMLRRPSL
Ga0247691_10566981	3300024222	Soil	RYSSTLSDGDKRLVLAMIRKMATMLPPPVRKPVARRPMA
Ga0179589_102063122	3300024288	Vadose Zone Soil	KYSTTLSEGDKRLVLAMIRKMATLLPTQAAAQAKNPMLRRPSL
Ga0207693_111971732	3300025915	Corn, Switchgrass And Miscanthus Rhizosphere	YSSTLSDGDKRLVLAMIRKMATMIPPPVRKPLVRRPAV
Ga0209802_11559301	3300026328	Soil	TTLSDGDKRLVLAMIRKMATLIPPPAAKKFIVRRPTA
Ga0179587_100602351	3300026557	Vadose Zone Soil	TTLSDGDKRLVLAMIRKMATLIPPPAAKKLIVRRPTA
Ga0207728_1160952	3300026833	Tropical Forest Soil	LSEGDKRLVLAMIRKMATLIPAQAAAAKKPVLRRPSL
Ga0209076_11554682	3300027643	Vadose Zone Soil	YSTTLSDGDKRLVLAMIRKMATLIPPPAPKKLIVRRPTA
Ga0209039_100806102	3300027825	Bog Forest Soil	KKYSTTLSDGDKRLVLAMIRKMATLLPVQAGQQVRKPVVLRRPTL
Ga0209180_107517471	3300027846	Vadose Zone Soil	FSTTLSDGDKRLVLAMIRKMATLVPPPAAKKPLARRPTA
Ga0209283_106519941	3300027875	Vadose Zone Soil	TNTLSDGNKRLVLAMIRKMATLIPPPARKVVVRRTTV
Ga0209169_101905982	3300027879	Soil	STTLSDGDKRLVLAMIRKMATLIPPPTTKKLVIRRTTTA
Ga0209488_101706161	3300027903	Vadose Zone Soil	KRCSTTLSDGDKRLVLAMIRKMATLVPPPTAKKPIIRRPTA
Ga0209583_102484262	3300027910	Watersheds	FSTTLSDGDKRLVLAMIRKMATLVPPPTTKKPLARRPTA
Ga0137415_105534092	3300028536	Vadose Zone Soil	STTLSDGDKRLVLAMIRKMATLVPPPAAKKPLVRRPTA
Ga0308309_105491811	3300028906	Soil	YSTTLSEGDKRLVLAMIRKMATLLPAQAAQSKKPILRRPSL
Ga0302324_1018087091	3300031236	Palsa	STTLSDGDKRLVLAMIRKMAIILPPPVARKPLPRRSAF
Ga0307469_101007902	3300031720	Hardwood Forest Soil	LSDGDKRLVLAMIRKMATLLPVAAAKKLLVRRPTA
Ga0302315_102321971	3300031837	Palsa	LSDGDKRLVVAMIRKMATILPPPGPKKVVVARRMTA
Ga0306925_115284982	3300031890	Soil	KKYSTTLSEGDKRLVLAMIRKMATLLPAQAAQAKKPVMRRPSL
Ga0306921_100272878	3300031912	Soil	RYSSTLSDGDKRLVLAMIRKMATMVPPPVRKPMVRRPAL
Ga0310909_116434531	3300031947	Soil	LSEGDKRLVLAMIRKMATLLPAQAAQAKKPVMRRPSL
Ga0326597_106887791	3300031965	Soil	SLSDGDKRLVLAMIRKMASLIPPPARKAVARRSVL
Ga0318559_104429821	3300032039	Soil	KKYSTTLSEGDKRLVLAMIRKMATLLPAQAVKKLVARRPTV
Ga0306924_106533461	3300032076	Soil	KYSTTLSEGDKRLVLAMIRKMATLLPAQAAQAKKTAMRRPSL
Ga0318525_104121872	3300032089	Soil	TTLSEGDKRLVLAMIRKMATLLPAQAAQAKKPVMRRPSL
Ga0318540_102384622	3300032094	Soil	LSDGDKRLVLAMIRKMATLLPAQAQQAKKAVVRRASL
Ga0307470_103041923	3300032174	Hardwood Forest Soil	KRFSTTLSDGDKRLVLAMIRKMATLIPPPAAKKALVRRPTA
Ga0307471_1001734341	3300032180	Hardwood Forest Soil	LSEGDKRLVLAMIRKMATLLPAQAAQTKKPAMRRPAL
Ga0306920_1006302031	3300032261	Soil	EGDKRLVLAMIRKMATLLPAQAAQSKKAVMRRPAL
Ga0306920_1031059482	3300032261	Soil	MPQLDASDGDKRLALAIIRKMATMIPPLRKPLERRPAI
Ga0335078_105302213	3300032805	Soil	RYSSTLSDENKRLVLAMIRKMATVVPAQRKAAVRRVSF
Ga0335080_105870922	3300032828	Soil	KYSTTLSEGDKRLVLAMIRKMATLLPTQAAAQAKKTVLRRPSL

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.40
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.40
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F060177

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign