| Basic Information | |
|---|---|
| Family ID | F059900 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 133 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MAKATKKISVADIAKLAKKIRKPNEKWTDAIKRAAAQLK |
| Number of Associated Samples | 103 |
| Number of Associated Scaffolds | 133 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 13.53 % |
| % of genes near scaffold ends (potentially truncated) | 18.05 % |
| % of genes from short scaffolds (< 2000 bps) | 58.65 % |
| Associated GOLD sequencing projects | 97 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.53 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (83.459 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (22.556 % of family members) |
| Environment Ontology (ENVO) | Unclassified (62.406 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (69.925 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 34.33% β-sheet: 0.00% Coil/Unstructured: 65.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 133 Family Scaffolds |
|---|---|---|
| PF00182 | Glyco_hydro_19 | 16.54 |
| PF01569 | PAP2 | 8.27 |
| PF01832 | Glucosaminidase | 3.01 |
| PF01520 | Amidase_3 | 2.26 |
| PF08291 | Peptidase_M15_3 | 1.50 |
| PF08239 | SH3_3 | 1.50 |
| PF07883 | Cupin_2 | 0.75 |
| PF07460 | NUMOD3 | 0.75 |
| PF00149 | Metallophos | 0.75 |
| PF01391 | Collagen | 0.75 |
| PF06414 | Zeta_toxin | 0.75 |
| PF00583 | Acetyltransf_1 | 0.75 |
| PF09374 | PG_binding_3 | 0.75 |
| PF06356 | DUF1064 | 0.75 |
| PF12840 | HTH_20 | 0.75 |
| COG ID | Name | Functional Category | % Frequency in 133 Family Scaffolds |
|---|---|---|---|
| COG3179 | Chitinase, GH19 family | Carbohydrate transport and metabolism [G] | 16.54 |
| COG3979 | Chitodextrinase | Carbohydrate transport and metabolism [G] | 16.54 |
| COG0860 | N-acetylmuramoyl-L-alanine amidase | Cell wall/membrane/envelope biogenesis [M] | 2.26 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 83.46 % |
| All Organisms | root | All Organisms | 16.54 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 22.56% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 17.29% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 7.52% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 6.77% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 4.51% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 4.51% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 4.51% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 3.01% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 3.01% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 3.01% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 2.26% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 2.26% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.26% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 1.50% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.50% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.50% |
| Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 1.50% |
| Wastewater Effluent | Engineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent | 1.50% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.75% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.75% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.75% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 0.75% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Sediment | 0.75% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.75% |
| Lake Water | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake Water | 0.75% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.75% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.75% |
| Surface Water | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Surface Water | 0.75% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.75% |
| Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 0.75% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2046860005 | Sediment microbial communities from Lake Washington, Seattle, for Methane and Nitrogen Cycles, sample from SIP 13C-methane aerobic no nitrate additional fraction | Environmental | Open in IMG/M |
| 3300001261 | Freshwater microbial communities from Lake Mendota, WI - 27AUG2008 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300001267 | Freshwater microbial communities from Lake Mendota, WI - 31AUG2010 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003388 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN | Environmental | Open in IMG/M |
| 3300003852 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB | Environmental | Open in IMG/M |
| 3300003986 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (v2) | Environmental | Open in IMG/M |
| 3300004096 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 2) | Environmental | Open in IMG/M |
| 3300004125 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (version 2) | Environmental | Open in IMG/M |
| 3300004128 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (version 2) | Environmental | Open in IMG/M |
| 3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
| 3300005525 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005739 | Cyanobacteria communities in tropical freswater systems - freshwater lake in Singapore | Environmental | Open in IMG/M |
| 3300005986 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 6/11/14 C2 DNA | Engineered | Open in IMG/M |
| 3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007212 | Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Bottom layer) 7 sequencing projects | Environmental | Open in IMG/M |
| 3300007216 | Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Surface and Bottom layer) 16 sequencing projects | Environmental | Open in IMG/M |
| 3300007562 | Estuarine microbial communities from the Columbia River estuary - metaG 1561A-02 | Environmental | Open in IMG/M |
| 3300007639 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-02 | Environmental | Open in IMG/M |
| 3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008962 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT5 | Environmental | Open in IMG/M |
| 3300009024 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705 | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
| 3300012348 | Freshwater microbial communities from Coldwater Creek, Ontario, Canada - S44 | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013094 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES058 metaG | Environmental | Open in IMG/M |
| 3300013125 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_11.25m | Environmental | Open in IMG/M |
| 3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
| 3300013128 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 69cm | Environmental | Open in IMG/M |
| 3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
| 3300013285 | Freshwater microbial communities from Lower Cathedral Lake, Yosemite National Park, California, USA - 13028-31Y | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300014720 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m | Environmental | Open in IMG/M |
| 3300014962 | Surface water microbial communities from Bangladesh - BaraHaldiaSW0309 | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020083 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015033 Kigoma Deep Cast 300m | Environmental | Open in IMG/M |
| 3300020084 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015032 Kigoma Deep Cast 1200m | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020179 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015056 Kigoma Offshore 0m | Environmental | Open in IMG/M |
| 3300020183 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surface | Environmental | Open in IMG/M |
| 3300020196 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015031 Kigoma Deep Cast 0m | Environmental | Open in IMG/M |
| 3300020498 | Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020563 | Freshwater microbial communities from Lake Mendota, WI - 09JUN2009 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
| 3300021424 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015009 Mahale N1 surface | Environmental | Open in IMG/M |
| 3300021438 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MG | Environmental | Open in IMG/M |
| 3300021602 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L222-5m | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300024512 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepC_0h | Environmental | Open in IMG/M |
| 3300027131 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_8h | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027741 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027751 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027777 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_140205_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027794 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 6/11/14 C2 DNA (SPAdes) | Engineered | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300027896 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes) | Environmental | Open in IMG/M |
| 3300031759 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18003P | Environmental | Open in IMG/M |
| 3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
| 3300033980 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME09Aug2015-rr0007 | Environmental | Open in IMG/M |
| 3300033992 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034119 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Jul2015-rr0166 | Environmental | Open in IMG/M |
| 3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| LWAeNNiAF_1970340 | 2046860005 | Freshwater Sediment | MAVAKKKVKVADIAKLAKKIRKPNEKWTDAIKRAAAQLK |
