


| Basic Information | |
|---|---|
| Family ID | F060137 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 133 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MKKVKSGNRSSAAKGNGAPKNVDEYLAGVPEPARSTLNKIR |
| Number of Associated Samples | 114 |
| Number of Associated Scaffolds | 133 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 21.05 % |
| % of genes near scaffold ends (potentially truncated) | 98.50 % |
| % of genes from short scaffolds (< 2000 bps) | 89.47 % |
| Associated GOLD sequencing projects | 109 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.32 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (72.180 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (29.323 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.579 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.617 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 24.64% β-sheet: 0.00% Coil/Unstructured: 75.36% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.32 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 133 Family Scaffolds |
|---|---|---|
| PF02687 | FtsX | 4.51 |
| PF12704 | MacB_PCD | 3.76 |
| PF04389 | Peptidase_M28 | 3.01 |
| PF07681 | DoxX | 2.26 |
| PF12697 | Abhydrolase_6 | 2.26 |
| PF03795 | YCII | 1.50 |
| PF00903 | Glyoxalase | 1.50 |
| PF06983 | 3-dmu-9_3-mt | 1.50 |
| PF08450 | SGL | 1.50 |
| PF03992 | ABM | 1.50 |
| PF00005 | ABC_tran | 1.50 |
| PF13377 | Peripla_BP_3 | 1.50 |
| PF07676 | PD40 | 1.50 |
| PF00069 | Pkinase | 1.50 |
| PF14332 | DUF4388 | 0.75 |
| PF00072 | Response_reg | 0.75 |
| PF00190 | Cupin_1 | 0.75 |
| PF01557 | FAA_hydrolase | 0.75 |
| PF00196 | GerE | 0.75 |
| PF14833 | NAD_binding_11 | 0.75 |
| PF05299 | Peptidase_M61 | 0.75 |
| PF01546 | Peptidase_M20 | 0.75 |
| PF01593 | Amino_oxidase | 0.75 |
| PF02540 | NAD_synthase | 0.75 |
| PF01406 | tRNA-synt_1e | 0.75 |
| PF04191 | PEMT | 0.75 |
| PF01842 | ACT | 0.75 |
| PF13360 | PQQ_2 | 0.75 |
| PF00266 | Aminotran_5 | 0.75 |
| PF05163 | DinB | 0.75 |
| PF08308 | PEGA | 0.75 |
| PF13581 | HATPase_c_2 | 0.75 |
| PF08713 | DNA_alkylation | 0.75 |
| PF06271 | RDD | 0.75 |
| PF00528 | BPD_transp_1 | 0.75 |
| PF00675 | Peptidase_M16 | 0.75 |
| PF13884 | Peptidase_S74 | 0.75 |
| PF01967 | MoaC | 0.75 |
| PF13533 | Biotin_lipoyl_2 | 0.75 |
| PF14534 | DUF4440 | 0.75 |
| PF00480 | ROK | 0.75 |
| PF12681 | Glyoxalase_2 | 0.75 |
| PF00484 | Pro_CA | 0.75 |
| PF00753 | Lactamase_B | 0.75 |
| PF08241 | Methyltransf_11 | 0.75 |
| PF02518 | HATPase_c | 0.75 |
| PF12840 | HTH_20 | 0.75 |
| PF08240 | ADH_N | 0.75 |
| PF01977 | UbiD | 0.75 |
| PF00884 | Sulfatase | 0.75 |
| PF10047 | DUF2281 | 0.75 |
| PF04020 | Phage_holin_4_2 | 0.75 |
| PF01791 | DeoC | 0.75 |
| COG ID | Name | Functional Category | % Frequency in 133 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 6.02 |
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 2.26 |
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 2.26 |
| COG1940 | Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domain | Transcription [K] | 1.50 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.50 |
| COG2764 | Zn-dependent glyoxalase, PhnB family | Energy production and conversion [C] | 1.50 |
| COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 1.50 |
| COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 1.50 |
| COG3865 | Glyoxalase superfamily enzyme, possible 3-demethylubiquinone-9 3-methyltransferase | General function prediction only [R] | 1.50 |
| COG0018 | Arginyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.75 |
| COG0043 | 3-polyprenyl-4-hydroxybenzoate decarboxylase | Coenzyme transport and metabolism [H] | 0.75 |
| COG0143 | Methionyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.75 |
| COG0171 | NH3-dependent NAD+ synthetase | Coenzyme transport and metabolism [H] | 0.75 |
| COG0215 | Cysteinyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.75 |
| COG0288 | Carbonic anhydrase | Inorganic ion transport and metabolism [P] | 0.75 |
| COG0308 | Aminopeptidase N, contains DUF3458 domain | Amino acid transport and metabolism [E] | 0.75 |
| COG0315 | Molybdenum cofactor biosynthesis enzyme MoaC | Coenzyme transport and metabolism [H] | 0.75 |
| COG1714 | Uncharacterized membrane protein YckC, RDD family | Function unknown [S] | 0.75 |
