Basic Information | |
---|---|
Family ID | F059443 |
Family Type | Metagenome |
Number of Sequences | 134 |
Average Sequence Length | 42 residues |
Representative Sequence | GSANISAAPGTNTVTTLPAPAGGCKVATFTVSGTLTVS |
Number of Associated Samples | 120 |
Number of Associated Scaffolds | 134 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 3.08 % |
% of genes near scaffold ends (potentially truncated) | 94.78 % |
% of genes from short scaffolds (< 2000 bps) | 92.54 % |
Associated GOLD sequencing projects | 114 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.48 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (54.478 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (19.403 % of family members) |
Environment Ontology (ENVO) | Unclassified (49.254 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (55.224 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 33.33% Coil/Unstructured: 66.67% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 134 Family Scaffolds |
---|---|---|
PF13640 | 2OG-FeII_Oxy_3 | 23.13 |
PF02945 | Endonuclease_7 | 5.97 |
PF13661 | 2OG-FeII_Oxy_4 | 2.24 |
PF13759 | 2OG-FeII_Oxy_5 | 1.49 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 61.94 % |
Unclassified | root | N/A | 38.06 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001450|JGI24006J15134_10201501 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 606 | Open in IMG/M |
3300001460|JGI24003J15210_10153264 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 587 | Open in IMG/M |
3300002511|JGI25131J35506_1040175 | Not Available | 647 | Open in IMG/M |
3300002930|Water_102378 | All Organisms → cellular organisms → Bacteria | 3256 | Open in IMG/M |
3300003393|JGI25909J50240_1116953 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 526 | Open in IMG/M |
3300005517|Ga0070374_10323967 | Not Available | 780 | Open in IMG/M |
3300005581|Ga0049081_10117454 | Not Available | 985 | Open in IMG/M |
3300005581|Ga0049081_10315923 | Not Available | 536 | Open in IMG/M |
3300005913|Ga0075108_10174471 | Not Available | 757 | Open in IMG/M |
3300005913|Ga0075108_10249300 | Not Available | 601 | Open in IMG/M |
3300006805|Ga0075464_10123714 | All Organisms → cellular organisms → Bacteria | 1504 | Open in IMG/M |
3300006869|Ga0075477_10164659 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 921 | Open in IMG/M |
3300006921|Ga0098060_1122450 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 729 | Open in IMG/M |
3300006924|Ga0098051_1032847 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1466 | Open in IMG/M |
3300006925|Ga0098050_1189825 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 512 | Open in IMG/M |
3300006929|Ga0098036_1066931 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1109 | Open in IMG/M |
3300006990|Ga0098046_1140738 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 519 | Open in IMG/M |
3300007074|Ga0075110_1092087 | Not Available | 644 | Open in IMG/M |
3300007640|Ga0070751_1180579 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 829 | Open in IMG/M |
3300007973|Ga0105746_1080146 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 1055 | Open in IMG/M |
3300008220|Ga0114910_1094239 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 898 | Open in IMG/M |
3300008266|Ga0114363_1140445 | Not Available | 813 | Open in IMG/M |
3300008450|Ga0114880_1147129 | Not Available | 852 | Open in IMG/M |
3300009071|Ga0115566_10587127 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 625 | Open in IMG/M |
3300009076|Ga0115550_1179247 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 724 | Open in IMG/M |
3300009077|Ga0115552_1425998 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 522 | Open in IMG/M |
3300009152|Ga0114980_10064625 | All Organisms → cellular organisms → Bacteria | 2208 | Open in IMG/M |
3300009152|Ga0114980_10180297 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 1245 | Open in IMG/M |
3300009155|Ga0114968_10118040 | Not Available | 1604 | Open in IMG/M |
3300009155|Ga0114968_10375295 | Not Available | 780 | Open in IMG/M |
3300009160|Ga0114981_10135657 | Not Available | 1361 | Open in IMG/M |
3300009161|Ga0114966_10101584 | Not Available | 1933 | Open in IMG/M |
3300009438|Ga0115559_1211176 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 698 | Open in IMG/M |
3300009507|Ga0115572_10620132 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 595 | Open in IMG/M |
3300009508|Ga0115567_10209867 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1255 | Open in IMG/M |
3300009508|Ga0115567_10525820 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 718 | Open in IMG/M |
3300009601|Ga0114914_1074509 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 518 | Open in IMG/M |
3300009785|Ga0115001_10861038 | Not Available | 545 | Open in IMG/M |
3300010299|Ga0129342_1215323 | Not Available | 678 | Open in IMG/M |
3300010430|Ga0118733_108747413 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 522 | Open in IMG/M |
3300011011|Ga0139556_1028373 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 819 | Open in IMG/M |
3300011252|Ga0151674_1032994 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 538 | Open in IMG/M |
3300012282|Ga0157136_1005248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 845 | Open in IMG/M |
3300012920|Ga0160423_11151548 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 518 | Open in IMG/M |