| B570J13879_1002344 | 3300001261 | Freshwater | MAKTIAKKKVNVADISALAKKIRKPNEAWTAAIKRAAAQIKKG* |
| B570J13875_1025711 | 3300001267 | Freshwater | MAKKITVAQISALAKKIRKPNEKWTDAIKRATAQLKKS* |
| B570J29032_1097857723 | 3300002408 | Freshwater | MAKATKKKVGVAEISALAKKIRKPNEKWTDAIKRASAQLK* |
| B570J40625_1007700931 | 3300002835 | Freshwater | MATAKKKINVADIAKLAKKIRKQGERWTDAIKRAAAQLK* |
| JGI25910J50241_101588651 | 3300003388 | Freshwater Lake | IMAKATKKVGVADIAKLAKKIRKPNEKWTDAIKRAAAQLK* |
| Ga0031655_100251189 | 3300003852 | Freshwater Lake Sediment | MATSKPAKKISVSDIAKLAKKIRKEGEKWTDAIKRASSQLKG* |
| Ga0063233_100896481 | 3300003986 | Freshwater Lake | MAVAKATKKISVSDIAKHAKKIRKDGEAWTSAIKRSAAELKKG* |
| Ga0066177_100028865 | 3300004096 | Freshwater Lake | MAVAKATKKISVSDIAKHAKKIRKDGEAWTMAIKRAAAELKKG* |
| Ga0066182_100380601 | 3300004125 | Freshwater Lake | MAKATKKAGVADIAKLAKKIRKPNEKWTDAIKRAAAQLK* |
| Ga0066180_101529722 | 3300004128 | Freshwater Lake | MAKATKKVGVADIAKLAKKIRKPNEKWTDAIKRAAAQLK* |
| Ga0007787_100136884 | 3300004240 | Freshwater Lake | MAKSTKKISVSDIAKLAKKIRKPNEKWTDAIKRAAAQLK* |
| Ga0007787_100256871 | 3300004240 | Freshwater Lake | MAKATTTKKITVSDISKHAKKIRKPNEAWTAAIKRASAELKKG* |
| Ga0068877_100527744 | 3300005525 | Freshwater Lake | MAKKISVAQISALAKKIRKANEKWTDAIKRASAQLKKG* |
| Ga0068876_100065707 | 3300005527 | Freshwater Lake | MAKATKKVSVSDIAKLAKKIRKEGEKWTDAIKRASAQLKN* |
| Ga0049080_100130512 | 3300005582 | Freshwater Lentic | MAKSKKINVADISKLAKKIRKPNEAWTSAIKRASAELKKA* |
| Ga0078894_101470432 | 3300005662 | Freshwater Lake | MAKKITVAQISALAKKIRKPNEKWTDAIKRATAQLKKG* |
| Ga0078894_111141651 | 3300005662 | Freshwater Lake | MAKAEKKKVNVSDIAKLAKKIRKPNEKWTDAIKRASAQLK* |
| Ga0076948_10050551 | 3300005739 | Lake Water | MATKKKISVQDISKLAKKIRKPNEKWTDAIKRAAKQLK* |
| Ga0075152_100470057 | 3300005986 | Wastewater Effluent | MAKATTSKKIDVSSISALAKKIRKPNEEWRDAIKRAAAQLKKG* |
| Ga0075471_100636455 | 3300006641 | Aqueous | MAVAKKKVKVADIAKLAKKIRKPNEKWTDAIKRASAQLK* |
| Ga0075471_103789052 | 3300006641 | Aqueous | MAKKISVAQISALAKKIRKPNEKWVDAIKRASAQLKKG* |
| Ga0103958_12008872 | 3300007212 | Freshwater Lake | MSKEVKKKLSISEIAKLAKKIRKPNEKWVDALKRATAQLK* |
| Ga0103961_12868221 | 3300007216 | Freshwater Lake | LFRSMAKKISVAQISALAKKIRKANEKWTDAIKRASAQLKKG* |
| Ga0102915_12904191 | 3300007562 | Estuarine | KKVGVADIAKLAKKIRKPNEKWTDAIKRAAAQLK* |
| Ga0102865_12442671 | 3300007639 | Estuarine | TKKKVSVSDIAKLAKKIRKPGEKWTDAIKRAAAQLK* |
| Ga0108970_108911734 | 3300008055 | Estuary | MAKATKKISVADIAKLAKKIRKPNEKWTDAIKRAAAQLK* |
| Ga0108970_115509871 | 3300008055 | Estuary | MAKATKKVGVADIAKLAKKIRKPNEVWTEAIKRAAKQLK* |
| Ga0114340_10583673 | 3300008107 | Freshwater, Plankton | MAKAMKVSVAEISKLAKKIRKPNEKWTDAIKRASAQLKKG* |
| Ga0114346_11356515 | 3300008113 | Freshwater, Plankton | MAKSTKKISVSDIAKLAKKIRKPNEKWTDAIKRASAQLK* |
| Ga0114350_100479411 | 3300008116 | Freshwater, Plankton | MAKKITVAQISALAKKIRKPNEKWTEAIKRATAQLKKG* |
| Ga0114355_11549312 | 3300008120 | Freshwater, Plankton | MSKATKKVNVADIAKLAKKIRKPKEAWTDAIKRASAQLKKG* |
| Ga0114876_10036361 | 3300008448 | Freshwater Lake | CNFMAKAMKVSVAEISKLAKKIRKPNEKWTDAIKRASAQLKKG* |
| Ga0104242_10677842 | 3300008962 | Freshwater | MAKAVKKVSVADIAKLAKKIRKPKEVWTDAIKRASAQLKKG* |
| Ga0102811_14311141 | 3300009024 | Estuarine | KNKNKIMAKATKKVGVADIAKLAKKIRKPNEKWTDAIKRAAAQLK* |
| Ga0114962_100085266 | 3300009151 | Freshwater Lake | MATAKKKINVADIAKLAKKIRKDGEAWTAAIKRAAAQLKK* |
| Ga0114978_100414844 | 3300009159 | Freshwater Lake | MANKKISVAEISKLAKKIRKPNEAWTAAIKRASAQLKKG* |
| Ga0105104_101842973 | 3300009168 | Freshwater Sediment | MAKAEKKVSVSDIAKLAKQIRKPNEKWTDAIKRAASQLKK* |
| Ga0129333_100138448 | 3300010354 | Freshwater To Marine Saline Gradient | MPTKKKVSVSDIAKLAKKIRKPGEKWTDAIKRAAAQLK* |
| Ga0129333_106524662 | 3300010354 | Freshwater To Marine Saline Gradient | MAKATKKVSVQEISALAKKIRKPNEAWTAAIKRAAAQLKKG* |
| Ga0129333_109059282 | 3300010354 | Freshwater To Marine Saline Gradient | MAGKKLSVAAISSLAKKIRKPNEKWTDAIKRATAQLKKG* |
| Ga0129333_111894282 | 3300010354 | Freshwater To Marine Saline Gradient | MAKAKKISVSDIAKLAKKIRKPTEKWTDAIKRAAAQLK* |
| Ga0133913_1000258913 | 3300010885 | Freshwater Lake | MTKKPTKITVADIAKHAKKIRKTGEAWTSAIKRAAAELKK* |
| Ga0133913_1014922016 | 3300010885 | Freshwater Lake | MAKATKKISVADIAKLAKKIRKPNEKWTDAIKRAAAQL |
| Ga0151620_10027086 | 3300011268 | Freshwater | MAKATKKKVSVAEISALAKKIRKANEKWTDAIKRASAQLK* |
| Ga0157140_1000007511 | 3300012348 | Freshwater | MAKAIVKKKVGVADIAALAKKIRKPNEAWTSAIKRAAAEIKKG* |
| Ga0164293_100886583 | 3300013004 | Freshwater | MAKKITVAQISALAKKIRKPNEKWTEAIKRATAQLKRG* |
| Ga0164293_104782362 | 3300013004 | Freshwater | MAKATKKVSVADIAKLAKKIRKEGEKWTDAIKRAASQLKK* |
| Ga0164292_103046192 | 3300013005 | Freshwater | MAKKITVAQISALAKKIRKPNEKWTEAIKRATAQLKRV* |
| Ga0164292_106890203 | 3300013005 | Freshwater | MAKATKKVSVADIAKLAKKIRKEGEKWTDAIKRAAA |
| Ga0164297_101817002 | 3300013094 | Freshwater | MAKSAKGGKVALISAHAKATRKPNEAWTKAIQRASKELKKLGKI* |
| (restricted) Ga0172369_103599952 | 3300013125 | Freshwater | MAKSTKKVSVAEIAKLAKKIRKPTEKWTDAIKRAAAQLK* |
| (restricted) Ga0172367_100181888 | 3300013126 | Freshwater | MAKKISVAQISALAKKIRKANEKWTDAIKRAAAQLKKG* |
| (restricted) Ga0172366_104410972 | 3300013128 | Sediment | MAGKKLSVAAISSLAKKIRKPKEKWTDAIKRATAQLKKG* |
| (restricted) Ga0172373_1000221922 | 3300013131 | Freshwater | MANETKKTTKIKVSDIAKLAQKIRKPNEKWQDTIKRAAAQLKKENA* |
| Ga0136642_10485464 | 3300013285 | Freshwater | MEKQTKKINVADISKLAKKIRKPNEAWTAAIKRAAKELKK* |
| Ga0177922_100665573 | 3300013372 | Freshwater | MAKVTKKKVGVAEISALAKKIRKANEKWTDAIKRASAQLK* |
| (restricted) Ga0172376_102602692 | 3300014720 | Freshwater | LKPFNMAKKISVAQISALAKKIRKANEKWTDAIKRAAAQLKKG* |
| Ga0134315_100006536 | 3300014962 | Surface Water | MANDKKIKVSDIAKLAKQIRKPNEKWTDAIKRAAAQLKK* |
| Ga0181356_12511232 | 3300017761 | Freshwater Lake | MAKVTKKKVGVAEISALAKKSRNANEKWTDAIKRATAALK |
| Ga0181358_10108132 | 3300017774 | Freshwater Lake | MAKTTKKVGVADIAKLAKKIRKPNEKWTDAIKRAAAQLK |
| Ga0181349_10046729 | 3300017778 | Freshwater Lake | MAKETKKINVADISKLAKKIRKPNEAWTAAIKRAAKELKK |
| Ga0181349_12859261 | 3300017778 | Freshwater Lake | MAKATKKVSVADIARLAKKIRKEGEKWTDAIKRAAAQLKK |
| Ga0181355_12330501 | 3300017785 | Freshwater Lake | RRGFMAKVTKKKVGVAEISALAKKIRKANEKWTDAIKRASAQLK |
| Ga0169931_106323031 | 3300017788 | Freshwater | MAKKISVAQISALAKKIRKANEKWTDAIKRAAAQLKKG |
| Ga0181359_100059911 | 3300019784 | Freshwater Lake | MAVAKATKKISVSDIAKHAKKIRKDGEAWTMAIKRAAAELKKG |
| Ga0181359_100080113 | 3300019784 | Freshwater Lake | MAKSTKKISVSDIAKLAKKIRKPNEKWTDAIKRAAAQLK |
| Ga0181359_10169894 | 3300019784 | Freshwater Lake | MAKATKKAGVADIAKLAKKIRKPNEKWTDAIKRAAAQLK |
| Ga0181359_10494882 | 3300019784 | Freshwater Lake | MAKKITVAQISALAKKIRKPNEKWTDAIKRATAQLKKG |
| Ga0181359_11690792 | 3300019784 | Freshwater Lake | MAKATKKINVADIAKLAKKIRKEGEKWTDAIKRAAAQLKK |
| Ga0181359_12354832 | 3300019784 | Freshwater Lake | MAKATKKVGVADIAKLAKKIRKEGEKWTDAIKRAAAQLKK |
| Ga0194111_107573962 | 3300020083 | Freshwater Lake | MAKAVKKVSVADIAKLAKKIRKPKEAWTDAIKRASAQLKKG |
| Ga0194110_104398901 | 3300020084 | Freshwater Lake | VKKVSVADIAKLAKKIRKPKEAWTDAIKRASAQLKKG |
| Ga0211736_108006334 | 3300020151 | Freshwater | MAKATKKVGVADIAKLAKKIRKPNEKWTDAIKRASAQLK |
| Ga0211726_105817292 | 3300020161 | Freshwater | MAKATKKKISVAEISALAKKIRKANEKWTDAIKRASAQLK |
| Ga0211729_112162873 | 3300020172 | Freshwater | MAKATKKVGVADIAKLAKKMRKPNEKWTDAIKRAAAQLK |
| Ga0194134_100210187 | 3300020179 | Freshwater Lake | MAKSTKKVSVAEIAKLAKKIRKPTEKWTDAIKRAAAQLK |
| Ga0194115_100282846 | 3300020183 | Freshwater Lake | MAKKISVAQISALAKKIRKANEKWTDAIKRASAQLKKG |
| Ga0194115_101763992 | 3300020183 | Freshwater Lake | MAKKITVAQISALAKKIRKPNEKWTDAIKRASMQIKKR |
| Ga0194124_100814516 | 3300020196 | Freshwater Lake | MAKAVKKVSVADIAKLAKKIRKPKEAWTDAIKRAK |
| Ga0208050_10027912 | 3300020498 | Freshwater | MAKATKKISVADIAKLAKKIRKPNEKWTDAIKRAAAQLK |
| Ga0208050_10077032 | 3300020498 | Freshwater | MAKKITVAQISALAKKIRKPNEKWTDAIKRATAQLKKS |
| Ga0208082_10293693 | 3300020563 | Freshwater | IAKKKVNVADISALAKKIRKPNEAWTAAIKRAAAQIKKG |
| Ga0194117_104206362 | 3300021424 | Freshwater Lake | MAGKKLSVAAISSLAKKIRKPKEKWTDAIKRATAQLKKA |
| Ga0213920_10101355 | 3300021438 | Freshwater | MAEKKKVSVSEISTLAKKIRKEGEKWTDAIKRAAAQLKKA |
| Ga0194060_100508821 | 3300021602 | Anoxic Zone Freshwater | TLISAHAKKIWNKEKGEKWTDAIKRASAELKKLKKI |
| Ga0222715_100349106 | 3300021960 | Estuarine Water | MAKATKKVSVADIAKLAKKIRKEGEKWTDAIKRAASQLKK |
| Ga0222714_1000249119 | 3300021961 | Estuarine Water | MAKATKKKVSVAEISALAKKIRKANEKWTDAIKRASAQLK |
| Ga0222712_101590032 | 3300021963 | Estuarine Water | MAKSTKKKISVAEISALAKKIRKADEKWTSAIKRAAAQLK |
| Ga0181353_10199613 | 3300022179 | Freshwater Lake | MAKATTTKKITVSDISKHAKKIRKPNEAWTAAIKRASAELKKG |
| Ga0181354_10043798 | 3300022190 | Freshwater Lake | MSKATTPKKITVSDISKHAKKIRKPNEAWTAAIKRASAELKKG |
| Ga0181354_10680134 | 3300022190 | Freshwater Lake | MATAKKKVNVADIAKLAKKIRKDGEKWTDAIKRASI |
| Ga0181351_10115209 | 3300022407 | Freshwater Lake | MAKATKKVSVADIAKLAKKIRKEGEKWTDAIKRAAAQLKK |
| Ga0181351_10286724 | 3300022407 | Freshwater Lake | MAKVTKKKVGVAEISALAKKIRKANEKWTDAIKRASAQLK |
| Ga0181351_10318574 | 3300022407 | Freshwater Lake | MAKAEKKKVNVSDIAKLAKKIRKPNEKWTDAIKRASAQLK |
| Ga0181351_10717522 | 3300022407 | Freshwater Lake | MPKETKKKVNVADIAKLAKKIRKPNEKWTDAIKRASAQLK |
| Ga0181351_11028823 | 3300022407 | Freshwater Lake | MAKATKKINVADISKLAKKIRKPDEKWTAAIKRASVQLRK |
| Ga0214917_1000015995 | 3300022752 | Freshwater | MAKKITVAQISALAKKIRKPNEKWTEAIKRATAQLKKG |
| Ga0214917_1000126250 | 3300022752 | Freshwater | MPTKKKVSVSDIAKLAKKIRKPGEKWTDAIKRAAAQLK |
| Ga0214917_100553458 | 3300022752 | Freshwater | MAKKISVAQISALAKKIRKPNEKWTDAIKRASAQLKRG |
