NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F059764

Metagenome Family F059764

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F059764
Family Type Metagenome
Number of Sequences 133
Average Sequence Length 44 residues
Representative Sequence MKRLQKLLIQLNPKIAEVRVESLIDNSFMNKLESSGFIQSLYKKN
Number of Associated Samples 116
Number of Associated Scaffolds 133

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 2.29 %
% of genes near scaffold ends (potentially truncated) 91.73 %
% of genes from short scaffolds (< 2000 bps) 88.72 %
Associated GOLD sequencing projects 111
AlphaFold2 3D model prediction Yes
3D model pTM-score0.39

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (87.218 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere
(7.519 % of family members)
Environment Ontology (ENVO) Unclassified
(34.586 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(39.098 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 45.21%    β-sheet: 0.00%    Coil/Unstructured: 54.79%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.39
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 133 Family Scaffolds
PF00890FAD_binding_2 56.39
PF02602HEM4 5.26
PF04343DUF488 2.26
PF03992ABM 2.26
PF01244Peptidase_M19 2.26
PF13020NOV_C 1.50
PF03401TctC 0.75
PF02211NHase_beta 0.75
PF13091PLDc_2 0.75
PF13273DUF4064 0.75
PF09992NAGPA 0.75
PF03795YCII 0.75
PF00491Arginase 0.75
PF09084NMT1 0.75
PF05168HEPN 0.75
PF10049DUF2283 0.75
PF13607Succ_CoA_lig 0.75
PF00498FHA 0.75
PF10012DUF2255 0.75
PF00329Complex1_30kDa 0.75
PF00884Sulfatase 0.75
PF13343SBP_bac_6 0.75

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 133 Family Scaffolds
COG1587Uroporphyrinogen-III synthaseCoenzyme transport and metabolism [H] 5.26
COG2355Zn-dependent dipeptidase, microsomal dipeptidase homologPosttranslational modification, protein turnover, chaperones [O] 2.26
COG3189Uncharacterized conserved protein YeaO, DUF488 familyFunction unknown [S] 2.26
COG0010Arginase/agmatinase family enzymeAmino acid transport and metabolism [E] 0.75
COG0715ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic componentInorganic ion transport and metabolism [P] 0.75
COG0852NADH:ubiquinone oxidoreductase 27 kD subunit (chain C)Energy production and conversion [C] 0.75
COG1895HEPN domain protein, predicted toxin of MNT-HEPN systemDefense mechanisms [V] 0.75
COG2250HEPN domain protein, predicted toxin of MNT-HEPN systemDefense mechanisms [V] 0.75
COG2350YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHisSecondary metabolites biosynthesis, transport and catabolism [Q] 0.75
COG3181Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctCEnergy production and conversion [C] 0.75
COG3262Ni,Fe-hydrogenase III component GEnergy production and conversion [C] 0.75
COG4521ABC-type taurine transport system, periplasmic componentInorganic ion transport and metabolism [P] 0.75


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms87.22 %
UnclassifiedrootN/A12.78 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000956|JGI10216J12902_100329610All Organisms → cellular organisms → Bacteria → Proteobacteria605Open in IMG/M
3300000956|JGI10216J12902_111751420All Organisms → cellular organisms → Bacteria → Acidobacteria1171Open in IMG/M
3300002503|C687J35164_10129036Not Available736Open in IMG/M
3300004633|Ga0066395_10530546All Organisms → cellular organisms → Bacteria682Open in IMG/M
3300005205|Ga0068999_10116102All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300005331|Ga0070670_101995979All Organisms → cellular organisms → Bacteria → Proteobacteria534Open in IMG/M
3300005335|Ga0070666_11145838All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300005336|Ga0070680_101495970All Organisms → cellular organisms → Bacteria585Open in IMG/M
3300005406|Ga0070703_10514863All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300005438|Ga0070701_11151820All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300005458|Ga0070681_10000542All Organisms → cellular organisms → Bacteria31061Open in IMG/M
3300005518|Ga0070699_100891419All Organisms → cellular organisms → Bacteria → Proteobacteria815Open in IMG/M
3300005536|Ga0070697_100664205All Organisms → cellular organisms → Bacteria → Proteobacteria918Open in IMG/M
3300005553|Ga0066695_10368394All Organisms → cellular organisms → Bacteria898Open in IMG/M
3300005559|Ga0066700_10164647All Organisms → cellular organisms → Bacteria → Proteobacteria1512Open in IMG/M
3300005563|Ga0068855_101109861All Organisms → cellular organisms → Bacteria826Open in IMG/M
3300005713|Ga0066905_101079262All Organisms → cellular organisms → Bacteria → Proteobacteria712Open in IMG/M
3300005836|Ga0074470_10050749All Organisms → cellular organisms → Bacteria2244Open in IMG/M
3300005981|Ga0081538_10189449All Organisms → cellular organisms → Bacteria866Open in IMG/M
3300006049|Ga0075417_10042358All Organisms → cellular organisms → Bacteria1935Open in IMG/M
3300006804|Ga0079221_11754227All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300006852|Ga0075433_11254594All Organisms → cellular organisms → Bacteria → Proteobacteria643Open in IMG/M
3300006854|Ga0075425_101286212All Organisms → cellular organisms → Bacteria830Open in IMG/M
3300009094|Ga0111539_12502912All Organisms → cellular organisms → Bacteria → Proteobacteria599Open in IMG/M
3300009100|Ga0075418_10207470All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae2086Open in IMG/M
3300009100|Ga0075418_11125603All Organisms → cellular organisms → Bacteria → Proteobacteria850Open in IMG/M
3300009101|Ga0105247_10408980All Organisms → cellular organisms → Bacteria969Open in IMG/M
3300009147|Ga0114129_11264515Not Available916Open in IMG/M
3300009147|Ga0114129_11691178All Organisms → cellular organisms → Bacteria772Open in IMG/M
3300009147|Ga0114129_13126743All Organisms → cellular organisms → Bacteria → Proteobacteria540Open in IMG/M
3300009168|Ga0105104_10289075All Organisms → cellular organisms → Bacteria900Open in IMG/M
3300009177|Ga0105248_11323881All Organisms → cellular organisms → Bacteria815Open in IMG/M
3300009551|Ga0105238_11684148Not Available665Open in IMG/M
3300010043|Ga0126380_11236997All Organisms → cellular organisms → Bacteria → Proteobacteria646Open in IMG/M
3300010371|Ga0134125_12746236All Organisms → cellular organisms → Bacteria → Proteobacteria535Open in IMG/M
3300010373|Ga0134128_10516518All Organisms → cellular organisms → Bacteria → Proteobacteria1331Open in IMG/M
3300010375|Ga0105239_10116615All Organisms → cellular organisms → Bacteria2963Open in IMG/M
3300010399|Ga0134127_12461966All Organisms → cellular organisms → Bacteria600Open in IMG/M
3300010401|Ga0134121_12166338All Organisms → cellular organisms → Bacteria → Proteobacteria592Open in IMG/M
3300010403|Ga0134123_10366822All Organisms → cellular organisms → Bacteria1307Open in IMG/M
3300010403|Ga0134123_11375903Not Available745Open in IMG/M
3300011403|Ga0137313_1110558All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300011432|Ga0137428_1255684Not Available517Open in IMG/M
3300011435|Ga0137426_1137642All Organisms → cellular organisms → Bacteria710Open in IMG/M
3300011440|Ga0137433_1246625All Organisms → cellular organisms → Bacteria583Open in IMG/M
3300011441|Ga0137452_1149667All Organisms → cellular organisms → Bacteria785Open in IMG/M
3300012157|Ga0137353_1041583All Organisms → cellular organisms → Bacteria821Open in IMG/M
3300012172|Ga0137320_1062385All Organisms → cellular organisms → Bacteria780Open in IMG/M
3300012210|Ga0137378_10650075All Organisms → cellular organisms → Bacteria → Proteobacteria965Open in IMG/M
3300012285|Ga0137370_10129319All Organisms → cellular organisms → Bacteria → Proteobacteria1446Open in IMG/M
3300012355|Ga0137369_11057083All Organisms → cellular organisms → Bacteria → Proteobacteria534Open in IMG/M
3300012474|Ga0157356_1024917All Organisms → cellular organisms → Bacteria → Proteobacteria516Open in IMG/M
3300012532|Ga0137373_10881069All Organisms → cellular organisms → Bacteria → Proteobacteria658Open in IMG/M
3300012922|Ga0137394_10424559All Organisms → cellular organisms → Bacteria1132Open in IMG/M
3300012944|Ga0137410_10527890All Organisms → cellular organisms → Bacteria968Open in IMG/M
3300012944|Ga0137410_11469204All Organisms → cellular organisms → Bacteria594Open in IMG/M
3300012948|Ga0126375_10258655All Organisms → cellular organisms → Bacteria1184Open in IMG/M
3300012955|Ga0164298_10006273All Organisms → cellular organisms → Bacteria4326Open in IMG/M
3300012971|Ga0126369_11873812All Organisms → cellular organisms → Bacteria → Proteobacteria688Open in IMG/M
3300012989|Ga0164305_10000115All Organisms → cellular organisms → Bacteria25579Open in IMG/M
3300013306|Ga0163162_10284963All Organisms → cellular organisms → Bacteria1784Open in IMG/M
3300013306|Ga0163162_12038287All Organisms → cellular organisms → Bacteria → Proteobacteria658Open in IMG/M
3300013308|Ga0157375_13184687All Organisms → cellular organisms → Bacteria → Proteobacteria547Open in IMG/M
3300015245|Ga0137409_11079545All Organisms → cellular organisms → Bacteria641Open in IMG/M
3300015371|Ga0132258_13960658All Organisms → cellular organisms → Bacteria1006Open in IMG/M
3300015372|Ga0132256_100069333All Organisms → cellular organisms → Bacteria3336Open in IMG/M
3300015372|Ga0132256_103713501All Organisms → cellular organisms → Bacteria → Proteobacteria513Open in IMG/M
3300015373|Ga0132257_102845342All Organisms → cellular organisms → Bacteria631Open in IMG/M
3300015374|Ga0132255_101773366All Organisms → cellular organisms → Bacteria → Proteobacteria937Open in IMG/M
3300016319|Ga0182033_11747951Not Available564Open in IMG/M
3300017927|Ga0187824_10039650All Organisms → cellular organisms → Bacteria → Proteobacteria1435Open in IMG/M
3300018053|Ga0184626_10267321All Organisms → cellular organisms → Bacteria715Open in IMG/M
3300018056|Ga0184623_10039284All Organisms → cellular organisms → Bacteria2147Open in IMG/M
3300018056|Ga0184623_10126828All Organisms → cellular organisms → Bacteria1180Open in IMG/M
3300018056|Ga0184623_10205507All Organisms → cellular organisms → Bacteria → Proteobacteria905Open in IMG/M
3300018076|Ga0184609_10060071All Organisms → cellular organisms → Bacteria1641Open in IMG/M
3300018082|Ga0184639_10308787All Organisms → cellular organisms → Bacteria830Open in IMG/M
3300018084|Ga0184629_10103171All Organisms → cellular organisms → Bacteria → Proteobacteria1397Open in IMG/M
3300018422|Ga0190265_10651318All Organisms → cellular organisms → Bacteria → Proteobacteria1174Open in IMG/M
3300018469|Ga0190270_12244885All Organisms → cellular organisms → Bacteria → Proteobacteria606Open in IMG/M
3300018469|Ga0190270_13345771All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300019879|Ga0193723_1122742All Organisms → cellular organisms → Bacteria719Open in IMG/M
3300019881|Ga0193707_1184669All Organisms → cellular organisms → Bacteria → Proteobacteria548Open in IMG/M
3300020195|Ga0163150_10383642All Organisms → cellular organisms → Bacteria → Proteobacteria654Open in IMG/M
3300021073|Ga0210378_10065410All Organisms → cellular organisms → Bacteria1427Open in IMG/M
3300021080|Ga0210382_10105574All Organisms → cellular organisms → Bacteria → Proteobacteria1177Open in IMG/M
3300021082|Ga0210380_10453676All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria587Open in IMG/M
3300021432|Ga0210384_10448417Not Available1162Open in IMG/M
3300022534|Ga0224452_1140759All Organisms → cellular organisms → Bacteria → Proteobacteria743Open in IMG/M
3300022563|Ga0212128_10537160All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium712Open in IMG/M
3300022694|Ga0222623_10426907All Organisms → cellular organisms → Bacteria → Proteobacteria503Open in IMG/M
3300025146|Ga0209322_10080517Not Available1522Open in IMG/M
3300025289|Ga0209002_10193294Not Available1262Open in IMG/M
3300025289|Ga0209002_10343412All Organisms → cellular organisms → Bacteria865Open in IMG/M
3300025289|Ga0209002_10553817Not Available627Open in IMG/M
3300025289|Ga0209002_10672878Not Available545Open in IMG/M
3300025313|Ga0209431_10503747All Organisms → cellular organisms → Bacteria921Open in IMG/M
3300025313|Ga0209431_10583071Not Available841Open in IMG/M
3300025326|Ga0209342_10078456Not Available3073Open in IMG/M
3300025796|Ga0210113_1017064All Organisms → cellular organisms → Bacteria1499Open in IMG/M
3300025903|Ga0207680_10422177All Organisms → cellular organisms → Bacteria → Proteobacteria944Open in IMG/M
3300025925|Ga0207650_11705626All Organisms → cellular organisms → Bacteria → Proteobacteria534Open in IMG/M
3300025931|Ga0207644_10906086All Organisms → cellular organisms → Bacteria739Open in IMG/M
3300025936|Ga0207670_10458314All Organisms → cellular organisms → Bacteria1029Open in IMG/M
3300025936|Ga0207670_10998372All Organisms → cellular organisms → Bacteria → Proteobacteria704Open in IMG/M
3300025953|Ga0210068_1075140All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300025971|Ga0210102_1005974All Organisms → cellular organisms → Bacteria2553Open in IMG/M
3300025981|Ga0207640_10549401All Organisms → cellular organisms → Bacteria → Proteobacteria970Open in IMG/M
3300026078|Ga0207702_10736014All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia973Open in IMG/M
3300026323|Ga0209472_1064294All Organisms → cellular organisms → Bacteria → Proteobacteria1531Open in IMG/M
3300027252|Ga0209973_1029094All Organisms → cellular organisms → Bacteria771Open in IMG/M
3300027765|Ga0209073_10524054All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300027778|Ga0209464_10079222All Organisms → cellular organisms → Bacteria1109Open in IMG/M
3300027909|Ga0209382_10052439All Organisms → cellular organisms → Bacteria4854Open in IMG/M
3300028145|Ga0247663_1114004All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300031720|Ga0307469_12455042All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300031858|Ga0310892_10069884All Organisms → cellular organisms → Bacteria1819Open in IMG/M
3300031890|Ga0306925_11027839All Organisms → cellular organisms → Bacteria → Proteobacteria838Open in IMG/M
3300031908|Ga0310900_11315561All Organisms → cellular organisms → Bacteria → Proteobacteria605Open in IMG/M
3300031949|Ga0214473_12410373Not Available501Open in IMG/M
3300031965|Ga0326597_10429513All Organisms → cellular organisms → Bacteria1460Open in IMG/M
3300032000|Ga0310903_10629908All Organisms → cellular organisms → Bacteria → Proteobacteria574Open in IMG/M
3300032174|Ga0307470_10912914All Organisms → cellular organisms → Bacteria691Open in IMG/M
3300032829|Ga0335070_10074158All Organisms → cellular organisms → Bacteria3644Open in IMG/M
3300033419|Ga0316601_101429827All Organisms → cellular organisms → Bacteria696Open in IMG/M
3300033475|Ga0310811_10726460All Organisms → cellular organisms → Bacteria952Open in IMG/M
3300033814|Ga0364930_0227309All Organisms → cellular organisms → Bacteria → Proteobacteria633Open in IMG/M
3300034147|Ga0364925_0330956All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria572Open in IMG/M
3300034176|Ga0364931_0246316All Organisms → cellular organisms → Bacteria → Proteobacteria587Open in IMG/M
3300034177|Ga0364932_0010682All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Bacillus → Bacillus tuaregi3456Open in IMG/M
3300034177|Ga0364932_0081861Not Available1224Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere7.52%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil6.77%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.02%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil5.26%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment5.26%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil4.51%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.76%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.76%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment3.76%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere3.76%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands3.01%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil3.01%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.01%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil3.01%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment2.26%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.26%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.26%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.26%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.50%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.50%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.50%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.50%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.50%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.50%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.50%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.50%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.50%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.50%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.50%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.50%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere1.50%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.75%
Freshwater Microbial MatEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat0.75%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment0.75%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.75%
Thermal SpringsEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs0.75%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)0.75%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil0.75%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.75%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.75%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.75%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere0.75%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.75%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300002503Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3EnvironmentalOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300005205Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleC_D2EnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005406Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaGEnvironmentalOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005836Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBBEnvironmentalOpen in IMG/M
3300005981Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1Host-AssociatedOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009168Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011403Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT166_2EnvironmentalOpen in IMG/M
3300011432Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT718_2EnvironmentalOpen in IMG/M
3300011435Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT660_2EnvironmentalOpen in IMG/M
3300011440Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT840_2EnvironmentalOpen in IMG/M
3300011441Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT513_2EnvironmentalOpen in IMG/M
3300012157Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT760_2EnvironmentalOpen in IMG/M
3300012172Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT366_2EnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012474Unplanted soil (control) microbial communities from North Carolina - M.Soil.3.yng.040610EnvironmentalOpen in IMG/M
3300012532Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300017927Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4EnvironmentalOpen in IMG/M
3300018053Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1EnvironmentalOpen in IMG/M
3300018056Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1EnvironmentalOpen in IMG/M
3300018064Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018076Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coexEnvironmentalOpen in IMG/M
3300018082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2EnvironmentalOpen in IMG/M
3300018084Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300019879Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2EnvironmentalOpen in IMG/M
3300019881Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2EnvironmentalOpen in IMG/M
3300020195Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.P2.IBEnvironmentalOpen in IMG/M
3300021073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redoEnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300021082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redoEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300022534Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1EnvironmentalOpen in IMG/M
3300022563OV2_combined assemblyEnvironmentalOpen in IMG/M
3300022694Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coexEnvironmentalOpen in IMG/M
3300025146Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 1EnvironmentalOpen in IMG/M
3300025289Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 2EnvironmentalOpen in IMG/M
3300025313Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes)EnvironmentalOpen in IMG/M
3300025326Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_2 (SPAdes)EnvironmentalOpen in IMG/M
3300025796Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025953Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025971Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes)EnvironmentalOpen in IMG/M
3300027252Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027765Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027778Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028145Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK04EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031944Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1EnvironmentalOpen in IMG/M
3300031949Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197EnvironmentalOpen in IMG/M
3300031965Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185EnvironmentalOpen in IMG/M
3300032000Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300033419Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCTEnvironmentalOpen in IMG/M
3300033475Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YCEnvironmentalOpen in IMG/M
3300033814Sediment microbial communities from East River floodplain, Colorado, United States - 55_j17EnvironmentalOpen in IMG/M
3300034147Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17EnvironmentalOpen in IMG/M
3300034176Sediment microbial communities from East River floodplain, Colorado, United States - 21_j17EnvironmentalOpen in IMG/M
3300034177Sediment microbial communities from East River floodplain, Colorado, United States - 17_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI10216J12902_10032961013300000956SoilTSVEGMKRLQKLLIQLNPKIADVRVETLIDNSFMNRLESSGFIQNLYKKNL*
JGI10216J12902_11175142023300000956SoilVEGMKRLQKLMAQITPKIADARVETVVDNSFMNKLESSGYIQSLYKKNEVPR*
C687J35164_1012903613300002503SoilKRLHRLLIQVNPKVADVKVESVIDNSFISKLESSGYIQGVYKKK*
Ga0066395_1053054613300004633Tropical Forest SoilPTPSLDGMKRLQRLLTHVNPKVSEVKVENVIDSSFMNKLESSGFIQTVYKRN*
Ga0068999_1011610223300005205Natural And Restored WetlandsLLIQLNPKIADVRVETLLDNSFMNKLESSGFIQGLYKKN*
Ga0070670_10199597913300005331Switchgrass RhizosphereMKRLHKLMTQITPGIGDVRVENVIDNSFMNKLETSGYIQSFYKKN*
Ga0070666_1114583823300005335Switchgrass RhizosphereLQRLLTHVNPKVSEVKVESVIDSSFMNKLESSGFIQSVYKKN*
Ga0070680_10149597023300005336Corn RhizosphereTSVEGMKRLQKLMAQITPKIADVRVETVVDTSFMNKLESSGYIQSLYKKN*
Ga0070703_1051486323300005406Corn, Switchgrass And Miscanthus RhizosphereLMAQITPKLADVRVETAVDSSFMNKLESSGYIQSLYKKN*
Ga0070701_1115182023300005438Corn, Switchgrass And Miscanthus RhizosphereLHKLMTQINPKIADVRVENAIDNSFMNKLETSGFIQSVSKRN*
Ga0070681_10000542373300005458Corn RhizosphereKRLQRLLTHVNPKVSEVKVESVIDSSFMNKLESSGFIQNVYKKN*
Ga0070699_10089141923300005518Corn, Switchgrass And Miscanthus RhizosphereSVEGMKRLQKLLTQLNPKIAEVRVETLIDNSFMNKLESSGFIESLYKKN*
Ga0070697_10066420533300005536Corn, Switchgrass And Miscanthus RhizosphereHKLMTQITPGIGDVRVENVIDNSFMNKLETSGYIQSFYKKN*
Ga0066695_1036839423300005553SoilTLEGMKRLQKLLIQLNPKIAEVRVESLIDNSFMNKLESSGFIQSLYKKN*
Ga0066700_1016464723300005559SoilISLDGMKRLHKLLTQINAKVADVRVENVIDTSFMNRLESTGYIQNLYKKN*
Ga0068855_10110986123300005563Corn RhizosphereHVNPKVSEVKVESVIDSSFMNKLESSGFIQNVYKKN*
Ga0066905_10107926213300005713Tropical Forest SoilMKKLQRLLAQINPKIAEVRVENVIDNSFMNKLESSGFIQSVYKKN*
Ga0074470_1005074913300005836Sediment (Intertidal)LLVQFNPKIADVRVETLIDNSLMNKLESSGFIQGLYKKN*
Ga0081538_1018944913300005981Tabebuia Heterophylla RhizosphereISLEAMKRLQGLLIQINPKIAEVRVENVIDNSFMNKLESSGYIQSVYKKQ*
Ga0075417_1004235813300006049Populus RhizosphereSLEGMKRLQVLLTQINPKIAEVRVENVIDNSFMNKLERSGYIQSVYKKH*
Ga0079221_1175422723300006804Agricultural SoilRLLTHVNPKVSEVKVESVVDSSFMNKLESSGFIQSVYKKN*
Ga0075433_1125459413300006852Populus RhizosphereNPKIAEVRVETLIDNSFMNRLESSGFIQSLYKKH*
Ga0075425_10128621223300006854Populus RhizosphereERVPQTSLEGMKRLQKLMLQINPKMGDVRVESVIDNSFMNKLESSGFIQSVYKRN*
Ga0111539_1250291213300009094Populus RhizosphereRAPHTSLEGMKRLQVLLTQINPKIAEVRVENVIDNSFMNKLERSGYIQSVYKKH*
Ga0075418_1020747033300009100Populus RhizosphereKRLQVLLTQINPKIAEVRVENVIDTSFMNKLENSGYIQSVYKKH*
Ga0075418_1112560313300009100Populus RhizosphereKRLQKLLIQLNPKIAEVRVETLIDNSFMNKLESSGFIQRLYKKN*
Ga0105247_1040898023300009101Switchgrass RhizosphereLQTLMAQITPKLADVRVETAVDSSFMNKLESSGYIQSLYKKN*
Ga0114129_1126451513300009147Populus RhizosphereLQKLLMQINPKMGDVRVENVLDNSFMNKLESSGYIQSVYKKN*
Ga0114129_1169117813300009147Populus RhizosphereLLIQLNPKIAEVRVESLIDNSFMNKLESSGFIQGLYKKN*
Ga0114129_1312674323300009147Populus RhizosphereEGMKRLQVLLTQINPKIADVRVENLIDNSFMSKLESSGYIQSVYKK*
Ga0105104_1028907513300009168Freshwater SedimentKLLMQINPKMGDVRVENVIENSFMNKLETSGYIQSVYKKN*
Ga0105248_1132388113300009177Switchgrass RhizosphereLMAQITPKLADVRVETAVDTSFMNKLESSGYIQSLYKKN*
Ga0105238_1168414823300009551Corn RhizosphereMKRLQRLLTHVNPKVSEVKVESVIDSSFMNKLESSGFIQNVYKKN*
Ga0126380_1123699723300010043Tropical Forest SoilGLLVQINPKIAEVRVENLIDSSFMNKIESSGYIQSVYKKH*
Ga0134125_1274623613300010371Terrestrial SoilKLLIQLNPKIAEVRVESLIDNSFMNKLESSGFIQSLYKKN*
Ga0134128_1051651823300010373Terrestrial SoilQKLLIQLNPKIAEVRVESLIDNSFMNKLESSGFIQSLYKKN*
Ga0105239_1011661543300010375Corn RhizosphereVNPKVSEVKVESVIDSSFMNKLESSGFIQSVYKKN*
Ga0134127_1246196623300010399Terrestrial SoilLHKLMTQINPKIADVRVENAIDNSFMNKLETSGYIDSFYKKN*
Ga0134121_1216633823300010401Terrestrial SoilQLNPKIAEVRVESLIDNSFMNKLESSGFIQSLYKKN*
Ga0134123_1036682213300010403Terrestrial SoilTLMAQITPKLADVRVETAVDTSFMNKLESSGYMQRLYKKN*
Ga0134123_1137590313300010403Terrestrial SoilGMKRLHKLMTQITPKLADVRVENTVDPSFMNKLEASGYIQSLYKKN*
Ga0137313_111055813300011403SoilLLIQLNPKIADVRVETLIDNSFMNKLESSGFIQGLYKKN*
Ga0137428_125568413300011432SoilLHKLLTQLNPKMADVRVENCIDNSFMNKLESSGFIQSVYKKN*
Ga0137426_113764223300011435SoilLHKLLLQINPKMGDVRVENVIDNSFMNKLETSGYIQSVYKKN*
Ga0137433_124662523300011440SoilEGMKRLQKILAQINPKISEVRVENIIDSSFMNRLESSGFIQNLYKK*
Ga0137452_114966713300011441SoilGMKRLQKLLIQLNPKIADVRVETLIDNSFMNKLESSGFIQGLYKKN*
Ga0137353_104158313300012157SoilQKILAQINPKISEVRVENIIDSSFMNRLESSGFIQSLYKK*
Ga0137320_106238513300012172SoilQLNPKIADVRVETLIDNSFMNKLESSGFIQGLYKKN*
Ga0137378_1065007523300012210Vadose Zone SoilEGMKRLQKLLIQLNPKISEVRVETLIDNSFMNRLESSGFIQSLYKKN*
Ga0137370_1012931923300012285Vadose Zone SoilRAPHTTIEGMKRLQKLLIQLNPKIAEVRVETLIDNSFMNKLESSGFIQNLYKKN*
Ga0137369_1105708323300012355Vadose Zone SoilQKLLIQLNPKIAEVRVETLIDDSFMNRLESSGFIQSLYKKN*
Ga0157356_102491713300012474Unplanted SoilTTIEGMKRLQKLLIQLNPKIAEVRVETLIDNSFMNKLESSGFIQRLYKKN*
Ga0137373_1088106913300012532Vadose Zone SoilKRLQKLLIQLNPKIAEVRVETLIDNSFMNRLESSGFIQSLYKKN*
Ga0137394_1042455913300012922Vadose Zone SoilRLQKLLIQLNPKIAEVRVETLIDNSFMNKLESSGFIKSLYKKN*
Ga0137410_1052789023300012944Vadose Zone SoilKRLHKLMTQINPKIADVRVENAIDNSFMNKLETSGFIQSVSKKN*
Ga0137410_1146920413300012944Vadose Zone SoilNPKIVEVRVETLIDNSFMNKLESSGFIQSLYKKN*
Ga0126375_1025865523300012948Tropical Forest SoilMKRLQGLLVQINPKIADVRVENLIDSSFMNRIESSGYIQSVYKKH*
Ga0164298_1000627363300012955SoilMAQITPKIADVRVETVVDTSFMNKLESSGYIQSLYKKN*
Ga0126369_1187381213300012971Tropical Forest SoilPSLDGMKRLQRLLTHVNPKVSEVKVENVIDSSFMNKLESSGFIQTVYKRN*
Ga0164305_1000011513300012989SoilHVNPKVSEVKVESVIDSSFMNKLESSGFIQSVYKKN*
Ga0163162_1028496333300013306Switchgrass RhizosphereGMKRLHKLMTQINPKIADVRVENAIDNSFMNKLETSGFIQSVSKRN*
Ga0163162_1203828723300013306Switchgrass RhizosphereDGMKRLQRLLTHVNPKVSEVKVESVIDSSFMNKLESSGFIQNVYKKN*
Ga0157375_1318468723300013308Miscanthus RhizosphereIEGMKRLQKLLIQLNPKIAEVRVETLIDNSFMNKLESSGFIQSLYKKN*
Ga0137409_1107954513300015245Vadose Zone SoilTTLEGMKRLQKLLIQLNPKIAEVRVESLIDNSFMNKLESSGFIQSLYKKN*
Ga0132258_1396065823300015371Arabidopsis RhizosphereAQITPKIADVRVETVVDTSFMNKLESSGYIQSLYKKN*
Ga0132256_10006933363300015372Arabidopsis RhizosphereNSFERVPTPNLDGMKRLQRLLTHVNPKVSEVKVESVIDSSFMNKLESSGFIQSVYKKN*
Ga0132256_10371350113300015372Arabidopsis RhizosphereMKRLQRLLAQVNPKVSEVKVENVIDSSFMNKLESSGFMQSVYKKN*
Ga0132257_10284534213300015373Arabidopsis RhizosphereGMKRLHKLMTQINPKIADVRVENAIDNSFMNKLETSGFIQSVSKKN*
Ga0132255_10177336613300015374Arabidopsis RhizosphereMKRLQRLLTHVNPKVAEVKVESVIDSSFMNKLESSGFIQSVYKKN*
Ga0182033_1174795123300016319SoilMKRLQKLMTQINPKMGDVRVENIIDNSFMNKLESSGYIQSVYKKN
Ga0187824_1003965013300017927Freshwater SedimentMKRLHGLLSTINPKVKDVRVESVIDNSFISRLDQSGFVQSVWKK
Ga0184626_1026732123300018053Groundwater SedimentHTNLEGMKRLHKLLTQINPKIADVRIENTIDNSFMNKLETSGYIQSVYKKN
Ga0184623_1003928433300018056Groundwater SedimentMKRLHKLLIQINPKVTDVRVENVIDTSFMNKLDSSGFIQSVYKKH
Ga0184623_1012682823300018056Groundwater SedimentNQLNLKIADVRVETLIDNSFMNKLASSGFIQSLYKKN
Ga0184623_1020550713300018056Groundwater SedimentEGMKRLHKLLVQINPKVADVRVENVIDPSFMNRLESSGYIQSLYKKN
Ga0187773_1059365313300018064Tropical PeatlandYERVPHINLEGMKRLQKLLTQINPKMGDVRVENVIDDSFMNKLESSGYIQSVYRKN
Ga0184609_1006007123300018076Groundwater SedimentEGMKRLQKLLIQLNPKIAEVRVETLIDDSFMNRLESSGFIQGLYKKN
Ga0184639_1030878713300018082Groundwater SedimentRLQKLLVQLNPKIAEVRVENLLDSSFMNKLESSGFIQGLYKKN
Ga0184629_1010317113300018084Groundwater SedimentIQLNPKIADVRVETLLDNSFMNKLESSGFIQGLYKKN
Ga0190265_1065131823300018422SoilMKRLQKLLIQLNPKIAEVRVESLIDNSFMNKLESSGFIQSLYKKN
Ga0190270_1224488513300018469SoilIQLNPKIAEVRVENLIDNSFMNKLESSGFIQGLYKKN
Ga0190270_1334577123300018469SoilLNPKIADVRVETLLDNSFMNKLESSGFIQGLYKKN
Ga0193723_112274213300019879SoilLNPKIVEVRVETLIDNSFMNKLESSGFIRSLYKKN
Ga0193707_118466913300019881SoilRLHKLMTQITPGIGDVRVENVIDNSFMNKLETSGYIQSFYKKN
Ga0163150_1038364223300020195Freshwater Microbial MatHISMEGMKRLQKLLTQLNPKIADVRVETLIDNSFMNKLESSGFIQGLYKKN
Ga0210378_1006541023300021073Groundwater SedimentEGMKRLHKLLTQINPKIADARIENTIDNSFMNKLETSGYIQSVYKKN
Ga0210382_1010557423300021080Groundwater SedimentVEGMKRLQKLLIQLNPKIAEVRVETLIDDSFMNRLESSGFIQSLYKKN
Ga0210380_1045367613300021082Groundwater SedimentMKRLHKLMTQINSKIADVRVENAVDNSFMNKLEAAGFIQSIYKKN
Ga0210384_1044841713300021432SoilQINPKMGDVRVENVIDNTFMNKLESSGFIQSVYKKN
Ga0224452_114075913300022534Groundwater SedimentSVEGMKRLQKLLIQLNPKIAEVRVETLIDDSFMNRLESSGFIQGLYKKN
Ga0212128_1053716023300022563Thermal SpringsERAPHTSPEGMKRLHRLLIQINPKVADVRIETVVDNSFMNKLESSGFIQSVYKKH
Ga0222623_1042690713300022694Groundwater SedimentVEGMKRLQKLLIQLNPKIAEVRVETLIDDSFMNRLESSGFIQGLYKKN
Ga0209322_1008051753300025146SoilVPYSNLENMKRLHRLLIQVNPKVADVKVESVIDNSFISKLESSGYIQSVYKKR
Ga0209002_1019329453300025289SoilIQVNPKVADVKVESVIDNSFISKLESSGYIQSVYKKR
Ga0209002_1034341213300025289SoilLLIQVNPKVADVKVESVIDNSFISKLENSGYVQSVYKKK
Ga0209002_1055381713300025289SoilRLHQLLIQVNPKVADVKVESVIDNSFISKLESSGYVQSVYKKK
Ga0209002_1067287813300025289SoilNLENMKRLHRLLIQVNPKVADVKVESVIDNSFISKLESSGYIQGVYKKK
Ga0209431_1050374713300025313SoilKRLHRLLIQVNPKVADVKVESVIDNSFISKLENSGYVQSVYKKK
Ga0209431_1058307113300025313SoilKRLHRLLIQVNPKVADVKVESVIDNSFISKLESSGYIQGVYKKK
Ga0209342_1007845613300025326SoilLENMKRLHRLLIQVNPKVVDVKVESVIDNSFISKLERSGYIQSVYKKR
Ga0210113_101706413300025796Natural And Restored WetlandsSLQGMQRLQKILAQSNPKISEVRVENTIDNSVMERLENSGFIQSAYRKN
Ga0207680_1042217723300025903Switchgrass RhizosphereFERVPSPSLDGMKRLQRLLTHVNPKVSEVKVESVIDSSFMNKLESSGFIQNVYKKN
Ga0207650_1170562623300025925Switchgrass RhizosphereMKRLHKLMTQITPGIGDVRVENVIDNSFMNKLETSGYIQSFYKKN
Ga0207644_1090608623300025931Switchgrass RhizosphereMAQITPKIADVRVETVVDTSFMNKLESSGYIQSLYKKN
Ga0207670_1045831413300025936Switchgrass RhizosphereQKLLTQQNPKIAEVRVETLIDAAPMNKLESSGFIHSLYKK
Ga0207670_1099837213300025936Switchgrass RhizosphereQKLLIQLNPKIAEVRVESLIDNSFMNKLESSGFIQSLYKKN
Ga0210068_107514023300025953Natural And Restored WetlandsLLVQVNPKVADVRIEGVIENSFINKLESSGYIQSVYKKN
Ga0210102_100597413300025971Natural And Restored WetlandsQVNPKVADVRIDGVIENSFINKLESSGYIQSVYKKN
Ga0207640_1054940113300025981Corn RhizosphereSLDGMKRLQRLLTHVNPKVSEVKVESVIDSSFMNKLESSGFIQSVYKKN
Ga0207702_1073601413300026078Corn RhizosphereDGMKRLQRLLTHVNPKVSEVKVESVIDSSFMNKLESSGFIQSVYKKN
Ga0209472_106429423300026323SoilHKLLTQINAKVADVRVENVIDTSFMNRLESTGYIQNLYKKN
Ga0209973_102909413300027252Arabidopsis Thaliana RhizosphereGMKRLQKLMAQLNPKVAEVRVENLIDSSFMNKLESSGYIQNVYKKH
Ga0209073_1052405413300027765Agricultural SoilAPHTSVAGMKRLQTLMAQITPKLADVRVETAVDTSFMNKLESSGYIQSLYKKN
Ga0209464_1007922213300027778Wetland SedimentRVPYSQLESMKRLHQLLVQINPKVADVRVESVIDNSILNRLESSGYIQSVYKKN
Ga0209382_1005243953300027909Populus RhizosphereAPHTSLEGMKRLQVLLTQINPKIAEVRVENVIDNSFMNKLERSGYIQSVYKKH
Ga0247663_111400423300028145SoilLNPNIADVRVENVIDNSFMNKLESSGYIQSVYKKN
Ga0307469_1245504213300031720Hardwood Forest SoilMVQINPKMGDVRVENVIDNSFMNKLESSGFIQSVYRKN
Ga0310892_1006988413300031858SoilLDGMKRLQRLLTHVNPKVSEVKVESVVDSSFMNKLESSGFIQSVYKKN
Ga0306925_1102783913300031890SoilTPSLDGMKRLQRLLTHVNPKVSEVKVENVIDSSFMNKLESSGFIQSVYKRN
Ga0310900_1131556123300031908SoilIQLNPKIAEVRVESLIDNSFMNKLESSGFIQSLYKKN
Ga0310884_1102008723300031944SoilERAPHTNVEGMKRLHKLMTQINPKIADVRVENAIDNSFMNKLETSGFIQSVSKKN
Ga0214473_1241037313300031949SoilENMKRLHQLLIQVNPKVADVKVESVIDNSFISRLESSGYIQSVYKKK
Ga0326597_1042951313300031965SoilHTTLEGMKRLQKILTQINPKISEVRVENIIDSSFMNKLESSGFMQSLNKK
Ga0310903_1062990813300032000SoilHTTLEGMKRLQKLLIQLNPKIAEVRVENLIDNSFMNKLESSGFIQGLYKKN
Ga0307470_1091291433300032174Hardwood Forest SoilKRLQKLLIQINPKMGDVRVENVIDNSFMNKLENSGFIQSVYRKN
Ga0335070_1007415833300032829SoilMSRLHQLLLQINPKVSDVRVEAVIDNSFINKLETSGYLQPLYKRN
Ga0316601_10142982713300033419SoilMKRLQKLLTQLNPKIAEVRVETLIDSSFMNKLESSGFIQGLYKKN
Ga0310811_1072646023300033475SoilEGMKRLQRLLAQINPKVAEVRIESVIDNSFMNKLENSGFIQAAYKKN
Ga0364930_0227309_12_1463300033814SedimentMKRLQKILAQINPKISEVRVENVIDSSFMNRLESSGFMQSLYKK
Ga0364925_0330956_3_1343300034147SedimentRLHKLITQINTKIADVRVENAVDNSFMNKLEAAGFIQSIYKKN
Ga0364931_0246316_431_5683300034176SedimentMKRLQVLLTQINPKIAEVRVENVIDNSFMNKLESSGYIQSVYKKH
Ga0364932_0010682_2_1363300034177SedimentKRLHRLLIQVNPKVADVRVESVIDNSFISKLENSGYIQSVYKKR
Ga0364932_0081861_26_1633300034177SedimentMKRLHRLLIQVNPNVADVRVESVIDNSFISKLESSGYIQSVYKKK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.