| COG1950 | Uncharacterized membrane protein YvlD, DUF360 family | Function unknown [S] | 0.75 |
| COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.75 |
| COG3975 | Predicted metalloprotease, contains C-terminal PDZ domain | General function prediction only [R] | 0.75 |
| COG4912 | 3-methyladenine DNA glycosylase AlkD | Replication, recombination and repair [L] | 0.75 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 72.93 % |
| Unclassified | root | N/A | 27.07 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001089|JGI12683J13190_1005165 | All Organisms → cellular organisms → Bacteria | 1495 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_105126845 | Not Available | 802 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101301628 | Not Available | 618 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101443562 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 582 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101621426 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 545 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101737918 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300004152|Ga0062386_100437107 | All Organisms → cellular organisms → Bacteria | 1057 | Open in IMG/M |
| 3300005177|Ga0066690_10342413 | All Organisms → cellular organisms → Bacteria | 1013 | Open in IMG/M |
| 3300005181|Ga0066678_10138258 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1513 | Open in IMG/M |
| 3300005447|Ga0066689_10540551 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 736 | Open in IMG/M |
| 3300005536|Ga0070697_102023145 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300005537|Ga0070730_10827526 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300005555|Ga0066692_10050844 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2303 | Open in IMG/M |
| 3300005559|Ga0066700_10511491 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
| 3300005576|Ga0066708_10010117 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 4402 | Open in IMG/M |
| 3300006046|Ga0066652_101798183 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 554 | Open in IMG/M |
| 3300006086|Ga0075019_10194800 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1198 | Open in IMG/M |
| 3300006162|Ga0075030_101214698 | Not Available | 592 | Open in IMG/M |
| 3300006176|Ga0070765_102105203 | Not Available | 527 | Open in IMG/M |
| 3300006224|Ga0079037_101827386 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300006800|Ga0066660_11164771 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 607 | Open in IMG/M |
| 3300007258|Ga0099793_10317029 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 759 | Open in IMG/M |
| 3300007265|Ga0099794_10578095 | Not Available | 594 | Open in IMG/M |
| 3300009088|Ga0099830_10011752 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5383 | Open in IMG/M |
| 3300009089|Ga0099828_10181125 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1875 | Open in IMG/M |
| 3300009089|Ga0099828_10565714 | Not Available | 1024 | Open in IMG/M |
| 3300009518|Ga0116128_1143254 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300009519|Ga0116108_1090184 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 934 | Open in IMG/M |
| 3300009521|Ga0116222_1113125 | All Organisms → cellular organisms → Bacteria | 1169 | Open in IMG/M |
| 3300010043|Ga0126380_10230880 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → unclassified Planctomycetia → Planctomycetia bacterium 21-64-5 | 1265 | Open in IMG/M |
| 3300010301|Ga0134070_10430788 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rubrivivax → unclassified Rubrivivax → Rubrivivax sp. A210 | 525 | Open in IMG/M |
| 3300010304|Ga0134088_10176732 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1020 | Open in IMG/M |
| 3300010337|Ga0134062_10103923 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1222 | Open in IMG/M |
| 3300010359|Ga0126376_13059715 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300010391|Ga0136847_12055690 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1839 | Open in IMG/M |
| 3300011269|Ga0137392_10016642 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 5061 | Open in IMG/M |
| 3300011270|Ga0137391_10100867 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2501 | Open in IMG/M |
| 3300011271|Ga0137393_10536339 | Not Available | 1004 | Open in IMG/M |
| 3300011271|Ga0137393_10878198 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 765 | Open in IMG/M |
| 3300011271|Ga0137393_11779672 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
| 3300011419|Ga0137446_1135289 | Not Available | 593 | Open in IMG/M |
| 3300012189|Ga0137388_10164571 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 1976 | Open in IMG/M |
| 3300012198|Ga0137364_10034431 | All Organisms → cellular organisms → Bacteria | 3260 | Open in IMG/M |
| 3300012199|Ga0137383_11152836 | Not Available | 559 | Open in IMG/M |
| 3300012200|Ga0137382_10191866 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1401 | Open in IMG/M |
| 3300012200|Ga0137382_10289362 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1141 | Open in IMG/M |
| 3300012202|Ga0137363_10178753 | All Organisms → cellular organisms → Bacteria | 1688 | Open in IMG/M |
| 3300012202|Ga0137363_10557476 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 965 | Open in IMG/M |
| 3300012209|Ga0137379_10840410 | Not Available | 823 | Open in IMG/M |
| 3300012210|Ga0137378_10632679 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 980 | Open in IMG/M |
| 3300012210|Ga0137378_10656569 | All Organisms → cellular organisms → Bacteria | 959 | Open in IMG/M |
| 3300012349|Ga0137387_10128357 | All Organisms → cellular organisms → Bacteria | 1793 | Open in IMG/M |
| 3300012349|Ga0137387_11167084 | Not Available | 545 | Open in IMG/M |
| 3300012351|Ga0137386_10576518 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 810 | Open in IMG/M |
| 3300012356|Ga0137371_11159941 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 578 | Open in IMG/M |
| 3300012357|Ga0137384_10329073 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1268 | Open in IMG/M |
| 3300012362|Ga0137361_11164061 | Not Available | 693 | Open in IMG/M |
| 3300012363|Ga0137390_11106591 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanosarcinales → Methanosarcinaceae → Methanosarcina → unclassified Methanosarcina → Methanosarcina sp. DH2 | 741 | Open in IMG/M |
| 3300012582|Ga0137358_10063357 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2473 | Open in IMG/M |
| 3300012582|Ga0137358_10889252 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 585 | Open in IMG/M |
| 3300012918|Ga0137396_10153446 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1678 | Open in IMG/M |
| 3300012924|Ga0137413_10453909 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 933 | Open in IMG/M |
| 3300012927|Ga0137416_10106275 | All Organisms → cellular organisms → Bacteria | 2121 | Open in IMG/M |
| 3300012927|Ga0137416_11884321 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 547 | Open in IMG/M |
| 3300012929|Ga0137404_10136058 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2027 | Open in IMG/M |
| 3300014164|Ga0181532_10478095 | Not Available | 685 | Open in IMG/M |
| 3300014493|Ga0182016_10177670 | Not Available | 1400 | Open in IMG/M |
| 3300015242|Ga0137412_10647051 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 794 | Open in IMG/M |
| 3300015357|Ga0134072_10231960 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 655 | Open in IMG/M |
| 3300017789|Ga0136617_11193420 | Not Available | 572 | Open in IMG/M |
| 3300017931|Ga0187877_1140865 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 975 | Open in IMG/M |
| 3300017955|Ga0187817_10033730 | All Organisms → cellular organisms → Bacteria | 3112 | Open in IMG/M |
| 3300017975|Ga0187782_11413004 | Not Available | 547 | Open in IMG/M |
| 3300018002|Ga0187868_1156675 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
| 3300018005|Ga0187878_1138384 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 954 | Open in IMG/M |
| 3300018016|Ga0187880_1017680 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4369 | Open in IMG/M |
| 3300018020|Ga0187861_10417296 | Not Available | 561 | Open in IMG/M |
| 3300018057|Ga0187858_10897399 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300018088|Ga0187771_11168497 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 653 | Open in IMG/M |
| 3300018088|Ga0187771_11923390 | Not Available | 502 | Open in IMG/M |
| 3300018090|Ga0187770_11672597 | Not Available | 520 | Open in IMG/M |
| 3300018431|Ga0066655_10578684 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rubrivivax → unclassified Rubrivivax → Rubrivivax sp. A210 | 754 | Open in IMG/M |
| 3300020580|Ga0210403_10759096 | Not Available | 773 | Open in IMG/M |
| 3300020581|Ga0210399_10030564 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4300 | Open in IMG/M |
| 3300020581|Ga0210399_10258226 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1453 | Open in IMG/M |
| 3300021170|Ga0210400_11510379 | Not Available | 532 | Open in IMG/M |
| 3300021181|Ga0210388_11526050 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300021307|Ga0179585_1084013 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1650 | Open in IMG/M |
| 3300021401|Ga0210393_10201748 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1608 | Open in IMG/M |
| 3300021405|Ga0210387_10392160 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1230 | Open in IMG/M |
| 3300021432|Ga0210384_10291433 | All Organisms → cellular organisms → Bacteria | 1469 | Open in IMG/M |
| 3300021474|Ga0210390_10479841 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1048 | Open in IMG/M |
| 3300021559|Ga0210409_11362803 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300021559|Ga0210409_11496669 | Not Available | 551 | Open in IMG/M |
| 3300021861|Ga0213853_11404316 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 620 | Open in IMG/M |
| 3300022731|Ga0224563_1004754 | Not Available | 974 | Open in IMG/M |
| 3300024330|Ga0137417_1151945 | All Organisms → cellular organisms → Bacteria | 1317 | Open in IMG/M |
| 3300025441|Ga0208456_1087959 | Not Available | 539 | Open in IMG/M |
| 3300025812|Ga0208457_1082148 | Not Available | 610 | Open in IMG/M |
| 3300026215|Ga0209849_1027572 | Not Available | 973 | Open in IMG/M |
| 3300026304|Ga0209240_1125473 | All Organisms → cellular organisms → Bacteria | 867 | Open in IMG/M |
| 3300026361|Ga0257176_1053757 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 638 | Open in IMG/M |
| 3300026376|Ga0257167_1083628 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300026528|Ga0209378_1115055 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1165 | Open in IMG/M |
| 3300026551|Ga0209648_10109487 | All Organisms → cellular organisms → Bacteria | 2250 | Open in IMG/M |
| 3300027570|Ga0208043_1156845 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 591 | Open in IMG/M |
| 3300027610|Ga0209528_1134181 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300027625|Ga0208044_1150748 | Not Available | 645 | Open in IMG/M |
| 3300027635|Ga0209625_1135962 | Not Available | 550 | Open in IMG/M |
| 3300027674|Ga0209118_1020406 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2117 | Open in IMG/M |
| 3300028047|Ga0209526_10811072 | Not Available | 578 | Open in IMG/M |
| 3300028536|Ga0137415_10238860 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1628 | Open in IMG/M |
| 3300028536|Ga0137415_10618960 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 894 | Open in IMG/M |
| 3300028673|Ga0257175_1081314 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 622 | Open in IMG/M |
| 3300028798|Ga0302222_10174451 | Not Available | 844 | Open in IMG/M |
| 3300028828|Ga0307312_10306681 | All Organisms → cellular organisms → Bacteria | 1034 | Open in IMG/M |
| 3300028906|Ga0308309_11614736 | Not Available | 552 | Open in IMG/M |
| 3300029945|Ga0311330_11286748 | Not Available | 526 | Open in IMG/M |
| 3300031680|Ga0318574_10652028 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300031708|Ga0310686_106678400 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300031720|Ga0307469_10164576 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1682 | Open in IMG/M |
| 3300031754|Ga0307475_10243897 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae | 1439 | Open in IMG/M |
| 3300031754|Ga0307475_10911070 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 694 | Open in IMG/M |
| 3300031910|Ga0306923_11206405 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300031946|Ga0310910_11345041 | Not Available | 551 | Open in IMG/M |
| 3300032160|Ga0311301_12327237 | Not Available | 608 | Open in IMG/M |
| 3300032180|Ga0307471_101125408 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
| 3300032180|Ga0307471_101741103 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 776 | Open in IMG/M |
| 3300032893|Ga0335069_12766926 | Not Available | 503 | Open in IMG/M |
| 3300032896|Ga0335075_10851393 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 844 | Open in IMG/M |
| 3300033158|Ga0335077_10867673 | All Organisms → cellular organisms → Bacteria | 913 | Open in IMG/M |
| 3300033158|Ga0335077_11740540 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300033289|Ga0310914_10202266 | Not Available | 1773 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 29.32% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.77% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.77% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 4.51% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.76% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 3.01% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.01% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.01% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.01% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.01% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.26% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.26% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.50% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.50% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.50% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.75% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.75% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.75% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.75% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.75% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.75% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.75% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.75% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.75% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.75% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.75% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.75% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.75% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.75% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001089 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 | Environmental | Open in IMG/M |
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006224 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009518 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 | Environmental | Open in IMG/M |
| 3300009519 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300011419 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT357_2 | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300017789 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06) | Environmental | Open in IMG/M |
| 3300017931 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018002 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_40 | Environmental | Open in IMG/M |
| 3300018005 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_150 | Environmental | Open in IMG/M |
| 3300018016 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40 | Environmental | Open in IMG/M |
| 3300018020 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021307 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_06_16RNAfungal (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022731 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU4 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025441 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025812 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300026215 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 (SPAdes) | Environmental | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026361 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-B | Environmental | Open in IMG/M |
| 3300026376 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-B | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027570 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027610 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027625 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027635 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028673 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-B | Environmental | Open in IMG/M |
| 3300028798 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029945 | I_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12683J13190_10051651 | 3300001089 | Forest Soil | MKKVKSGNRGSAAKGNGAPKDVDEYLAGVPEPARGTLNKIRAAI |
| JGIcombinedJ13530_1051268453 | 3300001213 | Wetland | MRKAKSSIHSSSPITAAKSVDEYLENVPEPARSTLN |
| JGIcombinedJ26739_1013016282 | 3300002245 | Forest Soil | MKKVKSGDRRSSARGKGAPKNVDEYFAGVPEPARG |
| JGIcombinedJ26739_1014435622 | 3300002245 | Forest Soil | MFRMKKLKSGVGSSAAKGRGVPKNVDEYLAGVPQPA |
| JGIcombinedJ26739_1016214262 | 3300002245 | Forest Soil | MRKVRSADKRSAAKGKGAPKNVDEYLSAVPEPARGTLNTMRAAVRS |
| JGIcombinedJ26739_1017379182 | 3300002245 | Forest Soil | MKPRKRSPANGRKGVPKNVDEYLARVPEPALSMLNKMRTAIRST |
| Ga0062386_1004371071 | 3300004152 | Bog Forest Soil | MKKPKAGSRGSVSKGKITQKTVDEYLAGVPEPARRTLNKIR |
| Ga0066690_103424131 | 3300005177 | Soil | VKKRKSGNRSPAAGRSKAAKNVADYLSDVPEPARGTLNKIRAAIRASLPSD |
| Ga0066678_101382583 | 3300005181 | Soil | MKKVKSGKRGSAAKGNGAPQDVDEYLAGVPEPARSTLNKVRAAIR |
| Ga0066689_105405512 | 3300005447 | Soil | MKKVKSGNRSSAAKGNGAPKNVDEYLAGVPEPARSTLNKIR |
| Ga0070697_1020231451 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MVGMKKAKSDMRGARAKGKGTPKSVDEYLAGVPEPARGTLNKI |
| Ga0070730_108275261 | 3300005537 | Surface Soil | MARGQKVKSDMRGARAKGKGAPKSVDEYLAGVPEPARGTLNKIRAAI |
| Ga0066692_100508444 | 3300005555 | Soil | LPAIKKGKSGKRGSAAKGKGAPKSIDEYLAGVPERARSTLN |
| Ga0066700_105114913 | 3300005559 | Soil | MKKINSGDRGSAAKGNAAPKNVDEYLAGVPEPARSTL |
| Ga0066708_100101176 | 3300005576 | Soil | MKKVKSGSHSSVAKANGAPKNVDEYLAGIPEPARST |
| Ga0066652_1017981832 | 3300006046 | Soil | MKKANSGDRGSAAKSNVAPKGVDEYLAGVPEPARTTLNT |
| Ga0075019_101948002 | 3300006086 | Watersheds | MKKAKSGDRRSARKSSGAPKNVDEYLARVPEPARSTLNK |
| Ga0075030_1012146982 | 3300006162 | Watersheds | MARMRRVKSSNRRSAATGSSAPKNVDDYLAGVPEPARGTLKKIRAVIRS |
| Ga0070765_1021052031 | 3300006176 | Soil | MKSGPGRSAPKDSGIPKDVDEYLAEVPEPARSTLKKIRAAKKA* |
| Ga0079037_1018273861 | 3300006224 | Freshwater Wetlands | MKKSNLSDRDSAAKGNVAPKNVDEYLAGVPEPARTTLSKVRAVI |
| Ga0066660_111647711 | 3300006800 | Soil | MKKVKSGNRRSAAKSTRAPKNVDEYLAGVPEPARGTLN |
| Ga0099793_103170292 | 3300007258 | Vadose Zone Soil | MKKVKSGSHSSAAKANGAPKNVDEYLAGIPEPARST |
| Ga0099794_105780951 | 3300007265 | Vadose Zone Soil | MKQGKSGTRRSVAKAKGAPTNVDEYLAGVPEPARSTLNKMRSAIRSAAP |
| Ga0099830_100117521 | 3300009088 | Vadose Zone Soil | MKKVKSGNRSSAAKDNGTPKNFAEYLAGVPQPARSTLNKIRAAIRSA |
| Ga0099828_101811253 | 3300009089 | Vadose Zone Soil | MKKVKSGNRSSAAKGNSAPKNVDEYLAGVAEPARSTLNKMRAAIRSA |
| Ga0099828_105657143 | 3300009089 | Vadose Zone Soil | MKKVKSGNRSSAAKGKGAPKNVDEYLAGVPEPARSTLNK |
| Ga0116128_11432541 | 3300009518 | Peatland | MKKATSRGGGFAAKGNARPKDVDEYLASVPEPARATLKRMRAV |
| Ga0116108_10901843 | 3300009519 | Peatland | MKKVKSGNRSSAAIGNGAPKNVDEYLECVPEPARSTLNKIRAAIRCAV |
| Ga0116222_11131252 | 3300009521 | Peatlands Soil | MKKAKPGDRDPAAKPNAAPKDIDEYLAGVPEPARGTL |
| Ga0126380_102308802 | 3300010043 | Tropical Forest Soil | MKKVKPAKRGSAAKGKTAPNNVDEYLARVPNSARGPLNEIRAAIRSVVPAD |
| Ga0134070_104307881 | 3300010301 | Grasslands Soil | VKKLNSGNRSSAAKGSPTPQNVVPKNVDEYLAGVPETARSTLNKMRAAIRS |
| Ga0134088_101767324 | 3300010304 | Grasslands Soil | MKKARSGDRGSGAKGNLVPKNVDEYLAGVPEPARSTLN |
| Ga0134062_101039231 | 3300010337 | Grasslands Soil | MKKANSGDRGSAAKSNVAPKGVDEYLAGVPEPARTT |
| Ga0126376_130597152 | 3300010359 | Tropical Forest Soil | MARVKKRKSANRRSAKANGAPKNVNEYIAGTPEAARSTLNKMRAAIRSVVPPDAT |
| Ga0136847_120556904 | 3300010391 | Freshwater Sediment | MKKTKSSTRGSAAKGNVAPKSVDEYLAGVPEPARSTL |
| Ga0137392_100166421 | 3300011269 | Vadose Zone Soil | MKKVKSGNRSSAAKDNGIPKNLAEYLAGVPQPARGTLNKMR |
| Ga0137391_101008674 | 3300011270 | Vadose Zone Soil | MKKVKSGNRSSAAKGKGAPKNVDEYLAGVPEPDRSTLNKIR |
| Ga0137393_105363393 | 3300011271 | Vadose Zone Soil | MKKVKSGNRSSAAKGKGAPKNVDEYLAGVPEPARSTL |
| Ga0137393_108781983 | 3300011271 | Vadose Zone Soil | MTRMKKAKSGNRSSGAKGKGAPKSVDEYLASVPEPARSMLNKMRAAIRS |
| Ga0137393_117796721 | 3300011271 | Vadose Zone Soil | MKKVKSGNRSSAAKGKGAPKNVDEYLAGVPEPARSTLNKI |
| Ga0137446_11352891 | 3300011419 | Soil | MKKANSGDRGSAAKGNVAPKNVDEYLASVPEPARGTLSK |
| Ga0137388_101645713 | 3300012189 | Vadose Zone Soil | MKKVKSGNGSSAAKGNGAPKNVDEYLAGVTEPARS |
| Ga0137364_100344311 | 3300012198 | Vadose Zone Soil | MKKVKSGSHSSVAKANGAPKNVDEYLAGIPEPARSTLSKIR |
| Ga0137383_111528361 | 3300012199 | Vadose Zone Soil | MRKRQSGHRSSAAKGNGAPKTVDEYLGGVPEPARSTLNKIRDAI |
| Ga0137382_101918662 | 3300012200 | Vadose Zone Soil | MKKVKSGSHSSVAKANGAPKNVDEYLAGIPEPARSTLSKIRMAI |
| Ga0137382_102893624 | 3300012200 | Vadose Zone Soil | MKKVKSGNRSSVAKGSGAPKNVDEYLAGVPEPARSTLNKMR |
| Ga0137363_101787531 | 3300012202 | Vadose Zone Soil | MKKVKSGNHRSAAKGGGAPKNVDEYLAGVPEPARST |
| Ga0137363_105574762 | 3300012202 | Vadose Zone Soil | MKKAKSGKSRSTAAKASVAPKDVDEYLAGVPEPARSTLN |
| Ga0137379_108404101 | 3300012209 | Vadose Zone Soil | MKKVKSNNRSSAAKGNGAPKNVDEYLAGVPQPARSTLNKIRAAI |
| Ga0137378_106326791 | 3300012210 | Vadose Zone Soil | MKSAKIGSGGAAAKGKAAPASVDEYLASVPEPARSTLN |
| Ga0137378_106565691 | 3300012210 | Vadose Zone Soil | MKKVKSGRPSSAAKANGAPKNVDEYLAGIPEPARSTL |
| Ga0137387_101283571 | 3300012349 | Vadose Zone Soil | MKKVKSGKRGSAAKGNGAPQDVDEYLAGVPEPARST |
| Ga0137387_111670841 | 3300012349 | Vadose Zone Soil | MKKVKSGNRSSAAKGNGAPKNVDEYFAGVPEPARSTLNKMRVAIRSA |
| Ga0137386_105765181 | 3300012351 | Vadose Zone Soil | MKKVTSGNRSSAAKGSPTPQNVVPKNVDEYLAGVPEPARSTLNKMRAAIRS |
| Ga0137371_111599411 | 3300012356 | Vadose Zone Soil | MKKANSGDRGSAAKSNVAPKGVDEYLAGVPEPARTTLNTVRAAIRSA |
| Ga0137384_103290731 | 3300012357 | Vadose Zone Soil | MKKVKSGSHSSAAKANRAPKNVDEYLAGIPEPARSTLSK |
| Ga0137361_111640612 | 3300012362 | Vadose Zone Soil | MKKANSGSRGSGAKSSVAPKNVDEYLASVPEPARGTLKKIREAIRS |
| Ga0137390_111065911 | 3300012363 | Vadose Zone Soil | MKKANARARDSSAKSNVAPKNTDEYFARVPEPARSTLKKVRAAIRS |
| Ga0137358_100633573 | 3300012582 | Vadose Zone Soil | VKKARSANRKAAAKRSGAPKNIDEYLADVPEPGRGTLQK |
| Ga0137358_108892521 | 3300012582 | Vadose Zone Soil | MKKVRSGNRSSAAKGSGAPKNVDEYLAGVPEPARSTLNKMRAAI |
| Ga0137396_101534462 | 3300012918 | Vadose Zone Soil | MKKAKSGNRGSTAKDSGAPKNVDEYLAGVPEPARS |
| Ga0137413_104539091 | 3300012924 | Vadose Zone Soil | MKKVKSGSHSSAAKANGAPKNVDEYLAGIPEPARSTLSKMRMAI |
| Ga0137416_101062754 | 3300012927 | Vadose Zone Soil | MKKAKSGNRGSAVKGNRPPKNVDEYLVGVPEPARSTLNKIRA |
| Ga0137416_118843212 | 3300012927 | Vadose Zone Soil | MKKVKSGNRSSVAKASGAPKNVDEYLAGVPEPARSTLNKMRAA |
| Ga0137404_101360585 | 3300012929 | Vadose Zone Soil | MKKVKPGKRGSAAKGNGAPQDVDEYLAGVPEPARSTLK |
| Ga0181532_104780951 | 3300014164 | Bog | LAVLAALPEGIKSRSRSSSAKNTGAPNNVYEYLASLAEPARGTLNKIRAAI |
| Ga0182016_101776703 | 3300014493 | Bog | MKKMKPGNRGFTAKGHGAPKTVDEYLARVPEPARSTLHKIR |
| Ga0137412_106470512 | 3300015242 | Vadose Zone Soil | MKKVKSGSHSSVAKANGAPKNVDEYLAGIPEPARSTLSKIRMAIRSA |
| Ga0134072_102319602 | 3300015357 | Grasslands Soil | MKKVKSGKRNSAEKGTGAPKDFDEYLAGVPEPARGTLNRIRAVIRSAML |
| Ga0136617_111934201 | 3300017789 | Polar Desert Sand | MRNANAGVRGSAAKNKAAPKDVEEYLAGVPEPAHA |
| Ga0187877_11408652 | 3300017931 | Peatland | MKKVKSGNRSSAAIGNGAPKNVDEYLECVPEPARSTLNKIRA |
| Ga0187817_100337303 | 3300017955 | Freshwater Sediment | MARMKKMSPAKRKTAAKRHGAPKTVDEYLACIPEPARSKLKEMR |
| Ga0187782_114130041 | 3300017975 | Tropical Peatland | MKKAKSGSRSSSREGIGAAKAVDEYLAGVPEPARSTLNK |
| Ga0187868_11566751 | 3300018002 | Peatland | MKKVKSGNRSPATKGNGAPKTVDEYLAGVPEPARSTLNKIRAAI |
| Ga0187878_11383842 | 3300018005 | Peatland | MKKAHSGDRGSAARGNLAPKDVDEYLAGVPEPARGTLN |
| Ga0187880_10176809 | 3300018016 | Peatland | MKKVKSGNRGSAAKGNGGPKTVDEYLAGVPEPARSTLNKIRAA |
| Ga0187861_104172962 | 3300018020 | Peatland | MKKGKPLERHSAAAKSAPETVDEYLAGVPEPARSTLQKVR |
| Ga0187858_108973991 | 3300018057 | Peatland | MKKANSGDRDPAPKGNVAPKNVDEYLAGVPEPARS |
| Ga0187771_111684971 | 3300018088 | Tropical Peatland | MKKEKSGNRSPSREGKGAPKTVNEYLAGVPEPARSTLNKIRAA |
| Ga0187771_119233901 | 3300018088 | Tropical Peatland | MRKVKSGNRSAAAKDKGAPKTVNEYLAGVPEPARSTLSK |
| Ga0187770_116725971 | 3300018090 | Tropical Peatland | MKKAKSGTSSSREVKGAPKAVDEYLARVPEPARSTLNKIR |
| Ga0066655_105786841 | 3300018431 | Grasslands Soil | VKKLNSGNRSSAAKANGAPKNFDEYLAGVPEPARSTLNKMRAAIR |
| Ga0210403_107590962 | 3300020580 | Soil | MKKVKSGSRGSATKNKGAPKNVDEYLAGVPEPARGTLNKMRAAIRS |
| Ga0210399_100305645 | 3300020581 | Soil | MKKVKPAKRSSAAKGTGAPKNFDEYLAGVPESARRTLSKLRATIRSVVPPEATEVI |
| Ga0210399_102582261 | 3300020581 | Soil | MKRPKPKGRSSNAKAKGAPKSVDEYIAGVPEPARSTLVNMR |
| Ga0210400_115103792 | 3300021170 | Soil | MKKAVSRNRASSAKSTAPPKTVEEYLAGVREPARGTLNKLRARIKEITIRLVAP |
| Ga0210388_115260502 | 3300021181 | Soil | MVGMKRLPSGNRSSAAKGNGVPKNIDEYLAGVPQPARSTLKKIRVAI |
| Ga0179585_10840133 | 3300021307 | Vadose Zone Soil | MKKGKSGSRRPVAKNSGAPKDVDEYLAGIPEPARGTLN |
| Ga0210393_102017482 | 3300021401 | Soil | MARMKKVKPAKRSSAAKGTGAPKNFDEYLAGAPESARGT |
| Ga0210387_103921601 | 3300021405 | Soil | MKRVKSGARRSAAKANDAPKTVEEYLAGIPEPARTTFNKL |
| Ga0210384_102914332 | 3300021432 | Soil | MKKVKSGNRRSAAKGRGAPKNVDEYLAGFPEPARSTLNKMRAAIR |
| Ga0210390_104798413 | 3300021474 | Soil | MKRPKPKGRSSNAKAKGAPKSVDEYIAGVPEPARSTL |
| Ga0210409_113628031 | 3300021559 | Soil | MKKAKSSHRASSMKRSAAKNVDEYLAAVPEPARTTLNTIHAVI |
| Ga0210409_114966691 | 3300021559 | Soil | MKKVKSGSRGSATKNKGAPKNVDEYLAGVPEPARGTLNKMRAAIRSAV |
| Ga0213853_114043161 | 3300021861 | Watersheds | MKKANPSNRSSAAKGTLAAKTVDAYLAGVPEPARGTLKKIRVAIRS |
| Ga0224563_10047542 | 3300022731 | Soil | MKKSNSRDRCSASKSKIVPENVDEYRAGIPEPARGTFNKMRAAIRSAVPPQAVEVISYRI |
| Ga0137417_11519453 | 3300024330 | Vadose Zone Soil | MKKAMSGTRGSPAKGRPVPKDVDEYLAHVPEPARSTLEKV |
| Ga0208456_10879591 | 3300025441 | Peatland | MKKVKSGNLSSAAKGSGAPKTVDEYLAGVPEPARSALNKIRA |
| Ga0208457_10821481 | 3300025812 | Peatland | MKKANSGARGSAAKGSVVPKNVDDYLAGVPEPARSTLKKVR |
| Ga0209849_10275721 | 3300026215 | Soil | MKQIGSSNRGSVKKLRAAPENVDEYLAGVPEPARSTLTKVRAAIRAAV |
| Ga0209240_11254731 | 3300026304 | Grasslands Soil | MKKVKSGNRRSAPKGRGAPKNVDEYLAGVPEPARDTLNKI |
| Ga0257176_10537571 | 3300026361 | Soil | MRKVKSGNRGSGMKGSAAPKGIDEYLAGVPEPARSTLNRVRATIRS |
| Ga0257167_10836282 | 3300026376 | Soil | MKKVRSGNRSSAAKGSGAPKNVDEYLAGVPEPARSTLNKMR |
| Ga0209378_11150553 | 3300026528 | Soil | MKKVKSGKRNSAEKGTGAPKDFDEYLAGVPEPARGTLNRIRAV |
| Ga0209648_101094873 | 3300026551 | Grasslands Soil | MKKVKSGNRSSAAKGKGAPKNVDEYLAGVPEPARSTLNKIR |
| Ga0208043_11568451 | 3300027570 | Peatlands Soil | MARVRKVKSGKRSSAKKRNTAPKNVDEYLARVAEPARSDFI |
| Ga0209528_11341812 | 3300027610 | Forest Soil | MKKVKSGNRRSAAKGKGAPKNVDDYLAGVPEPARGTL |
| Ga0208044_11507482 | 3300027625 | Peatlands Soil | MKKANSGDRGSAAKGNAAPKNVDEYLAGVAEPARSTLNKVRA |
| Ga0209625_11359622 | 3300027635 | Forest Soil | NRMMKKTKLSSGGSAAKGSPPPKDIDEYLAAVPEPARGTLEKKRVQRKQPV |
| Ga0209118_10204061 | 3300027674 | Forest Soil | MKKVKSGNRSSAAKGNGAPKNVDEYLADVPEPARSTLNK |
| Ga0209526_108110721 | 3300028047 | Forest Soil | MKKVKSGNRSSAAKGKGTPKNVDESLAGVPEPARGTLNK |
| Ga0137415_102388601 | 3300028536 | Vadose Zone Soil | MKKAKSGNRGSAVKGNRPPKNVDEYLVGVPEPARSTLNKIRAEIRS |
| Ga0137415_106189601 | 3300028536 | Vadose Zone Soil | MKKVKSGSHSSAAKANGAPKNVDEYLAGIPEPARSTLS |
| Ga0257175_10813141 | 3300028673 | Soil | MKKSNSSARSSTAKATAPPTTVDDYLAGVPEPARSTL |
| Ga0302222_101744511 | 3300028798 | Palsa | MKKAKSGRRSSAAKAKGNAAPKNVDEYIAGAREPARSTLNKM |
| Ga0307312_103066812 | 3300028828 | Soil | MKKVKSGNRRSAAKSTRAPKNVDEYLAGVPEPARGTLNKIRAAIRSA |
| Ga0308309_116147361 | 3300028906 | Soil | MKSGPGRSAPKDSGIPKDVDEYLAEVPEPARSTLKKIRAAKKA |
| Ga0311330_112867481 | 3300029945 | Bog | MKKVKSGVRKSATKGNGLPKNVDEYLADVPEPARSTLNKIRAA |
| Ga0318574_106520281 | 3300031680 | Soil | MKKDKSGSRSSAAAGNHAPKNVDEYLAGVPEPARTTLN |
| Ga0310686_1066784001 | 3300031708 | Soil | MKKVTSGKRSSVAKGNGAPKDVDEYLAGVPEPARNTLNKVRAII |
| Ga0307469_101645761 | 3300031720 | Hardwood Forest Soil | MKKVRSGNRSSAAKGKGAPKNVDEYLAGVPEPARGTLNE |
| Ga0307475_102438971 | 3300031754 | Hardwood Forest Soil | MKKTKSGDRASAAKSSAAAKNIDEYLASVPDPARTT |
| Ga0307475_109110701 | 3300031754 | Hardwood Forest Soil | MKKVKSGNRSSAAKGKGAPKNVDEYLAGVPEPARGTLNE |
| Ga0306923_112064051 | 3300031910 | Soil | MKKDKSGSRSSAAAGNHAPKNVDEYLAGVPEPARTTLNKLRAA |
| Ga0310910_113450411 | 3300031946 | Soil | MKKVKSDNRSSAAKGNDAPKTVDEYLAGVSEPARSTLKKIRAAI |
| Ga0311301_123272371 | 3300032160 | Peatlands Soil | MKKAKSGTGGSPIKGKSGPKNIDEYLAKVPEPARGTLKK |
| Ga0307471_1011254082 | 3300032180 | Hardwood Forest Soil | MKKAKAPKRRTAAKPRPTAKNVDEYLAGLPAPARSALQKMRAAIRAV |
| Ga0307471_1017411031 | 3300032180 | Hardwood Forest Soil | MKKAKLGRRASPAKRRGAPRTIDEYLAGVPEPARSTLRKVRAAI |
| Ga0335069_127669262 | 3300032893 | Soil | MKQRKSHSRGSAAKGNASANDVDEYLAGVPEPARSTLNQIRAAIHSAAP |
| Ga0335075_108513931 | 3300032896 | Soil | MKKAKSGGRGSSAKRGDSAKSVDEYLARVPEPARITLKKIRAAN |
| Ga0335077_108676731 | 3300033158 | Soil | MKKVKPRQRLSAAKSQSVPRNFDEYMAGVPEPARSTLHKMRVAIRSA |
| Ga0335077_117405402 | 3300033158 | Soil | MKKTFAGGRKPATKASVAPKTVDEYLAGVPEPARSTLEKMRAVIR |
| Ga0310914_102022661 | 3300033289 | Soil | MKKMKSGNRGSAAKANPAPKTVDEYLAGVPEPARS |
| ⦗Top⦘ |