| Ga0214917_101107294 | 3300022752 | Freshwater | MAGKKLSVAAISSLAKKIRKPNEKWTDAIKRATAQLKKG |
| Ga0214919_107431522 | 3300023184 | Freshwater | MAKATKKISVADIAKLAKKIRKPNEVWTEAIKRAAAQLK |
| Ga0255186_10011117 | 3300024512 | Freshwater | MAKSTKKISVSDIAKLAKKIRKPNEKWTDAIKRASAQLK |
| Ga0255066_10319451 | 3300027131 | Freshwater | NMAKATKKISVADIAKLAKKIRKPNEKWTDAIKRAAAQLK |
| Ga0208974_100016438 | 3300027608 | Freshwater Lentic | MAKATKKVGVADIAKLAKKIRKPNEKWTDAIKRAAAQLK |
| Ga0208974_10718854 | 3300027608 | Freshwater Lentic | MAKSKKINVADISKLAKKIRKPNEAWTSAIKRASA |
| Ga0209085_12004472 | 3300027741 | Freshwater Lake | MATAKKKINVADIAKLAKKIRKDGEAWTAAIKRAAAQLKK |
| Ga0208304_101922211 | 3300027751 | Estuarine | KNKNKIMAKATKKVGVADIAKLAKKIRKPNEKWTDAIKRAAAQLK |
| Ga0209296_100051526 | 3300027759 | Freshwater Lake | MAKEVKKVSVADIAKLAKQIRRPNEKWTDAIKRAASQLKK |
| Ga0209088_100246165 | 3300027763 | Freshwater Lake | MAKETKKINVADISKLAKKIRKPNEAWTSAIKRAAKELKK |
| Ga0209829_104271031 | 3300027777 | Freshwater Lake | RSKIKSKYMATAKKKINVADIAKLAKKIRKDGEAWTAAIKRAAAQLKK |
| Ga0209500_100480094 | 3300027782 | Freshwater Lake | MANKKISVAEISKLAKKIRKPNEAWTAAIKRASAQLKKG |
| Ga0209480_100712266 | 3300027794 | Wastewater Effluent | MAKATTSKKIDVSSISALAKKIRKPNEEWRDAIKRAAAQLKKG |
| Ga0209229_102966622 | 3300027805 | Freshwater And Sediment | KATKKKISVSDIAKLAKKIRKPNERWTDAIKRASAQLK |
| Ga0209777_100603823 | 3300027896 | Freshwater Lake Sediment | MATSKPAKKISVSDIAKLAKKIRKEGEKWTDAIKRASSQLKG |
| Ga0316219_11516892 | 3300031759 | Freshwater | MAKSAKGGKVALISAHAKATRKPNEAWTKAIQRASKELKKLGKI |
| Ga0315288_103457173 | 3300031772 | Sediment | MAKVTKKKVGVAEISALAKKIRKANEKWTDAIKRASAALK |
| Ga0315909_100609242 | 3300031857 | Freshwater | MSKATKKVNVADIAKLAKKIRKPKEAWTDAIKRASAQLKKG |
| Ga0315909_101758155 | 3300031857 | Freshwater | MAKETKKKLSISEIAKLAKKIRKPDEKWVDALKRATAQLK |
| Ga0315909_107740243 | 3300031857 | Freshwater | MAKKISVAQISALAKKIRKPNEKWTDAIKRASAQLKKG |
| Ga0315906_113267973 | 3300032050 | Freshwater | MAKAKKISVSDIAKLAKKIRKPTEKWTDAIKRAAAQLK |
| Ga0315284_102846182 | 3300032053 | Sediment | MAMAKSTKKINVSDIAKLAKKIRKDGEKWTDAIKRASSQLKK |
| Ga0315905_115954083 | 3300032092 | Freshwater | MAKATKKKVGVAEISALAKKIRKADEKWTSAIKRAAAQLK |
| Ga0315902_106392882 | 3300032093 | Freshwater | MAKAMKVSVAEISKLAKKIRKPNEKWTDAIKRASAQLKKG |
| Ga0334980_0000759_2336_2467 | 3300033816 | Freshwater | MAKTIAKKKVNVADISALAKKIRKPNEAWTAAIKRAAAQIKKG |
| Ga0334980_0203590_427_546 | 3300033816 | Freshwater | MAKATKKISVADIAKLAKKIRKPDEKWTDAIKRASAQLK |
| Ga0334981_0281485_634_741 | 3300033980 | Freshwater | KITVAQISALAKKIRKPNEKWTDAIKRATAQLKKS |
| Ga0334992_0000419_34797_34919 | 3300033992 | Freshwater | MAKATKKKVGVAEISALAKKIRKPNEKWTDAIKRASAQLK |
| Ga0334979_0728775_121_237 | 3300033996 | Freshwater | MAKKITVAQISALAKKIRKPNEKWTEAIKRATAQLKRG |
| Ga0310130_0179899_158_277 | 3300034073 | Fracking Water | MATAKKKISVAEIAKLAKKIRKDGEKWTSAIKRAAAQLK |
| Ga0335027_0863766_2_112 | 3300034101 | Freshwater | TKKVSVADIAKLAKKIRKEGEKWTDAIKRAAAQLKK |
| Ga0335054_0260882_691_813 | 3300034119 | Freshwater | MAKATKKKVSVAEISALAKKIRKADEKWTDAIKRASAQLK |
| Ga0335007_0024830_370_492 | 3300034283 | Freshwater | MATAKKKINVAEIAKLAKKIRKDGEAWTSAIKRAAIALKK |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |