NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F059914

Metagenome / Metatranscriptome Family F059914

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F059914
Family Type Metagenome / Metatranscriptome
Number of Sequences 133
Average Sequence Length 62 residues
Representative Sequence MNEIKLSLQENEANVLLQLIDIAVKAQGLQVAEAGSFLATKIQEQTKEQITPQEEEGE
Number of Associated Samples 97
Number of Associated Scaffolds 133

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 28.57 %
% of genes near scaffold ends (potentially truncated) 24.06 %
% of genes from short scaffolds (< 2000 bps) 59.40 %
Associated GOLD sequencing projects 90
AlphaFold2 3D model prediction Yes
3D model pTM-score0.47

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (43.609 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(29.323 % of family members)
Environment Ontology (ENVO) Unclassified
(69.925 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(87.970 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 47.67%    β-sheet: 0.00%    Coil/Unstructured: 52.33%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.47
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 133 Family Scaffolds
PF13385Laminin_G_3 9.77
PF01510Amidase_2 5.26
PF07883Cupin_2 3.76
PF13450NAD_binding_8 3.76
PF03275GLF 3.01
PF12518DUF3721 2.26
PF03567Sulfotransfer_2 2.26
PF00294PfkB 1.50
PF02485Branch 1.50
PF07659DUF1599 0.75
PF01755Glyco_transf_25 0.75
PF10544T5orf172 0.75
PF11649T4_neck-protein 0.75
PF14464Prok-JAB 0.75
PF05496RuvB_N 0.75
PF03382DUF285 0.75
PF02945Endonuclease_7 0.75
PF01467CTP_transf_like 0.75

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 133 Family Scaffolds
COG0562UDP-galactopyranose mutaseCell wall/membrane/envelope biogenesis [M] 3.01
COG2255Holliday junction resolvasome RuvABC, ATP-dependent DNA helicase subunit RuvBReplication, recombination and repair [L] 0.75
COG3306Glycosyltransferase involved in LPS biosynthesis, GR25 familyCell wall/membrane/envelope biogenesis [M] 0.75


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms64.66 %
UnclassifiedrootN/A35.34 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000116|DelMOSpr2010_c10000732All Organisms → cellular organisms → Bacteria20570Open in IMG/M
3300000117|DelMOWin2010_c10000519All Organisms → cellular organisms → Bacteria24095Open in IMG/M
3300000928|OpTDRAFT_10459228Not Available650Open in IMG/M
3300001460|JGI24003J15210_10000900All Organisms → cellular organisms → Bacteria12807Open in IMG/M
3300001460|JGI24003J15210_10138038Not Available641Open in IMG/M
3300003592|JGI26246J51724_1012329All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon2639Open in IMG/M
3300005239|Ga0073579_1178722All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → unclassified Parcubacteria group → Parcubacteria group bacterium Greene0714_76898Open in IMG/M
3300005731|Ga0076919_1028834All Organisms → cellular organisms → Bacteria3269Open in IMG/M
3300005738|Ga0076926_104787All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon4699Open in IMG/M
3300005941|Ga0070743_10140057Not Available805Open in IMG/M
3300006026|Ga0075478_10046530All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1427Open in IMG/M
3300006029|Ga0075466_1000070All Organisms → cellular organisms → Bacteria31606Open in IMG/M
3300006637|Ga0075461_10209641Not Available581Open in IMG/M
3300006735|Ga0098038_1007619All Organisms → cellular organisms → Bacteria4344Open in IMG/M
3300006735|Ga0098038_1024728All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon2268Open in IMG/M
3300006752|Ga0098048_1012353All Organisms → cellular organisms → Bacteria2981Open in IMG/M
3300006752|Ga0098048_1019921All Organisms → cellular organisms → Bacteria2259Open in IMG/M
3300006752|Ga0098048_1020712All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon2204Open in IMG/M
3300006752|Ga0098048_1021816Not Available2141Open in IMG/M
3300006752|Ga0098048_1155059Not Available682Open in IMG/M
3300006789|Ga0098054_1006148All Organisms → cellular organisms → Bacteria5202Open in IMG/M
3300006789|Ga0098054_1142051Not Available889Open in IMG/M
3300006789|Ga0098054_1146227All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon874Open in IMG/M
3300006789|Ga0098054_1247596All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria643Open in IMG/M
3300006793|Ga0098055_1003671All Organisms → cellular organisms → Bacteria7695Open in IMG/M
3300006802|Ga0070749_10049661Not Available2557Open in IMG/M
3300006802|Ga0070749_10083489All Organisms → cellular organisms → Bacteria → Proteobacteria1906Open in IMG/M
3300006919|Ga0070746_10020738All Organisms → cellular organisms → Bacteria3610Open in IMG/M
3300006919|Ga0070746_10052571Not Available2121Open in IMG/M
3300006924|Ga0098051_1071665All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium941Open in IMG/M
3300006925|Ga0098050_1149633Not Available588Open in IMG/M
3300006925|Ga0098050_1155816All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alteromonas/Salinimonas group → Alteromonas → unclassified Alteromonas → Alteromonas sp. TMED35574Open in IMG/M
3300007863|Ga0105744_1001129All Organisms → cellular organisms → Bacteria7451Open in IMG/M
3300008012|Ga0075480_10629651Not Available505Open in IMG/M
3300009000|Ga0102960_1078302Not Available1210Open in IMG/M
3300009027|Ga0102957_1249193Not Available643Open in IMG/M
3300009027|Ga0102957_1279417Not Available608Open in IMG/M
3300009079|Ga0102814_10309774Not Available859Open in IMG/M
3300009080|Ga0102815_10147060All Organisms → cellular organisms → Bacteria → Proteobacteria1294Open in IMG/M
3300009130|Ga0118729_1003652All Organisms → cellular organisms → Bacteria15303Open in IMG/M
3300009420|Ga0114994_10043982All Organisms → cellular organisms → Bacteria3096Open in IMG/M
3300009420|Ga0114994_10108778Not Available1886Open in IMG/M
3300009420|Ga0114994_10463397Not Available836Open in IMG/M
3300009512|Ga0115003_10146694All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Pusillimonas (ex Stolz et al. 2005) → unclassified Pusillimonas → Pusillimonas sp. (ex Stolz et al. 2005)1434Open in IMG/M
3300009608|Ga0115100_10558395Not Available500Open in IMG/M
3300010150|Ga0098056_1021618All Organisms → cellular organisms → Bacteria → Proteobacteria2292Open in IMG/M
3300010151|Ga0098061_1196076All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon717Open in IMG/M
3300010368|Ga0129324_10185657All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon851Open in IMG/M
3300016740|Ga0182096_1289380All Organisms → cellular organisms → Bacteria1134Open in IMG/M
3300016741|Ga0182079_1465878Not Available543Open in IMG/M
3300016766|Ga0182091_1313192All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria741Open in IMG/M
3300017706|Ga0181377_1002407All Organisms → cellular organisms → Bacteria5685Open in IMG/M
3300017714|Ga0181412_1000501All Organisms → cellular organisms → Bacteria16807Open in IMG/M
3300017719|Ga0181390_1000951All Organisms → cellular organisms → Bacteria13055Open in IMG/M
3300017719|Ga0181390_1017729All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon2370Open in IMG/M
3300017719|Ga0181390_1171956Not Available534Open in IMG/M
3300017726|Ga0181381_1037133All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon1085Open in IMG/M
3300017727|Ga0181401_1038735All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon1342Open in IMG/M
3300017727|Ga0181401_1068738Not Available939Open in IMG/M
3300017749|Ga0181392_1247967All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae501Open in IMG/M
3300017769|Ga0187221_1117882All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alteromonas/Salinimonas group → Alteromonas → unclassified Alteromonas → Alteromonas sp. TMED35802Open in IMG/M
3300017771|Ga0181425_1000295Not Available20151Open in IMG/M
3300017782|Ga0181380_1041322All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon1670Open in IMG/M
3300017783|Ga0181379_1141464All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alteromonas/Salinimonas group → Alteromonas → unclassified Alteromonas → Alteromonas sp. TMED35862Open in IMG/M
3300017786|Ga0181424_10053339All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon1751Open in IMG/M
3300017824|Ga0181552_10112217All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1495Open in IMG/M
3300017952|Ga0181583_10265130All Organisms → cellular organisms → Bacteria1104Open in IMG/M
3300017956|Ga0181580_10850367Not Available572Open in IMG/M
3300017967|Ga0181590_10037099All Organisms → cellular organisms → Bacteria3919Open in IMG/M
3300018417|Ga0181558_10331758Not Available822Open in IMG/M
3300018421|Ga0181592_10381622Not Available999Open in IMG/M
3300018682|Ga0188851_1000825All Organisms → cellular organisms → Bacteria5753Open in IMG/M
3300018876|Ga0181564_10035095All Organisms → cellular organisms → Bacteria3567Open in IMG/M
3300020013|Ga0182086_1181364All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria762Open in IMG/M
3300020173|Ga0181602_10105049All Organisms → cellular organisms → Bacteria1377Open in IMG/M
3300020274|Ga0211658_1005795All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon3124Open in IMG/M
3300020347|Ga0211504_1034811All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1256Open in IMG/M
3300020438|Ga0211576_10014872Not Available4825Open in IMG/M
3300020438|Ga0211576_10275296Not Available879Open in IMG/M
3300020463|Ga0211676_10001531All Organisms → cellular organisms → Bacteria24159Open in IMG/M
3300020469|Ga0211577_10171409Not Available1447Open in IMG/M
3300021085|Ga0206677_10007773All Organisms → cellular organisms → Bacteria7908Open in IMG/M
3300021185|Ga0206682_10049481Not Available2307Open in IMG/M
3300021371|Ga0213863_10177135All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alteromonas/Salinimonas group → Alteromonas → unclassified Alteromonas → Alteromonas sp. TMED35953Open in IMG/M
3300021375|Ga0213869_10159878All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1044Open in IMG/M
3300021379|Ga0213864_10000365All Organisms → cellular organisms → Bacteria20302Open in IMG/M
3300021379|Ga0213864_10087070All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1537Open in IMG/M
3300021379|Ga0213864_10139454Not Available1221Open in IMG/M
3300021425|Ga0213866_10001229All Organisms → cellular organisms → Bacteria19277Open in IMG/M
3300021957|Ga0222717_10260128Not Available1004Open in IMG/M
3300021958|Ga0222718_10174226All Organisms → Viruses → Predicted Viral1194Open in IMG/M
3300021958|Ga0222718_10291852Not Available850Open in IMG/M
3300022072|Ga0196889_1054844All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon767Open in IMG/M
3300022074|Ga0224906_1001100All Organisms → cellular organisms → Bacteria13613Open in IMG/M
3300022074|Ga0224906_1005045All Organisms → cellular organisms → Bacteria5585Open in IMG/M
3300022074|Ga0224906_1046236Not Available1413Open in IMG/M
(restricted) 3300023109|Ga0233432_10024143All Organisms → cellular organisms → Bacteria4328Open in IMG/M
(restricted) 3300023109|Ga0233432_10055199All Organisms → cellular organisms → Bacteria2475Open in IMG/M
(restricted) 3300024059|Ga0255040_10435067Not Available558Open in IMG/M
(restricted) 3300024243|Ga0233436_1198389Not Available566Open in IMG/M
3300024346|Ga0244775_10492537All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alteromonas/Salinimonas group → Alteromonas → unclassified Alteromonas → Alteromonas sp. TMED351002Open in IMG/M
3300025070|Ga0208667_1003961All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon4310Open in IMG/M
3300025070|Ga0208667_1008388All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon2504Open in IMG/M
3300025070|Ga0208667_1008535All Organisms → cellular organisms → Bacteria2473Open in IMG/M
3300025084|Ga0208298_1079688Not Available609Open in IMG/M
3300025084|Ga0208298_1083252Not Available592Open in IMG/M
3300025086|Ga0208157_1002018All Organisms → cellular organisms → Bacteria8668Open in IMG/M
3300025120|Ga0209535_1000813All Organisms → cellular organisms → Bacteria21716Open in IMG/M
3300025120|Ga0209535_1008313All Organisms → cellular organisms → Bacteria6059Open in IMG/M
3300025120|Ga0209535_1019160All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon3516Open in IMG/M
3300025151|Ga0209645_1028347All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon2075Open in IMG/M
3300025151|Ga0209645_1169569All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon662Open in IMG/M
3300025168|Ga0209337_1168894Not Available925Open in IMG/M
3300025759|Ga0208899_1151583Not Available792Open in IMG/M
3300025769|Ga0208767_1049649All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Llyrvirus → Synechococcus virus SSKS11972Open in IMG/M
3300025806|Ga0208545_1050668All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon1232Open in IMG/M
3300025889|Ga0208644_1145503All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Llyrvirus → Synechococcus virus SSKS11094Open in IMG/M
3300026183|Ga0209932_1105989Not Available616Open in IMG/M
3300027571|Ga0208897_1037461All Organisms → cellular organisms → Bacteria1317Open in IMG/M
3300027813|Ga0209090_10230881Not Available943Open in IMG/M
3300027813|Ga0209090_10313739Not Available774Open in IMG/M
3300028110|Ga0247584_1087170Not Available786Open in IMG/M
3300028233|Ga0256417_1053986All Organisms → cellular organisms → Bacteria1089Open in IMG/M
3300028233|Ga0256417_1074003All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium921Open in IMG/M
3300028671|Ga0257132_1113577Not Available576Open in IMG/M
3300031569|Ga0307489_10016082All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales4324Open in IMG/M
3300031569|Ga0307489_10577383All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alteromonas/Salinimonas group → Alteromonas → unclassified Alteromonas → Alteromonas sp. TMED35773Open in IMG/M
3300031766|Ga0315322_10079628Not Available2378Open in IMG/M
3300031851|Ga0315320_10024144All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon4830Open in IMG/M
3300031851|Ga0315320_10883499Not Available552Open in IMG/M
3300032088|Ga0315321_10046204All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon3060Open in IMG/M
3300032088|Ga0315321_10300641Not Available1023Open in IMG/M
3300032277|Ga0316202_10332505All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alteromonas/Salinimonas group → Alteromonas → unclassified Alteromonas → Alteromonas sp. TMED35708Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine29.32%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater12.78%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous9.77%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh9.02%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater6.77%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater5.26%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine5.26%
Pond WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water3.01%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater2.26%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine2.26%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water2.26%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine1.50%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine1.50%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine1.50%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake0.75%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine0.75%
Microbial MatEnvironmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat0.75%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.75%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.75%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.75%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.75%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine0.75%
MEnvironmental → Aquatic → Marine → Unclassified → Unclassified → M0.75%
Freshwater And MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine0.75%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000116Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010EnvironmentalOpen in IMG/M
3300000117Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010EnvironmentalOpen in IMG/M
3300000928Marine plume microbial communities from the Columbia River - 25 PSUEnvironmentalOpen in IMG/M
3300001460Marine viral communities from the Pacific Ocean - LP-28EnvironmentalOpen in IMG/M
3300003592Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_10m_DNAEnvironmentalOpen in IMG/M
3300005239Environmental Genome Shotgun Sequencing: Ocean Microbial Populations from the Gulf of MaineEnvironmentalOpen in IMG/M
3300005731Seawater microbial communities from Vineyard Sound, MA, USA - succinate ammended T14EnvironmentalOpen in IMG/M
3300005738Seawater microbial communities from Vineyard Sound, MA, USA - sterilised with crude oil T0EnvironmentalOpen in IMG/M
3300005941Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697EnvironmentalOpen in IMG/M
3300006026Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006029Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNAEnvironmentalOpen in IMG/M
3300006637Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNAEnvironmentalOpen in IMG/M
3300006735Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaGEnvironmentalOpen in IMG/M
3300006752Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaGEnvironmentalOpen in IMG/M
3300006789Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaGEnvironmentalOpen in IMG/M
3300006793Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaGEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006919Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21EnvironmentalOpen in IMG/M
3300006924Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaGEnvironmentalOpen in IMG/M
3300006925Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaGEnvironmentalOpen in IMG/M
3300007863Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459B_0.2umEnvironmentalOpen in IMG/M
3300008012Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300009000Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MGEnvironmentalOpen in IMG/M
3300009027Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MGEnvironmentalOpen in IMG/M
3300009079Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741EnvironmentalOpen in IMG/M
3300009080Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759EnvironmentalOpen in IMG/M
3300009130Combined Assembly of Gp0139511, Gp0139512EnvironmentalOpen in IMG/M
3300009420Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152EnvironmentalOpen in IMG/M
3300009512Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88EnvironmentalOpen in IMG/M
3300009608Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_2Apr14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010150Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaGEnvironmentalOpen in IMG/M
3300010151Marine viral communities from the Subarctic Pacific Ocean - 22_ETSP_OMZ_AT15343 metaGEnvironmentalOpen in IMG/M
3300010368Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNAEnvironmentalOpen in IMG/M
