NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F060002

Metagenome / Metatranscriptome Family F060002

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F060002
Family Type Metagenome / Metatranscriptome
Number of Sequences 133
Average Sequence Length 48 residues
Representative Sequence VLEQLEAIGTDIGSRNVNDYLDLSIIDQLKQEGYFAQLEKAYPVK
Number of Associated Samples 122
Number of Associated Scaffolds 133

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.50 %
% of genes near scaffold ends (potentially truncated) 95.49 %
% of genes from short scaffolds (< 2000 bps) 92.48 %
Associated GOLD sequencing projects 119
AlphaFold2 3D model prediction Yes
3D model pTM-score0.40

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(20.301 % of family members)
Environment Ontology (ENVO) Unclassified
(24.060 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(49.624 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 35.62%    β-sheet: 0.00%    Coil/Unstructured: 64.38%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.40
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 133 Family Scaffolds
PF02538Hydantoinase_B 90.23
PF05378Hydant_A_N 2.26
PF09084NMT1 1.50
PF01774UreD 0.75
PF13540RCC1_2 0.75
PF05194UreE_C 0.75
PF01636APH 0.75

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 133 Family Scaffolds
COG0146N-methylhydantoinase B/oxoprolinase/acetone carboxylase, alpha subunitAmino acid transport and metabolism [E] 180.45
COG0145N-methylhydantoinase A/oxoprolinase/acetone carboxylase, beta subunitAmino acid transport and metabolism [E] 4.51
COG0715ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic componentInorganic ion transport and metabolism [P] 1.50
COG4521ABC-type taurine transport system, periplasmic componentInorganic ion transport and metabolism [P] 1.50
COG0829Urease accessory protein UreHPosttranslational modification, protein turnover, chaperones [O] 0.75
COG2371Urease accessory protein UreEPosttranslational modification, protein turnover, chaperones [O] 0.75

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2228664021|ICCgaii200_c0666509All Organisms → cellular organisms → Bacteria → Proteobacteria527Open in IMG/M
3300000793|AF_2010_repII_A001DRAFT_10036438All Organisms → cellular organisms → Bacteria → Proteobacteria1138Open in IMG/M
3300000955|JGI1027J12803_105545181All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium681Open in IMG/M
3300000956|JGI10216J12902_108798037All Organisms → cellular organisms → Bacteria → Proteobacteria1288Open in IMG/M
3300003911|JGI25405J52794_10009639All Organisms → cellular organisms → Bacteria → Proteobacteria1826Open in IMG/M
3300004629|Ga0008092_11347289All Organisms → cellular organisms → Bacteria → Proteobacteria523Open in IMG/M
3300004633|Ga0066395_10379883All Organisms → cellular organisms → Bacteria → Proteobacteria791Open in IMG/M
3300005147|Ga0066821_1009709All Organisms → cellular organisms → Bacteria → Proteobacteria680Open in IMG/M
3300005172|Ga0066683_10226982All Organisms → cellular organisms → Bacteria → Proteobacteria1155Open in IMG/M
3300005332|Ga0066388_100228587All Organisms → cellular organisms → Bacteria2492Open in IMG/M
3300005332|Ga0066388_105949692All Organisms → cellular organisms → Bacteria → Proteobacteria616Open in IMG/M
3300005332|Ga0066388_108428613All Organisms → cellular organisms → Bacteria → Proteobacteria514Open in IMG/M
3300005335|Ga0070666_10116828All Organisms → cellular organisms → Bacteria → Proteobacteria1848Open in IMG/M
3300005363|Ga0008090_10204563All Organisms → cellular organisms → Bacteria → Proteobacteria837Open in IMG/M
3300005434|Ga0070709_11017553All Organisms → cellular organisms → Bacteria660Open in IMG/M
3300005457|Ga0070662_100187740All Organisms → cellular organisms → Bacteria → Proteobacteria1632Open in IMG/M
3300005468|Ga0070707_100735450All Organisms → cellular organisms → Bacteria → Proteobacteria950Open in IMG/M
3300005518|Ga0070699_100087558All Organisms → cellular organisms → Bacteria2719Open in IMG/M
3300005554|Ga0066661_10462826All Organisms → cellular organisms → Bacteria → Proteobacteria773Open in IMG/M
3300005713|Ga0066905_101734550All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium574Open in IMG/M
3300005713|Ga0066905_102025239All Organisms → cellular organisms → Bacteria → Proteobacteria535Open in IMG/M
3300005764|Ga0066903_101531645All Organisms → cellular organisms → Bacteria → Proteobacteria1261Open in IMG/M
3300005764|Ga0066903_104019178All Organisms → cellular organisms → Bacteria → Proteobacteria788Open in IMG/M
3300005764|Ga0066903_108637527All Organisms → cellular organisms → Bacteria → Proteobacteria518Open in IMG/M
3300005843|Ga0068860_100756619All Organisms → cellular organisms → Bacteria → Proteobacteria983Open in IMG/M
3300006032|Ga0066696_10013557All Organisms → cellular organisms → Bacteria4019Open in IMG/M
3300006038|Ga0075365_10133451All Organisms → cellular organisms → Bacteria → Proteobacteria1719Open in IMG/M
3300006057|Ga0075026_100961191All Organisms → cellular organisms → Bacteria → Proteobacteria529Open in IMG/M
3300006358|Ga0068871_101402570All Organisms → cellular organisms → Bacteria → Proteobacteria659Open in IMG/M
3300006794|Ga0066658_10542247All Organisms → cellular organisms → Bacteria → Proteobacteria632Open in IMG/M
3300006844|Ga0075428_102109602All Organisms → cellular organisms → Bacteria → Proteobacteria583Open in IMG/M
3300006880|Ga0075429_100337268All Organisms → cellular organisms → Bacteria → Proteobacteria1319Open in IMG/M
3300007076|Ga0075435_101637681All Organisms → cellular organisms → Bacteria → Proteobacteria565Open in IMG/M
3300009038|Ga0099829_10929848All Organisms → cellular organisms → Bacteria → Proteobacteria721Open in IMG/M
3300009792|Ga0126374_10738625All Organisms → cellular organisms → Bacteria → Proteobacteria745Open in IMG/M
3300009792|Ga0126374_10960333All Organisms → cellular organisms → Bacteria → Proteobacteria667Open in IMG/M
3300009792|Ga0126374_11112607All Organisms → cellular organisms → Bacteria → Proteobacteria627Open in IMG/M
3300010043|Ga0126380_10735794All Organisms → cellular organisms → Bacteria → Proteobacteria798Open in IMG/M
3300010048|Ga0126373_12896478All Organisms → cellular organisms → Bacteria → Proteobacteria535Open in IMG/M
3300010322|Ga0134084_10340092All Organisms → cellular organisms → Bacteria → Proteobacteria569Open in IMG/M
3300010323|Ga0134086_10094609All Organisms → cellular organisms → Bacteria → Proteobacteria1051Open in IMG/M
3300010359|Ga0126376_11808308All Organisms → cellular organisms → Bacteria → Proteobacteria649Open in IMG/M
3300010360|Ga0126372_12749189All Organisms → cellular organisms → Bacteria → Proteobacteria544Open in IMG/M
3300010400|Ga0134122_10590734All Organisms → cellular organisms → Bacteria → Proteobacteria1024Open in IMG/M
3300010403|Ga0134123_11367143All Organisms → cellular organisms → Bacteria → Proteobacteria747Open in IMG/M
3300010868|Ga0124844_1032876All Organisms → cellular organisms → Bacteria → Proteobacteria1676Open in IMG/M
3300011119|Ga0105246_10786932All Organisms → cellular organisms → Bacteria → Proteobacteria843Open in IMG/M
3300012096|Ga0137389_10639749All Organisms → cellular organisms → Bacteria914Open in IMG/M
3300012361|Ga0137360_11189955All Organisms → cellular organisms → Bacteria → Proteobacteria659Open in IMG/M
3300012362|Ga0137361_11813974All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium528Open in IMG/M
3300012362|Ga0137361_11896516All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium513Open in IMG/M
3300012363|Ga0137390_10708113All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium969Open in IMG/M
3300012582|Ga0137358_10418186All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium906Open in IMG/M
3300012685|Ga0137397_10658772All Organisms → cellular organisms → Bacteria → Proteobacteria778Open in IMG/M
3300012918|Ga0137396_10261622All Organisms → cellular organisms → Bacteria → Proteobacteria1277Open in IMG/M
3300012944|Ga0137410_12080363All Organisms → cellular organisms → Bacteria → Proteobacteria506Open in IMG/M
3300012957|Ga0164303_10561875All Organisms → cellular organisms → Bacteria → Proteobacteria743Open in IMG/M
3300012960|Ga0164301_11012933All Organisms → cellular organisms → Bacteria → Proteobacteria654Open in IMG/M
3300012975|Ga0134110_10016131All Organisms → cellular organisms → Bacteria2864Open in IMG/M
3300012977|Ga0134087_10760761All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium520Open in IMG/M
3300012987|Ga0164307_11899317All Organisms → cellular organisms → Bacteria → Proteobacteria505Open in IMG/M
3300013308|Ga0157375_11763494All Organisms → cellular organisms → Bacteria → Proteobacteria734Open in IMG/M
3300015358|Ga0134089_10270342All Organisms → cellular organisms → Bacteria → Proteobacteria699Open in IMG/M
3300015371|Ga0132258_13443762All Organisms → cellular organisms → Bacteria → Proteobacteria1085Open in IMG/M
3300015372|Ga0132256_100602941All Organisms → cellular organisms → Bacteria → Proteobacteria1213Open in IMG/M
3300016294|Ga0182041_11983199All Organisms → cellular organisms → Bacteria → Proteobacteria542Open in IMG/M
3300016422|Ga0182039_11983024All Organisms → cellular organisms → Bacteria → Proteobacteria535Open in IMG/M
3300019889|Ga0193743_1236145All Organisms → cellular organisms → Bacteria → Proteobacteria546Open in IMG/M
3300020005|Ga0193697_1030543All Organisms → cellular organisms → Bacteria → Proteobacteria1345Open in IMG/M
3300021432|Ga0210384_10293327All Organisms → cellular organisms → Bacteria → Proteobacteria1464Open in IMG/M
3300021478|Ga0210402_11417941All Organisms → cellular organisms → Bacteria → Proteobacteria622Open in IMG/M
3300021479|Ga0210410_10041431All Organisms → cellular organisms → Bacteria4005Open in IMG/M
3300021479|Ga0210410_11645665All Organisms → cellular organisms → Bacteria → Proteobacteria535Open in IMG/M
3300025922|Ga0207646_11805495All Organisms → cellular organisms → Bacteria → Proteobacteria523Open in IMG/M
3300025923|Ga0207681_10412873All Organisms → cellular organisms → Bacteria → Proteobacteria1092Open in IMG/M
3300025931|Ga0207644_10768675All Organisms → cellular organisms → Bacteria → Proteobacteria805Open in IMG/M
3300025937|Ga0207669_11702988All Organisms → cellular organisms → Bacteria → Proteobacteria538Open in IMG/M
3300025981|Ga0207640_10619151All Organisms → cellular organisms → Bacteria → Proteobacteria919Open in IMG/M
3300026067|Ga0207678_10471984All Organisms → cellular organisms → Bacteria → Proteobacteria1092Open in IMG/M
3300026142|Ga0207698_10031565All Organisms → cellular organisms → Bacteria3826Open in IMG/M
3300026331|Ga0209267_1261276All Organisms → cellular organisms → Bacteria → Proteobacteria593Open in IMG/M
3300026508|Ga0257161_1040678All Organisms → cellular organisms → Bacteria → Proteobacteria928Open in IMG/M
3300026857|Ga0208893_1003000All Organisms → cellular organisms → Bacteria → Proteobacteria603Open in IMG/M
3300027181|Ga0208997_1001898All Organisms → cellular organisms → Bacteria → Proteobacteria2335Open in IMG/M
3300028381|Ga0268264_11769467All Organisms → cellular organisms → Bacteria → Proteobacteria628Open in IMG/M
3300028536|Ga0137415_10456245All Organisms → cellular organisms → Bacteria → Proteobacteria1084Open in IMG/M
3300028597|Ga0247820_10360373All Organisms → cellular organisms → Bacteria → Proteobacteria965Open in IMG/M
3300028708|Ga0307295_10204945All Organisms → cellular organisms → Bacteria → Proteobacteria559Open in IMG/M
3300028712|Ga0307285_10019899All Organisms → cellular organisms → Bacteria → Proteobacteria1536Open in IMG/M
3300028754|Ga0307297_10119122All Organisms → cellular organisms → Bacteria → Proteobacteria881Open in IMG/M
3300028755|Ga0307316_10276819All Organisms → cellular organisms → Bacteria → Proteobacteria612Open in IMG/M
3300028771|Ga0307320_10102334All Organisms → cellular organisms → Bacteria → Proteobacteria1089Open in IMG/M
3300028791|Ga0307290_10113902All Organisms → cellular organisms → Bacteria → Proteobacteria988Open in IMG/M
3300028793|Ga0307299_10246293All Organisms → cellular organisms → Bacteria → Proteobacteria671Open in IMG/M
3300028796|Ga0307287_10120930All Organisms → cellular organisms → Bacteria → Proteobacteria991Open in IMG/M
3300028803|Ga0307281_10426967All Organisms → cellular organisms → Bacteria → Proteobacteria510Open in IMG/M
3300028812|Ga0247825_10686203All Organisms → cellular organisms → Bacteria → Proteobacteria736Open in IMG/M
3300028824|Ga0307310_10368425All Organisms → cellular organisms → Bacteria → Proteobacteria708Open in IMG/M
3300028872|Ga0307314_10157950All Organisms → cellular organisms → Bacteria → Proteobacteria660Open in IMG/M
3300028876|Ga0307286_10212581All Organisms → cellular organisms → Bacteria → Proteobacteria703Open in IMG/M
3300028880|Ga0307300_10069905All Organisms → cellular organisms → Bacteria → Proteobacteria1022Open in IMG/M
3300028885|Ga0307304_10105276All Organisms → cellular organisms → Bacteria → Proteobacteria1132Open in IMG/M
3300031226|Ga0307497_10560983All Organisms → cellular organisms → Bacteria → Proteobacteria572Open in IMG/M
3300031543|Ga0318516_10208722All Organisms → cellular organisms → Bacteria → Proteobacteria1128Open in IMG/M
3300031544|Ga0318534_10318920All Organisms → cellular organisms → Bacteria → Proteobacteria895Open in IMG/M
3300031546|Ga0318538_10171703All Organisms → cellular organisms → Bacteria → Proteobacteria1151Open in IMG/M
3300031561|Ga0318528_10000927All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales10536Open in IMG/M
3300031561|Ga0318528_10095658All Organisms → cellular organisms → Bacteria → Proteobacteria1554Open in IMG/M
3300031564|Ga0318573_10302252All Organisms → cellular organisms → Bacteria → Proteobacteria857Open in IMG/M
3300031640|Ga0318555_10177238All Organisms → cellular organisms → Bacteria → Proteobacteria1145Open in IMG/M
3300031708|Ga0310686_107787354All Organisms → cellular organisms → Bacteria → Proteobacteria1016Open in IMG/M
3300031724|Ga0318500_10146828All Organisms → cellular organisms → Bacteria → Proteobacteria1107Open in IMG/M
3300031740|Ga0307468_102271079All Organisms → cellular organisms → Bacteria → Proteobacteria526Open in IMG/M
3300031744|Ga0306918_10459370All Organisms → cellular organisms → Bacteria → Proteobacteria995Open in IMG/M
3300031751|Ga0318494_10652737All Organisms → cellular organisms → Bacteria → Proteobacteria615Open in IMG/M
3300031764|Ga0318535_10089624All Organisms → cellular organisms → Bacteria → Proteobacteria1337Open in IMG/M
3300031796|Ga0318576_10241113All Organisms → cellular organisms → Bacteria → Proteobacteria852Open in IMG/M
3300031798|Ga0318523_10173147All Organisms → cellular organisms → Bacteria → Proteobacteria1076Open in IMG/M
3300031832|Ga0318499_10001355All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales6240Open in IMG/M
3300031880|Ga0318544_10039072All Organisms → cellular organisms → Bacteria → Proteobacteria1680Open in IMG/M
3300031896|Ga0318551_10162781All Organisms → cellular organisms → Bacteria → Proteobacteria1222Open in IMG/M
3300031943|Ga0310885_10516086All Organisms → cellular organisms → Bacteria → Proteobacteria653Open in IMG/M
3300031945|Ga0310913_10391555All Organisms → cellular organisms → Bacteria → Proteobacteria985Open in IMG/M
3300031981|Ga0318531_10002286All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales6261Open in IMG/M
3300032010|Ga0318569_10569272All Organisms → cellular organisms → Bacteria → Proteobacteria528Open in IMG/M
3300032067|Ga0318524_10344503All Organisms → cellular organisms → Bacteria → Proteobacteria773Open in IMG/M
3300032089|Ga0318525_10317140All Organisms → cellular organisms → Bacteria → Proteobacteria800Open in IMG/M
3300032094|Ga0318540_10135635All Organisms → cellular organisms → Bacteria → Proteobacteria1174Open in IMG/M
3300032094|Ga0318540_10147670All Organisms → cellular organisms → Bacteria → Proteobacteria1125Open in IMG/M
3300032174|Ga0307470_10431018All Organisms → cellular organisms → Bacteria → Proteobacteria942Open in IMG/M
3300032180|Ga0307471_101893961All Organisms → cellular organisms → Bacteria → Proteobacteria746Open in IMG/M
3300032205|Ga0307472_100841178All Organisms → cellular organisms → Bacteria → Proteobacteria843Open in IMG/M
3300034147|Ga0364925_0236693All Organisms → cellular organisms → Bacteria → Proteobacteria677Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil20.30%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil15.79%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil8.27%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil7.52%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil6.02%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil5.26%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil3.76%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.01%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.01%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.26%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.26%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.26%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.26%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.50%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.50%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.50%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.50%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.50%
Tropical Rainforest SoilEnvironmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil1.50%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.75%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.75%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.75%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.75%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.75%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.75%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere0.75%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.75%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.75%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.75%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.75%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.75%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2228664021Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000793Forest soil microbial communities from Amazon forest - 2010 replicate II A001EnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300003911Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300004629Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome P72I A01 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300005147Soil and rhizosphere microbial communities from Laval, Canada - mgLMCEnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005363Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006038Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5Host-AssociatedOpen in IMG/M
3300006057Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012EnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300010868Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction)EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012975Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015EnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300015358Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300019889Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2c2EnvironmentalOpen in IMG/M
3300020005Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m2EnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026331Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes)EnvironmentalOpen in IMG/M
3300026508Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-AEnvironmentalOpen in IMG/M
3300026857Soil and rhizosphere microbial communities from Laval, Canada - mgLMB (SPAdes)EnvironmentalOpen in IMG/M
3300027181Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028597Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14EnvironmentalOpen in IMG/M
3300028708Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152EnvironmentalOpen in IMG/M
3300028712Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139EnvironmentalOpen in IMG/M
3300028754Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157EnvironmentalOpen in IMG/M
3300028755Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356EnvironmentalOpen in IMG/M
3300028771Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369EnvironmentalOpen in IMG/M
3300028791Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144EnvironmentalOpen in IMG/M
3300028793Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159EnvironmentalOpen in IMG/M
3300028796Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141EnvironmentalOpen in IMG/M
3300028803Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120EnvironmentalOpen in IMG/M
3300028812Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300028872Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204EnvironmentalOpen in IMG/M
3300028876Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140EnvironmentalOpen in IMG/M