3300016740Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041413YT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016741Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071410CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016766Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041409AS metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017706Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaGEnvironmentalOpen in IMG/M
3300017714Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15EnvironmentalOpen in IMG/M
3300017719Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21EnvironmentalOpen in IMG/M
3300017726Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24EnvironmentalOpen in IMG/M
3300017727Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20EnvironmentalOpen in IMG/M
3300017749Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15EnvironmentalOpen in IMG/M
3300017769Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 (version 2)EnvironmentalOpen in IMG/M
3300017771Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13EnvironmentalOpen in IMG/M
3300017782Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19EnvironmentalOpen in IMG/M
3300017783Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10EnvironmentalOpen in IMG/M
3300017786Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18EnvironmentalOpen in IMG/M
3300017824Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017952Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017956Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017967Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018417Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018421Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018682Metatranscriptome of marine microbial communities from Baltic Sea - GS680_0p1EnvironmentalOpen in IMG/M
3300018876Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300020013Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041406CT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020173Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041408US metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020274Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX556029-ERR598943)EnvironmentalOpen in IMG/M
3300020347Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556109-ERR598994)EnvironmentalOpen in IMG/M
3300020438Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942)EnvironmentalOpen in IMG/M
3300020463Marine microbial communities from Tara Oceans - TARA_B100001057 (ERX555988-ERR599050)EnvironmentalOpen in IMG/M
3300020469Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052)EnvironmentalOpen in IMG/M
3300021085Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015EnvironmentalOpen in IMG/M
3300021185Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015EnvironmentalOpen in IMG/M
3300021371Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO497EnvironmentalOpen in IMG/M
3300021375Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132EnvironmentalOpen in IMG/M
3300021379Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO247EnvironmentalOpen in IMG/M
3300021425Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO284EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300021958Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27DEnvironmentalOpen in IMG/M
3300022072Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3)EnvironmentalOpen in IMG/M
3300022074Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2)EnvironmentalOpen in IMG/M
3300023109 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_10_MGEnvironmentalOpen in IMG/M
3300024059 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_2EnvironmentalOpen in IMG/M
3300024243 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_150_MGEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300025070Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025084Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025086Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025120Marine viral communities from the Pacific Ocean - LP-28 (SPAdes)EnvironmentalOpen in IMG/M
3300025151Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes)EnvironmentalOpen in IMG/M
3300025168Marine viral communities from the Pacific Ocean - LP-53 (SPAdes)EnvironmentalOpen in IMG/M
3300025759Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes)EnvironmentalOpen in IMG/M
3300025769Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes)EnvironmentalOpen in IMG/M
3300025806Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025889Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes)EnvironmentalOpen in IMG/M
3300026183Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG (SPAdes)EnvironmentalOpen in IMG/M
3300027571Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 (SPAdes)EnvironmentalOpen in IMG/M
3300027813Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 (SPAdes)EnvironmentalOpen in IMG/M
3300028110Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 43R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028233Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - MB_1026D (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028671Metatranscriptome of marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_10m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031569Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2EnvironmentalOpen in IMG/M
3300031766Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 21515EnvironmentalOpen in IMG/M
3300031851Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515EnvironmentalOpen in IMG/M
3300032088Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 21515EnvironmentalOpen in IMG/M
3300032277Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotiteEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOSpr2010_10000732413300000116MarineMNEVKLTLQENEANVLLQLIDVAVKSQGLQVAEAASFLATKIREQAQAQLPKPEGEETEAETAE*
DelMOWin2010_10000519353300000117MarineMNEIKITLQENEANALLQIIDVAVKAQGLQIAEAGSFLATKIQEQAKSQLPQAEAEAPTEEE*
OpTDRAFT_1045922823300000928Freshwater And MarineMNEVKLTLQENEANVLLQLIDVAVKAQGLQVAEAASFLATKIREQAQAQLPKPEGEETEAETAE*
JGI24003J15210_1000090083300001460MarineMNEIKITLQENEANALLQIIDVAVKAQGLQIAEAGSFLATKIQEQAKSQLPQPEAEAEVLPEGE*
JGI24003J15210_1013803813300001460MarineMNEVKMTFSEQEANVLLQLIDIAIKAQGLQVAEAGSFLATKIREEAQAQLPKPESEEGEGLEAVAEAVAESE*
JGI26246J51724_101232933300003592MarineMNEIKLSLQENETNVLLQLIDVAIKAQGLQVAEAGSFLANKITEQVKTQIASPEEGGE*
Ga0073579_117872233300005239MarineMNEINLSFQENELNVLLQLIDAAIKAQGLQVAEAGSFLATKIQEQAKSQIEQPEESEEAPAES*
Ga0076919_102883433300005731MMNEIKISFTQNEVDALLQLIDVAIKSQGLQVSEAGTFLANKITEQSKGQIDTPKEDSSDTE*
Ga0076926_10478713300005738MarineMNEIKLSLQENEANVLLQLIDIAVKAQGLQVAEAGSFLATKIQEQTKEQITPQEEEGE*
Ga0070743_1014005723300005941EstuarineVLMNEVKLTLQENEANVLLQLIDVAVKSQGLQVAEAASFLATKIREQAQAQLPKPEGEETEAETAE*
Ga0075478_1004653023300006026AqueousMNEIKISLQENEVNALLQLIDAAIKAQGLQVAEAGSFLATKISEQAKSQISPPEEEEAPTEEG*
Ga0075466_1000070213300006029AqueousMNEIKLSLQENEANVLLQLIDIAVKAQGLQVAEAGSFLATKIQEQTKEQIVPQEEEGQ*
Ga0075461_1020964113300006637AqueousITLQENEANVLLQLIDIAVKAQGLQVAEAGSFLATKIRQQAQSQLPKPEEQEEEVKED*
Ga0098038_100761933300006735MarineMNEIKLSLQENEANVLLQLIDIAVKAQGLQVAEAGSFLATKIQEQTKEQMAPQEEEGQA*
Ga0098038_102472843300006735MarineMNEIKLSLQENETNVLLQLIDVAIKAQGLQVAEAASFLANKITEQAKTQSTSSEEAEE*
Ga0098048_101235323300006752MarineMNEIKISLKENETNVLLQLIDFAIKAQGLQVAEAGSFLAAKIKEQAEAQLPKPEAEPSIQEE*
Ga0098048_101992123300006752MarineMNEIKITLQENEANALLQIIDVAVKAQGLQLAEAGSFLATKIQEQAKSQVSQPEVEAEAPSEGE*
Ga0098048_102071243300006752MarineMNEIKISLQENETNVLLQLIDIAIKAQGLQVAEAGSFLATKIQEQTKEQIVPQEEEEGQ*
Ga0098048_102181623300006752MarineMNEIKLSLQENEANVLLQLIDIAIKAQGLQVAEAGSFLATKIQEQTKEQMVPQDEEEQA*
Ga0098048_115505923300006752MarineMNEIKLSLQENEANVLLQLIDIAVKAQGLQVAEAGSFLATKIQEQTKEQMVPQEEEEQA*
Ga0098054_100614823300006789MarineMNEVKITFSEQEANVLLQLIDVAVKAQGLQVAEAGSFLATKIREEAQAQLPKPEGEETEAGTAE*
Ga0098054_114205123300006789MarineMNEVKLTLQENEANVLLQLIDVAVKSQGLQVAEAASFLATKIREQAQAQLPKPEGEE
Ga0098054_114622713300006789MarineLQENEANVLLQLIDIAVKAQGLQVAEAGSFLATKIQEQTKEQMVPQEEEEQA*
Ga0098054_124759623300006789MarineLQENEANILLQLIDIAVKSQGLQVAEAGSFLATKIREQSQPQMAQPELKYEPEEEAPE*
Ga0098055_1003671123300006793MarineMNEIKITLQENEANALLQIIDVAVKAQGLQIAEAGSFLASKIQEEAKSQLPQAQVEVQAEAPTEEE*
Ga0070749_1004966123300006802AqueousMNEIKLTLQENEANALLQLIDVAVKSQGLQVAEAGSFLATKIQEQAKAQLPAPEAPETEEEA*
Ga0070749_1008348913300006802AqueousMNSINITLQENEANVLLQLIDIAVKAQGLQVAEAGSFLATKIREQAQTQLPKPEEQEEVKED*
Ga0070746_1002073833300006919AqueousMNEIKLTLQENEANALLQLIDVAVKSQGLQVAEAGSFLATKIQEQAKAQLPTPEAPEAPETEEEA*
Ga0070746_1005257163300006919AqueousMNSINITLQENEANVLLQLIDIAVKAQGLQVAEAGSFLAGKIRQQAQAQLPQPEAQEEEAKED*
Ga0098051_107166513300006924MarineLMNEVKLTLQENEANVLLQLIDVAVKSQGLQVAEAASFLATKIREQAQAQLPKPEGEETEAETAE*
Ga0098050_114963313300006925MarineVKITFSKQEAIVLLKLIDVAVKAQGLQVAEAGSFLATKIREEAQAQLPKPEGEETEAETAE*
Ga0098050_115581623300006925MarineMLIC*IILLNFDNQVRMNEIKITLQENEANALLQIIDVAVKAQGLQIAEAGSFLASKIQEEAKSQLPQAQVEVQAEAPTEEE*
Ga0105744_100112943300007863Estuary WaterMNEITITLQENEANALLQIIDVAVKAQGLQIAEAGSFLATKIQEQAKSQSPQEEVEAPTEVE*
Ga0075480_1062965123300008012AqueousMNEIKLTLQENEANALLQLIDVAVKSQGLQVAEAGSFLATKIQEQAKAQLPAPEAPEAPETEEEA*
Ga0102960_107830233300009000Pond WaterMNEMKISLQENEVNALLQLIDAAVKAQGLQVAEAGSFLATKITEQAKSQMPSPEEEAPTEEG*
Ga0102957_124919313300009027Pond WaterMNEMKISLQENEVNALLQLIDAAVKAQGLQVAEAGSFLATKITEQAKSKMPSLEEEAPTEEG*
Ga0102957_127941723300009027Pond WaterMNEIKLTLQENEANALLQLIDVAVKSQGLQVAEAGSFLATKIQEQAKAQLPDPEAPEAPETEEQA*
Ga0102814_1030977413300009079EstuarineMNEIKISLKENETNVLLQLIDFAIKAQGLQVAEAGSFLASKIKEQAEAQLPKPEAEPSTQEE*
Ga0102815_1014706013300009080EstuarineMNEVNLTLQENEANILLQLIDIAVKSQGLQVAEAGAFLATKIREQSQPQMAQPELKYEPEEEAPE*
Ga0118729_100365273300009130MarineMNEIKISLQENETNVLLQLIDVAIKAQGLQVAEAGSFLANKITEQVKTQIDPPEEGGE*
Ga0114994_1004398293300009420MarineALLQIIDAAIKSQGLQIAEAGSFLAAKIQEQAKAQLPAPAPAPAPEPELEVLPEGE*
Ga0114994_1010877823300009420MarineMNEIKLSLQENEVNALLQLIDLAVKAQGLQVAEAGSVIAGKIQEQAKSQVEPPAEDGPPPEETGK*
Ga0114994_1046339723300009420MarineMNEIKITLQENEANALLQIIDVAVKAQGLQLAEVGSFLATKIQEQAKAQLPNPDVEAEIKAEASTEGE*
Ga0115003_1014669433300009512MarineMNEIKLSLQENEVNALLQLIDLAVKAQGLQVAEAGSIIAGKIQEQAKSQVEPPAEDGEAPEESEK*
Ga0115100_1055839523300009608MarineMNEINLSFKENELNVLLQLIDAAIKAQGLQVAEAGSFLATKIQEQAKSQIEQPEESEEAPAES*
Ga0098056_102161833300010150MarineMNEVNLTLQENEANILLQLIDIAVKSQGLQVAEAGSFLATKIREQSQPQMAQPELKYEPEEEAPE*
Ga0098061_119607633300010151MarineCYYQATMNEIKLSLQENEANVLLQLIDIAVKAQGLQVAEAGSFLATKIQEQTKEQMVPQEEEEQA*
Ga0129324_1018565713300010368Freshwater To Marine Saline GradientQENEANVLLQLIDIAVKAQGLQVAEAGSFLATKIQEQTKEQIVPQEEEGQ*
Ga0182096_128938013300016740Salt MarshLTLQENEANALLQLIDVAVKAQGLQVAEAGSFLATKIQEQAKAQLPAPEAPEAPETEEEA
Ga0182079_146587823300016741Salt MarshQNEVNALLQLIDVAIKAQGLQVAEAGSFLANKIGEQAKEQLPEPEAEEKTEAAE
Ga0182091_131319213300016766Salt MarshLTLQENEANALLQLIDVAVKSQGLQVAEAGSFLATKIQEQAKAQLPAPEAPEAPETEEEA
Ga0181377_100240743300017706MarineMNEIKLSLQENEANVLLQLIDIAVKAQGLQVAEAGSFLATKIQEQTKEQMAPQEEEEQA
Ga0181412_1000501103300017714SeawaterMNLDNQVRMNEIKITLQENEANALLQIIDIAVKAQGLQIAEAGSFLATKIQEQAKSQLPQAEAEVEAPTEGE
Ga0181390_1000951233300017719SeawaterMNLDNQVRMNEIKITLQENEANALLQIIDIAVKAQGLQIAEAGSFLATKIQEQAKYQLPQAEAEAEAEVEAPTEEE
Ga0181390_101772913300017719SeawaterKLSLQENETNVLLQLIDIAIKAQGLQVAEAGSFLATKIEEQMKEQATLQEEEGRKKEA
Ga0181390_117195623300017719SeawaterMNEIKLSLQENETNVLLQLIDVAIKAQGLQVAEAGSFLANKITEQVKTQITPPEEE
Ga0181381_103713313300017726SeawaterTMNEIKLSLQENEANVLVQLIDVAIKAQGLQVAEAGSFLATKIQEQTKEQIVPQEEEEEG
Ga0181401_103873533300017727SeawaterMNEIKLSLQENETNVLLQLIDIAIKAQGLQVAEAGSFLATKIEEQMKEQATLQEEEGRKKEA
Ga0181401_106873823300017727SeawaterMNEIKISLQENEVNALLQLIDAAVKAQGLQVAEAGSFLATKISEQAKAQISPPEEEEAPTEEG
Ga0181392_124796723300017749SeawaterMNLDNQVRMNEIKITLQENEANALLQIIDIAVKAQGLQIAEAGSFLATKIQEQAKYQLPQAEAEAEVEAPTEEE
Ga0187221_111788223300017769SeawaterILMNLDNQVHMNEIKITLQENEANALLQIIDVAVKAQGLQIAEAGSFLATKIQEQAKSQLPQAEAEAPTEGE
Ga0181425_100029533300017771SeawaterMNEIKISLQENETNVLLQLIDVAIKAQGLQVAEAGSFLANKITEQVKTQITPPEEEQ
Ga0181380_104132233300017782SeawaterMNEIKLSLQENEANVLVQLIDVAIKAQGLQVAEAGSFLATKIEEQMKEQAALQEEEGLKKEA
Ga0181379_114146413300017783SeawaterMNLDNQVRMNEIKITLQENEANALLQIIDVAVKAQGLQIAEAGSFLATKIQEQAKSQLPQAEAEVEAPTEGE
Ga0181424_1005333953300017786SeawaterEIKISLQENETNVLLQLIDVAIKAQGLQVAEAGSFLANKITEQVKTQITPPEEEQ
Ga0181552_1011221733300017824Salt MarshMNEIKISLQENEVNALLQLIDAAIKAQGLQVAEAGSFLATKISEQAKSQISPPEEEEAPTEEG
Ga0181583_1026513013300017952Salt MarshTMNEIKLSLQQNEVNALLQLIDVAIKAQGLQVAEAGSFLANKIGEQAKEQLPEPEAEEKTEAAE
Ga0181580_1085036713300017956Salt MarshMNSINITLQENEANVLLQLIDIAVKAQGLQVAEAGSFLATKIREQAQTQLPKPEEQEEEVKED
Ga0181590_1003709963300017967Salt MarshMNEIKLSLQQNEVNALLQLIDVAIKAQGLQVAEAGSFLANKIGEQAKEQLPEPEAEEKTEAAE
Ga0181558_1033175823300018417Salt MarshNEIKISLQENEVNALLQLIDAAIKAQGLQVAEAGSFLATKISEQAKSQISPPEEEEAPTEEG
Ga0181592_1038162223300018421Salt MarshMNPITITLQENEANVLLQLIDIAVKAQGLQVAEAGSFLATKIREQAQTQLPKPEEQEEVKED
Ga0188851_100082593300018682Freshwater LakeMNEIKISLQENEVNVLLQLIDIAVKAQGLQVAEAGSFLATKLREAAQSQITLPEVEPSTEEE
Ga0181564_1003509573300018876Salt MarshMNEIKISLQENEVNALLQLIDAAVKAQGLQVAEAGSFLATKISEQAKSQISPPEEEEAPTEEG
Ga0182086_118136423300020013Salt MarshMNEIKLTLQENEANALLQLIDVAVKSQGLQVAEAGSFLATKIQEQAKAQLPAPEAPEAPETEEEA
Ga0181602_1010504913300020173Salt MarshMNEIKLTLQENEANALLQLIDVAVKAQGLQVAEAGSFLATKIQEQAKAQLPAPEAPEAPETEEEA
Ga0211658_100579523300020274MarineMNEIKISLQENEANVLVQLIDVAIKAQGLQVAEAGSFLATKIEEQMKEQTAPQEEVVGAEKQAQ
Ga0211504_103481123300020347MarineMNEINLSFQENELNVLLQLIDAAIKAQGLQVAEAGSFLATKIQEQAKSQIEQPEESEEAPAES
Ga0211576_1001487233300020438MarineMNEIKLSLQENETNVLLQLIDVAIKAQGLQVAEAGSFLANKITEQVKTQITPPEEEQ
Ga0211576_1027529623300020438MarineNEINLSFQENELNVLLQLIDAAIKAQGLQVAEAGSFLATKIQEQAKSQIEQPEESEEAPAES
Ga0211676_1000153183300020463MarineMNEIKLSLQENETTVLLQLIDIAIKAQGLQVAEAGSFLANKITEEVKTQSAPSEEAEE
Ga0211577_1017140933300020469MarineMNEIKLSLQENETNVLLQLIDVAIKAQGLQVAEAGSFLANKITEQVKTQITPPEE
Ga0206677_10007773133300021085SeawaterMNEVKMTFSEQEANVLLQLIDIAIKAQGLQVAEAGSFLATKIREEAQAQLPKPESEEAEGSEVESE
Ga0206682_1004948133300021185SeawaterMNEVKLTLQENEANVLLQLIDVAVKAQGLQVAEAASFLATKIREQAQAQLPKPEGEETEAETAE
Ga0213863_1017713523300021371SeawaterMNEIKITLQENEANALLQIIDVAVKAQGLQIAEAGSFLATKIQEQAKSQLPQAEAEAPTEEE
Ga0213869_1015987823300021375SeawaterMNEVKLTLQENEANVLLQLIDVAVKSQGLQVAEAASFLATKIREQAQAQLPKPEGEETEAETAE
Ga0213864_10000365273300021379SeawaterMNSINITLQENEANVLLQLIDIAVKAQGLQVAEAGSFIATKIREQAQSQLPKPEEQEEEVKEG
Ga0213864_1008707023300021379SeawaterMNSINITLQENEANVLLQLIDIAVKAQGLQVAEAGSFIATKIREQAQTQLPKPEEQEEVKED
Ga0213864_1013945443300021379SeawaterMNSINITLQENEANVLLQLIDIAVKAQGLQVAEAGSFLATKIREQAQTQLPKPEEQEEVKED
Ga0213866_1000122983300021425SeawaterMNEIKLTLQENEANALLQLIDVAVKSQGLQVAEAGSFLATKIQEQAKAQLPSPEAPEAPETEEEA
Ga0222717_1026012823300021957Estuarine WaterMNEINLSFKENELNVLLQLIDAAIKAQGLQVAEAGSFLATKIQEQAKSQIEQPEESEEAPAES
Ga0222718_1017422623300021958Estuarine WaterMNEIKLTLQENEANALLQLIDVAVKSQGLQVAEAGSFLATKIQEQAKAQLPAPEAPEAPETEEQA
Ga0222718_1029185223300021958Estuarine WaterMNEIKISLQENEVNALLQLIDAAIKAQGLQVAEAGSFLATKITEQAKSQMPSPEEEEAPTEEG
Ga0196889_105484423300022072AqueousMNEIKLSLQENEANVLLQLIDIAVKAQGLQVAEAGSFLATKIQEQTKEQIVPQEEEGQ
Ga0224906_1001100103300022074SeawaterMNEITITLQENEANALLQIIDVAVKAQGLQIAEAGSFLATKIQEQAKSQLPQAEAEAPTEGE
Ga0224906_100504593300022074SeawaterMNEIKISLKENETNVLLQLIDFAIKAQGLQVAEAGSFLAAKIKEQAEAQLPKPEAEPSIQEE
Ga0224906_104623623300022074SeawaterMNEIKISLQENETNVLLQLIDIAIKAQGLQVAEAGSFLATKIQEQTKEQIVPQEEEEEGQ
(restricted) Ga0233432_10024143103300023109SeawaterMNEVNLTLQENEANILLQLIDIAVKSQGLQVAEAGAFLATKIREQSQPQMAQPELKYEPEEEAPE
(restricted) Ga0233432_1005519963300023109SeawaterMNEITITLQENEANALLQIIDVAVKAQGLQIAEAGSFLATKIQEQAKSQSPQEEVEAPTEVE
(restricted) Ga0255040_1043506723300024059SeawaterMNEIKLSLQENEANVLLQLIDIAIKAQGLQVAEAGSFLATKIQEQTKEQIAPQEEEEQS
(restricted) Ga0233436_119838913300024243SeawaterMNEIKLSLQENETNVLLQLIDVAIKAQGLQVAEAGSFLANKITEQVKTQIASPEEGGE
Ga0244775_1049253713300024346EstuarineYNQLHMNEITITLQENEANALLQIIDVAVKAQGLQIAEAGSFLATKIQEQAKSQSPQEEVEAPTEVE
Ga0208667_100396133300025070MarineMNEIKISLQENETNVLLQLIDIAIKAQGLQVAEAGSFLATKIQEQTKEQIVPQEEEEGQ
Ga0208667_100838833300025070MarineMNEIKLSLQENEANVLLQLIDIAIKAQGLQVAEAGSFLATKIQEQTKEQMVPQDEEEQA
Ga0208667_100853523300025070MarineMNEIKITLQENEANALLQIIDVAVKAQGLQIAEAGSFLASKIQEEAKSQLPQAQVEVQAEAPTEEE
Ga0208298_107968823300025084MarineMNEIKLSLQENETNVLLQLIDVAIKAQGLQVAEAASFLANKITEQAKTQSTSSEEAEE
Ga0208298_108325223300025084MarineMNEVKITFSEQEANVLLQLIDVAVKAQGLQVAEAGSFLATKIREEAQAQLPKPEGEETEAGTAE
Ga0208157_100201833300025086MarineMNEIKLSLQENEANVLLQLIDIAVKAQGLQVAEAGSFLATKIQEQTKEQMAPQEEEGQA
Ga0209535_100081383300025120MarineMNEIKITLQENEANALLQIIDVAVKAQGLQIAEAGSFLATKIQEQAKSQLPQPEAEAEVLPEGE
Ga0209535_1008313123300025120MarineMNEVKMTFSEQEANVLLQLIDIAIKAQGLQVAEAGSFLATKIREEAQAQLPKPESEEGEGLEAVAEAVAESE
Ga0209535_101916033300025120MarineMNEIKISLQENETNVLLQLIDVAIKAQGLQVAEAGSFLANKITEQVKTQIDPPEEGGE
Ga0209645_102834773300025151MarineMNEIKFLLQENEANVLLQLIDIAVKAQGLQVAEAGSFLATKIQEQTKEQITSQEEEGG
Ga0209645_116956913300025151MarineMNEIKLSLQENETNVLLQLIDVAIKAQGLQVAEAGSFLANKITEQVKTQITPPEEGGK
Ga0209337_116889423300025168MarineMNEVKMTFSEQEANVLLQLIDIAIKAQGLQVAEAGSFLATKIREEAQAQLPKPESEEGEGLEAVAESE
Ga0208899_115158313300025759AqueousMNEIKLTLQENEANALLQLIDVAVKSQGLQVAEAGSFLATKIQEQAKAQLPTPEAP
Ga0208767_104964923300025769AqueousMNEIKLTLQENEANALLQLIDVAVKSQGLQVAEAGSFLATKIQEQAKAQLPTPEAPEAPETEEEA
Ga0208545_105066833300025806AqueousMNEIKLTLQENEVRAVFQLIDVAVKSQGLQVAEAGSFLATKIQEQTKEQIVPQEEEGQ
Ga0208644_114550313300025889AqueousMNEIKLTLQENEANALLQLIDVAVKSQGLQVAEAGSFLATKIQEQAKAQLPAPEAPET
Ga0209932_110598923300026183Pond WaterMNEMKISLQENEVNALLQLIDAAVKAQGLQVAEAGSFLATKITEQAKSQMPSPEEEAPTEEG
Ga0208897_103746133300027571EstuarineVLMNEVKLTLQENEANVLLQLIDVAVKSQGLQVAEAASFLATKIREQAQAQLPKPEGEETEAETAE
Ga0209090_1023088123300027813MarineMNEIKLSLQENEVNALLQLIDLAVKAQGLQVAEAGSVIAGKIQEQAKSQVEPPAEDGPPPEETGK
Ga0209090_1031373923300027813MarineMNEIKITLQENEANALLQIIDVAVKAQGLQLAEVGSFLATKIQEQAKAQLPNPDVEAEIKAEASTEGE
Ga0247584_108717013300028110SeawaterTLQENEANVLLQLIDVAVKSQGLQVAEAASFLATKIREQAQAQLPKPEGEETEAETAE
Ga0256417_105398613300028233SeawaterVKLTLQENEANVLLQLIDVAVKSQGLQVAEAASFLATKIREQAQAQLPKPEGEETEAETA
Ga0256417_107400323300028233SeawaterLSFQENELNVLLQLIDAAIKAQGLQVAEAGSFLATKIQEQAKSQIEQPEESEEAPAES
Ga0257132_111357723300028671MarineVKMTFSEQEANVLLQLIDIAIKAQGLQVAEAGSFLATKIREEAQAQLPKPESEEGEGLEAVAEAVAESE
Ga0307489_1001608263300031569Sackhole BrineMNEIKLSLQENEVNALLQLIDLAVKAQGLQVAEAGSVIAGKIQEQAKSQVEPPAEDGPAPEETEK
Ga0307489_1057738323300031569Sackhole BrineMNEIKISFSEQEANALLQIIDAAIKSQGLQIAEAGSFLAAKIQEQAKAQLPAPAPAPEPELEVLPEGE
Ga0315322_1007962833300031766SeawaterMNEIKLSLQENEANVLLQLIDIAIKAQGLQVAEAGSFLATKIQEQTKEQIVPQEEEEQS
Ga0315320_1002414433300031851SeawaterMNEIKLSLQENEANVLLQLIDIAIKAQGLQVAEAGSFLATKIQEQTKEQIALQEEEEGQ
Ga0315320_1088349913300031851SeawaterVDFLFISLYNYVLMNEVKMTFSEQEANVLLQLIDIAIKAQGLQVAEAGSFLATKIREEAQAQLPKPESEEAEGSEVESE
Ga0315321_1004620433300032088SeawaterMNEIKLSLQENETNVLLQLIDIAIKAQGLQVAEAGSFLATKIQEQTKEQIVPQEEEEQS
Ga0315321_1030064113300032088SeawaterMNEVKLTLQENEANVLLQLIDVAVKSQGLQVAEAASFLATKIREQAQAQLPKPEGEETEAET
Ga0316202_1033250523300032277Microbial MatMNEIKISLKENETNVLLQLIDFAIKAQGLQVAEAGSFLATKIKEQAEAQLPKPEAEPPTQEE


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.