3300028880Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181EnvironmentalOpen in IMG/M
3300028885Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185EnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031832Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25EnvironmentalOpen in IMG/M
3300031880Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031943Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032094Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300034147Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
ICCgaii200_066650922228664021SoilRAGAENVLAQLEVIGTDIGSRNVNDYLDLGIIDQLKQEGYFAQLEKTYPVR
AF_2010_repII_A001DRAFT_1003643833300000793Forest SoilVLAQLEAIGTDIGSRNANDYLDLGIIETLKQEGYFAQLEKTYPARP*
JGI1027J12803_10554518123300000955SoilIEVGSKNVNDYLDLGIIEKLKQDGFFAQLEKTYPIK*
JGI10216J12902_10879803713300000956SoilVLAQLEAIGTDIGSRNVADYLDLGIIEALKQEGYFAQLEKIYSISP*
JGI25405J52794_1000963913300003911Tabebuia Heterophylla RhizospherePSRAGAENVLAQLEAIGTDIGSRNLNDYLDFGIIDQLKQEGYFAQLEKSYPVK*
Ga0008092_1134728913300004629Tropical Rainforest SoilAAPSRAGAENVLAQLEAIGTDIGSRNPADYLDLGIIETLKQQGYFAQLEKIYPVNP*
Ga0066395_1037988323300004633Tropical Forest SoilLAQLEAIGTDIGSRNANDYLDLGIIETLKQEGYFAQLEKTYPVK*
Ga0066821_100970923300005147SoilVLEQLEAIGTDIGSRNVNDYLDLSIIDQLKQEGYFAQLEKAYPVK*
Ga0066683_1022698223300005172SoilEAIGTDIGSRNAADYLDLSIIEALKQEGYFAQLDKIYPMKP*
Ga0066388_10022858733300005332Tropical Forest SoilDGAKNVLEQLVAIGTDIGSRNVDDYLDLGIITQLKKDGYFAQLERAYPVR*
Ga0066388_10594969213300005332Tropical Forest SoilLMPRDAAPSRAGAENVLAQLEAIGTDIGSRNVNDYLDLSIIDQLKKEGYFAQMEKTYPVK
Ga0066388_10842861323300005332Tropical Forest SoilAPTIEGARNVIDQLTAIGTDVGRRKVEDYLELSIIAKLKQDGYFAQLEKAYPIR*
Ga0070666_1011682813300005335Switchgrass RhizosphereLMPRDAAPSIEGAKSVLEQLEAIGTDIGSRNVNDYLDLSIIDQLKQEGYFAQLEKAYPVK
Ga0008090_1020456313300005363Tropical Rainforest SoilADFKRLMPRDAAPSRAGAENVLAQLEAIGTDIGSRNPADYLDLGIIETLKREGYFAQLEKIYPIKP*
Ga0070709_1101755323300005434Corn, Switchgrass And Miscanthus RhizospherePRDAAPSLDGAKNVLAQLEAIGTDVGSRNANDYIDLGIIETLKQEGYFAQLGRTYQVTP*
Ga0070662_10018774013300005457Corn RhizosphereLEAIGTDIGSRNVNDYLDLSIIDQLKQEGYFAQLEKAYPVK*
Ga0070707_10073545023300005468Corn, Switchgrass And Miscanthus RhizosphereQLVAIGTDIGSRNVNDHLDLSIIEKLKQDGYFAQLAKTYPVK*
Ga0070699_10008755843300005518Corn, Switchgrass And Miscanthus RhizosphereMPRDAAPSLAGAKNVFAQLEAIGTDVGSKNANDYLDLGIIDTLKQEGYFAQLEKTYPVK*
Ga0066661_1046282613300005554SoilLMPRDAAPSREGADNVLAQLEAIGTDIGSRNAADYLDLSIIEALKQEGYFAQLDKIYPMKP*
Ga0066905_10173455023300005713Tropical Forest SoilMPRDAAPSLEGGKNVLAQLEAIGTDIGSRNVNDYLDLGIIDQLKQEGYFAQLEKTYPVK*
Ga0066905_10202523913300005713Tropical Forest SoilAIGTDIGSRNANDYLDLGIIETLKQEGYFAQLEKTYPVRP*
Ga0066903_10153164513300005764Tropical Forest SoilAPTLEGARNVVEQLTAIGTDVGRSNVNDYLELGIIAKLKQEGYFAELEKTYPVR*
Ga0066903_10401917823300005764Tropical Forest SoilAKNVLAQLEAIGTDIGSRNANDYLDLGIIETLKQEGYFAQLEKTYPARP*
Ga0066903_10863752723300005764Tropical Forest SoilLAQLEAIGTDVGSKNANDYLDLGIIDTLKQEGYFAQLEKTYPVK*
Ga0068860_10075661913300005843Switchgrass RhizosphereIGTDIGSRNVNDYLDLSIIDQLKQEGYFAQLEKAYPVK*
Ga0066696_1001355713300006032SoilMPRDAAPSREGAENVLAQLEAIGTDIGSRNAADYLDLSIIEALKQEGYFAQLDKMYPMKP
Ga0075365_1013345123300006038Populus EndosphereAIGTDIGSRNVNDYLDLSIIDQLKQEGYFAQLEKAYPVK*
Ga0075026_10096119123300006057WatershedsPSIEGAKSVLEQLEAIGTDIGSRNVNDYLDLSIIDQLKQEGYFARLEKTYPVK*
Ga0068871_10140257023300006358Miscanthus RhizosphereQLEAIGTDIGSRNVNDYLDLSIIDQLKQDGYFAQLEKAYPIRP*
Ga0066658_1054224723300006794SoilLMPRDAAPSREGAENVLAQLEAIGTDIGSRNPADYLDLSIIEALKQEGYFAQLDKIYPMKP*
Ga0075428_10210960223300006844Populus RhizosphereDFKRLMPRDAAPTVEGARNVIEQLTAIGTDVGRRKVEDYLELGIIAKLKQDGYFAELEKAYPIR*
Ga0075429_10033726823300006880Populus RhizosphereAPSRAGAENVLAQLEAIGTDIGSRNPADYLDLGIIEALKQEGYFAQLEKTYPVK*
Ga0075435_10163768123300007076Populus RhizosphereDAAPTVEGARNVIEQLTAIGTDVGRRKVEDYLELGIIAKLKQDGYFAELEKAYPIR*
Ga0099829_1092984813300009038Vadose Zone SoilIDGAKNVLAQLEAIGTDIGSRNMNDYLDLGIIAQLRQEAYFDQMAKAYPVKQ*
Ga0126374_1073862523300009792Tropical Forest SoilIEQLTAIGTDVGRHKVEDYLELGIIEKLKQEGYFAQLEKAYPVR*
Ga0126374_1096033313300009792Tropical Forest SoilTDVGSKNANDYLDLGIIDTLKQEGYFAQLEKTYPVRP*
Ga0126374_1111260723300009792Tropical Forest SoilGAKNVLAQLEAIGTDIGSRNANDYLDLGIIETLKQEGYFTQLEKTYPVK*
Ga0126380_1073579413300010043Tropical Forest SoilPRDAAPTVEGARNVIEQLTAIGTDVGRRKVEDYLELSIIEKLKQEGYFAQLEKTHPIR*
Ga0126373_1289647823300010048Tropical Forest SoilLDAAPSIDGANNVLEQLVAIGTDIGSRNPNDYLDLSIIEALKREGYFDQLAKAFPVKQ*
Ga0134084_1034009223300010322Grasslands SoilAAPSREGADNVLAQLEAIGTDIGSRNAADYLDLSIIEALKQEGYFAQLDKIYPMKP*
Ga0134086_1009460913300010323Grasslands SoilDFKRLMPRDAAPSREGAENVLAQLEAIGTDIGSRNPADYLDLSIIEALKQEGYFAQLDKMYPMKP*
Ga0126376_1180830813300010359Tropical Forest SoilQLEAIGTDIGSKNANDYLDLGIIDTLKQEGYFAQLEKTYPARP*
Ga0126372_1274918913300010360Tropical Forest SoilDQLAAIGTDIGRHKVEDYLELGIIEKLKQEGYFAQLEKTYPVR*
Ga0134122_1059073413300010400Terrestrial SoilGAKSVLEQLEAIGTDIGSRNVNDYLDLSIIDQLKQDGYFAQLEKAYPIRP*
Ga0134123_1136714313300010403Terrestrial SoilIGSRNVNDYLDLSIIDQLKQEGYFAQLEKAYPVK*
Ga0124844_103287623300010868Tropical Forest SoilGTDIGSRNANDYLDLGIIETLKQEGYFAQLEKTYPAKP*
Ga0105246_1078693213300011119Miscanthus RhizosphereEAIGTDIGSRNVNDYLDLSIIDQLKQEGYFAQLEKAYPVK*
Ga0137389_1063974913300012096Vadose Zone SoilAKNVLAQLEAIGTDIGSRNVNDYLDLGIIAQLRQEGYFDQMAKAYPVKQ*
Ga0137360_1118995513300012361Vadose Zone SoilGSNNVDDYLGLSIIAQLKQEGYFDQMAKTYPVKQ*
Ga0137361_1181397423300012362Vadose Zone SoilGAENVLAQLEAIGTDIGSRNAADYLDLDIIEALKQEGYFAQLEKLYPVKL*
Ga0137361_1189651613300012362Vadose Zone SoilVVEQLTAIGTDVGRRKVEEYLELGIIAKLKQEGYFAQLEKAYPIR*
Ga0137390_1070811313300012363Vadose Zone SoilDFKRLMPRDGAPSVAGARNVIEQLSALGIDVGSRNVDDHLDFGIIEKLKRDGYFAQLEKEFPVK*
Ga0137358_1041818623300012582Vadose Zone SoilLEAIGIEVGSKNVNDYLDLGIIEKLKQDGFFAQLEKTYPIK*
Ga0137397_1065877223300012685Vadose Zone SoilAPSLDGAKNVLAQLEAIGIEVGSKNVNDYLDLGIIEKLKQDGFFAQLEKTYPTQ*
Ga0137396_1026162223300012918Vadose Zone SoilVLAHLEVIGTDIGSRNANDYLDLGIIEALKQEGYFVQLERTYPVK*
Ga0137410_1208036313300012944Vadose Zone SoilPSPEGARNVLAQLQAIGIEVGSKNVDDYLDLSIIQKLKQDGFFAQLEKTYPIK*
Ga0164303_1056187513300012957SoilDRVVRNANGSLALGIIEALKQEGYFAQLGRTYPVK*
Ga0164301_1101293323300012960SoilGAKSVLEQLESIGTDIGSRNVNDYLDLSIIDQLKQEGYFAQLEKAYPVK*
Ga0134110_1001613113300012975Grasslands SoilPSREGAENVLAQLEAIGTDIGSRNPADYLDLSIIEALKQEGYFAQLDKIYPMKP*
Ga0134087_1076076113300012977Grasslands SoilPEGARNVLDQLAAIGTDVGSKNVSDYVDLGVIDSLKQEGYFARLEQSYRLK*
Ga0164307_1189931723300012987SoilGTDIGSRNVNDYLDLSIIDQLKQEGYFAQLEKAYPVK*
Ga0157375_1176349413300013308Miscanthus RhizosphereSIEGAKSVLEQLEAIGTDIGSRNVNDYLDLSIIDQLKQEGYFAQLEKAYPVK*
Ga0134089_1027034223300015358Grasslands SoilSREGAENVLAQLEAIGTDIGSRNPADYLDLSIIEALKQEGYFAQLDKIYPMKP*
Ga0132258_1344376213300015371Arabidopsis RhizosphereLESIGTDIGSRNVNDYLDLSIIDQLKQDGYFAQLEKAYPIGP*
Ga0132256_10060294123300015372Arabidopsis RhizosphereEGAKSVLEQLEAIGTDIGSRNVNDYLDLSIIDQLKQEGYFAQLEKAYPVK*
Ga0182041_1198319923300016294SoilVLAQLEAIGTDIGSRNANDYLDLGIIETLKQEGYFAQLEKTYPVRP
Ga0182039_1198302423300016422SoilQLEAIGTDIGSRNANDYLDLGIIETLKQEGYFAQLEKTYPVRP
Ga0193743_123614513300019889SoilAAPTIAGAQNVLDQLVALGTDIGSRNPNDYLDLSIIEALKKDGYFDQMAKMYPIK
Ga0193697_103054323300020005SoilKSVLEQLEAIGTDIGSRNVNDYLDLSIIDQLKQEGYFAQLEKAYPVK
Ga0210384_1029332713300021432SoilTDIGSRNANDYLDLGIIDTLKQEGYFAQLEKTYPARP
Ga0210402_1141794113300021478SoilIGSRNVNDYLDLGIIEQLKQEGYFAQMARMFPVKQ
Ga0210410_1004143113300021479SoilQLAVIGTDIGSKNINDYLDLSIIDRLKQDGYFAGLEK
Ga0210410_1164566513300021479SoilLAVIGTDIGSKNINDYLDLSIIDRLKQDGYFAGLEK
Ga0207646_1180549523300025922Corn, Switchgrass And Miscanthus RhizosphereNNVLDQLVAIGTDIGSRNVNDHLDLSIIEKLKQDGYFAQLAKTYPVK
Ga0207681_1041287323300025923Switchgrass RhizosphereLEAIGTDIGSRNVNDYLDLSIIDQLKQEGYFAQLEKAYPVK
Ga0207644_1076867523300025931Switchgrass RhizosphereIGTDIGSRNVNDYLDLSIIDQLKQDGYFAQLEKAYPIRP
Ga0207669_1170298813300025937Miscanthus RhizosphereIGTDIGSRNVNDYLDLSIIDQLKQEGYFAQLEKAYPVK
Ga0207640_1061915123300025981Corn RhizosphereTDIGSRNVNDYLDLSIIDQLKQDGYFAQLEKAYPIRP
Ga0207678_1047198423300026067Corn RhizosphereGAKSVLEQLESIGTDIGSCNVNDYLDLSIIDQLKQEGYFAQLEKAYPVK
Ga0207698_1003156513300026142Corn RhizosphereDIGSRNVNDYLDLSIIDQLKQEGYFAQLEKAYPVK
Ga0209267_126127623300026331SoilLMPRDAAPSREGADNVLAQLEAIGTDIGSRNAADYLDLSIIEALKQEGYFAQLDKIYPMK
Ga0257161_104067823300026508SoilLEAIGTDIGSRNANDYLDLGIIEALKQEGYFAQLERTYPVK
Ga0208893_100300023300026857SoilSIEGAKSVLEQLEAIGTDIGSRNVNDYLDLSIIDQLKQEGYFAQLEKAYPVK
Ga0208997_100189813300027181Forest SoilQLAAIGTDIGSRNVNDYLDLGVIELLKQEGYFDQLAKAYPVKQ
Ga0268264_1176946713300028381Switchgrass RhizosphereAAPTVEGARNVIEQLTAIGTDVGRRKVEDYLELSIIAQLKQEGYFAQLEKDYPVR
Ga0137415_1045624523300028536Vadose Zone SoilDFNRLMPRDAAPTIDGAKNVLDQLVAIGTDIGSRDVNDYLDLGIIAQLKQEGYFDQMAKAYVVK
Ga0247820_1036037323300028597SoilLAQLEAIGTDIGSRNVNDYLDLSIIDQLKQEGYFAQLEKAYPVK
Ga0307295_1020494513300028708SoilMPRDAAPSIEGAKSVLEQLEAIGTDIGSRNVNDYLDLSIIDQLKQEGYFAQLEKTYPVRP
Ga0307285_1001989913300028712SoilQLEAIGTDIGSRNVNDYLDLSIIDQLKQEGYFAQLEKTYPVRP
Ga0307297_1011912223300028754SoilGTDIGSRNVNDYLDLSIIDQLKQEGYFAQLEKAYPVK
Ga0307316_1027681923300028755SoilVEGARSVLEQLEAIGTDIGSRNVNDYLDLSIIDQLEQEGYFAQLEKAYPVK
Ga0307320_1010233413300028771SoilIEGARNVLEQLAAIGTDIGSRNVNDYLDLGVIELLKQEGYFDQLAKAYPVKQ
Ga0307290_1011390213300028791SoilLEQLEAIGTDIGSRNVNDYLDLSIIDQLKQEGYFAQLEKTYPVRP
Ga0307299_1024629313300028793SoilPRSRALEQLEAIGTDIGSRNVNDYLDLSIIDQLKQEGYFAQLEKTYPVRP
Ga0307287_1012093023300028796SoilAPSIEGAKSVLAQLEAIGTDIGSRNVNDYLDLSIIDQLKQEGYFAQLEKAYPVK
Ga0307281_1042696723300028803SoilDAAPSVDGANNVIEQLLAIGTDIGSRNVNDYLDLSIIEKLKRDGYFDQMAKAYPVK
Ga0247825_1068620323300028812SoilIEGAKSVLAQLEAIGTDIGSRNVNDYLDLSIIDQLKQEGYFAQLEKAYPVK
Ga0307310_1036842513300028824SoilEAIGTDIGSRNVNDYLDLSIIDQLKQEGYFAQLEKTYPVRP
Ga0307314_1015795013300028872SoilEQLEAIGTDIGSRNVNDYLDLSIIDQLKQEGYFAQLEKTYPVRS
Ga0307286_1021258123300028876SoilKSVLEQLEAIGTDIGSRNVNDYLDLSIIDQLKQEGYFAQLEKTYPVRP
Ga0307300_1006990513300028880SoilEQLEAIGTDIGSRNVNDYLDLSIIDQLKQEGYFAQLEKTYPVRP
Ga0307304_1010527623300028885SoilGTDIGSRNVNDYLDLSIIDQLKQEGYFAQLEKTYPVRP
Ga0307497_1056098313300031226SoilVLEQFEAIGTDIGSRNVNDYLDLSIIDQLKQEGYFAQLEKTYPVK
Ga0318516_1020872223300031543SoilQLEAIGTDIGSRNANDYLDLGIIETLKQEGYFAQLEKTYPVK
Ga0318534_1031892023300031544SoilEAIGTDIGSRNANDYLDLGIIETLKQEGYFAQLEKTYPVK
Ga0318538_1017170323300031546SoilGAKNVLAQLEAIGTDIGSRNANDYLDLGIIETLKQEGYFAQLEKTYPVK
Ga0318528_1000092713300031561SoilDAAPSLAGAKNVLAQLEAIGTDVGSKNANDYLDLGIIDTLKQEGYFAQIEKTYPVK
Ga0318528_1009565813300031561SoilGAKNVLAQLEAIGTDIGSRNANDYLDLGIIETLKQEGYFAQLEKTYPVRP
Ga0318573_1030225213300031564SoilKNVLAQLEAIGTDIGSRNANDYLDLGIIETLKQEGYFAQLEKTYPVRP
Ga0318555_1017723813300031640SoilKNVLAQLEAIGTDIGSRNANDYLDLGIIETLKQEGYFAQLEKTYPVK
Ga0310686_10778735423300031708SoilIGIEVGSRNVNDQLDDSIIRKLRQDGFFAQMDKDYPIK
Ga0318500_1014682813300031724SoilLEAIGTDIGSRNPADYLDLCIIETLKREGYFAQLEKIYPIKP
Ga0307468_10227107913300031740Hardwood Forest SoilTDIGSRNVNDYLDLSIIDQLKQEGYFAQLEKAYPVK
Ga0306918_1045937023300031744SoilAQLEAIGTDIGSRNANDYLDLGIIETLKQEGYFAQLEKTYPVRP
Ga0318494_1065273723300031751SoilYADFKRLMPRDAAPSRAGAENVLAQLEAIGTDIGSRNPADYLDLGIIETLKREGYFAQLEKIYPIKP
Ga0318535_1008962423300031764SoilGTDIGSRNANDYLDLGIIETLKQEGYFAQLEKTYPVRP
Ga0318576_1024111323300031796SoilLPRDAAPSRAGAENVLAQLEAIGTDIGSRNPADYLDLGIIETLKREGYFAQLEKIYPIKP
Ga0318523_1017314723300031798SoilDIGSRNPADYLDLGIIETLKREGYFAQLEKIYPIKP
Ga0318499_1000135573300031832SoilSQLEAIGTDVGSKNANDYLDLGIIDTLKQEGYFAQLAKTYPVK
Ga0318544_1003907223300031880SoilAKNVLAQLEAIGTDIGSRNANDYLDLGIIETLKQEGYFAQLEKTYPVK
Ga0318551_1016278123300031896SoilAENVLAQLEAIGTDIGSRNPADYLDLGIIETLKREGYFAQLEKIYPIKP
Ga0310885_1051608623300031943SoilEAIGTDIGSRNVNDYLDLSIIDQLKQEGYFAQLEKAYPVK
Ga0310913_1039155523300031945SoilEAIGTDIGSRNANDYLDLGIIETLKQEGYFAQLEKTYPVRP
Ga0318531_1000228613300031981SoilAGAKNVLSQLEAIGTDVGGKNANDYLDLGIIDTLKQEGYFAQLAKTYPVK
Ga0318569_1056927223300032010SoilIGTDIGSRNANDYLDLGIIETLKQEGYFAQLEKTYPVRP
Ga0318524_1034450323300032067SoilKNVLAQLEVIGTDIGSRNANDYLDLGIIETLKQEGYFAQLEKTYPVRP
Ga0318525_1031714013300032089SoilNVLSQLEAIGTDVGSKNANDYLDLGIIDTLKQEGYFAQLAKTYPVK
Ga0318540_1013563513300032094SoilKNVLAQLEAIGTDIGSRNANDYLDLGIIEALKQEGYFAQLEKIYPVK
Ga0318540_1014767023300032094SoilLEAIGTDIGSRNANDYLDLGIIETLKQEGYFAQLEKTYPVK
Ga0307470_1043101823300032174Hardwood Forest SoilADFKRLMPRDAAPTADGANNVLEQLVAIGTDVGSRNVNDYLDLSIITKLKQDGYFAQLEKTYPARP
Ga0307471_10189396113300032180Hardwood Forest SoilTAIGTDVGRRQVEDYLELGIIAQLKQEGYFAELEKTYPIR
Ga0307472_10084117823300032205Hardwood Forest SoilLVAIGTDIGSRNVDDYLDLSIIDQLKKGGYFDQMAKEHPVRP
Ga0364925_0236693_11_1903300034147SedimentMPRDAAPSIEGAKSVLAQLEAIGTDIGSRNVNDYLDLSIIDQLKQEGYFAQLEKAYPVK

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.