3300012952|Ga0163180_11285165 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 601 | Open in IMG/M |
3300013115|Ga0171651_1049004 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1341 | Open in IMG/M |
(restricted) 3300013125|Ga0172369_10297947 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 855 | Open in IMG/M |
(restricted) 3300013133|Ga0172362_10410075 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 941 | Open in IMG/M |
(restricted) 3300013136|Ga0172370_10466565 | Not Available | 677 | Open in IMG/M |
3300017714|Ga0181412_1085394 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 755 | Open in IMG/M |
3300017725|Ga0181398_1170956 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 513 | Open in IMG/M |
3300017728|Ga0181419_1079713 | Not Available | 820 | Open in IMG/M |
3300017737|Ga0187218_1140265 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 573 | Open in IMG/M |
3300017740|Ga0181418_1081963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 787 | Open in IMG/M |
3300017761|Ga0181356_1173219 | Not Available | 655 | Open in IMG/M |
3300017767|Ga0181406_1033914 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1596 | Open in IMG/M |
3300017768|Ga0187220_1029574 | All Organisms → Viruses → Predicted Viral | 1649 | Open in IMG/M |
3300017774|Ga0181358_1111977 | Not Available | 968 | Open in IMG/M |
3300017774|Ga0181358_1137366 | Not Available | 846 | Open in IMG/M |
3300017774|Ga0181358_1238261 | Not Available | 577 | Open in IMG/M |
3300017781|Ga0181423_1213133 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 729 | Open in IMG/M |
3300017962|Ga0181581_10281631 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1073 | Open in IMG/M |
3300017962|Ga0181581_10877933 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 530 | Open in IMG/M |
3300018416|Ga0181553_10244839 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 1018 | Open in IMG/M |
3300019784|Ga0181359_1066380 | Not Available | 1372 | Open in IMG/M |
3300020141|Ga0211732_1269934 | Not Available | 1057 | Open in IMG/M |
3300020175|Ga0206124_10218212 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 748 | Open in IMG/M |
3300020409|Ga0211472_10468078 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 506 | Open in IMG/M |
3300020438|Ga0211576_10462373 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 644 | Open in IMG/M |
3300020560|Ga0208852_1063942 | Not Available | 589 | Open in IMG/M |
3300021959|Ga0222716_10315230 | Not Available | 939 | Open in IMG/M |
3300021961|Ga0222714_10230853 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 1049 | Open in IMG/M |
3300021961|Ga0222714_10553433 | Not Available | 582 | Open in IMG/M |
3300021962|Ga0222713_10017020 | All Organisms → Viruses | 6229 | Open in IMG/M |
3300022074|Ga0224906_1129633 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 724 | Open in IMG/M |
3300022190|Ga0181354_1046457 | Not Available | 1443 | Open in IMG/M |
3300022190|Ga0181354_1169152 | Not Available | 672 | Open in IMG/M |
3300022407|Ga0181351_1066144 | Not Available | 1474 | Open in IMG/M |
3300022842|Ga0222632_1050359 | Not Available | 621 | Open in IMG/M |
3300022929|Ga0255752_10390713 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 552 | Open in IMG/M |
3300023179|Ga0214923_10274202 | Not Available | 934 | Open in IMG/M |
3300023184|Ga0214919_10368228 | Not Available | 949 | Open in IMG/M |
3300023235|Ga0222634_1017162 | All Organisms → Viruses | 1304 | Open in IMG/M |
3300023235|Ga0222634_1021478 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1116 | Open in IMG/M |
(restricted) 3300024261|Ga0233439_10191386 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 944 | Open in IMG/M |
3300025069|Ga0207887_1084747 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 515 | Open in IMG/M |
3300025079|Ga0207890_1056316 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 655 | Open in IMG/M |
3300025098|Ga0208434_1110656 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 527 | Open in IMG/M |
3300025101|Ga0208159_1099534 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 519 | Open in IMG/M |
3300025110|Ga0208158_1101428 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 675 | Open in IMG/M |
3300025110|Ga0208158_1142428 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 547 | Open in IMG/M |
3300025112|Ga0209349_1167318 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 581 | Open in IMG/M |
3300025120|Ga0209535_1045421 | All Organisms → Viruses | 1921 | Open in IMG/M |
3300025120|Ga0209535_1216544 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 520 | Open in IMG/M |
3300025125|Ga0209644_1051294 | Not Available | 944 | Open in IMG/M |
3300025127|Ga0209348_1028870 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2005 | Open in IMG/M |
3300025132|Ga0209232_1256422 | Not Available | 502 | Open in IMG/M |
3300025137|Ga0209336_10163417 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 579 | Open in IMG/M |
3300025138|Ga0209634_1099542 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1289 | Open in IMG/M |
3300025141|Ga0209756_1166862 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 871 | Open in IMG/M |
3300025141|Ga0209756_1244180 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 662 | Open in IMG/M |
3300025645|Ga0208643_1045471 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1372 | Open in IMG/M |
3300025674|Ga0208162_1184283 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 543 | Open in IMG/M |
3300025707|Ga0209667_1113618 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 845 | Open in IMG/M |
3300025759|Ga0208899_1149138 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 802 | Open in IMG/M |
3300025830|Ga0209832_1194022 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 572 | Open in IMG/M |
3300025881|Ga0209309_10240415 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 848 | Open in IMG/M |
3300025886|Ga0209632_10198138 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1063 | Open in IMG/M |
3300025897|Ga0209425_10069881 | All Organisms → Viruses → Predicted Viral | 2211 | Open in IMG/M |
3300026138|Ga0209951_1027463 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 1254 | Open in IMG/M |
3300027292|Ga0255134_1079099 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 511 | Open in IMG/M |
3300027621|Ga0208951_1108360 | Not Available | 752 | Open in IMG/M |
3300027659|Ga0208975_1181755 | Not Available | 571 | Open in IMG/M |
3300027734|Ga0209087_1295817 | Not Available | 579 | Open in IMG/M |
3300027770|Ga0209086_10122560 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 1296 | Open in IMG/M |
3300027892|Ga0209550_10348045 | Not Available | 935 | Open in IMG/M |
3300028394|Ga0304730_1063832 | All Organisms → Viruses | 1726 | Open in IMG/M |
3300029930|Ga0119944_1022824 | Not Available | 842 | Open in IMG/M |
3300031510|Ga0308010_1283635 | Not Available | 572 | Open in IMG/M |
3300031578|Ga0307376_10895310 | Not Available | 541 | Open in IMG/M |
3300031655|Ga0308018_10188877 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 700 | Open in IMG/M |
3300031857|Ga0315909_10104816 | All Organisms → Viruses | 2428 | Open in IMG/M |
3300032046|Ga0315289_10412175 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Spirosoma → Spirosoma oryzae | 1338 | Open in IMG/M |
3300032053|Ga0315284_10638079 | Not Available | 1263 | Open in IMG/M |
3300033742|Ga0314858_184961 | Not Available | 535 | Open in IMG/M |
3300034082|Ga0335020_0097022 | Not Available | 1505 | Open in IMG/M |
3300034112|Ga0335066_0547704 | Not Available | 606 | Open in IMG/M |
3300034272|Ga0335049_0838919 | Not Available | 540 | Open in IMG/M |
3300034375|Ga0348336_142043 | Not Available | 729 | Open in IMG/M |
3300034654|Ga0326741_073673 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 565 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 19.40% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 8.21% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 6.72% |
Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 6.72% |
Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 6.72% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 5.97% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 5.22% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 2.99% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 2.99% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.99% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.24% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 2.24% |
Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 2.24% |
Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 2.24% |
Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 2.24% |
Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 1.49% |
Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 1.49% |
Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 1.49% |
Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 1.49% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.75% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 0.75% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.75% |
Aquatic | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic | 0.75% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.75% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.75% |
Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.75% |
Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 0.75% |
Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.75% |
Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 0.75% |
Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 0.75% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.75% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.75% |
Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 0.75% |
Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.75% |
Estuary Water | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuary Water | 0.75% |
Filtered Seawater | Environmental → Aquatic → Marine → Unclassified → Unclassified → Filtered Seawater | 0.75% |
Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.75% |
Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 0.75% |
Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.75% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
3300002511 | Marine viral communities from the Pacific Ocean - ETNP_2_1000 | Environmental | Open in IMG/M |
3300002930 | Estuary water microbial communities from Pearl Estuary, Zhujiang, China | Environmental | Open in IMG/M |
3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005913 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK1 | Environmental | Open in IMG/M |
3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
3300006869 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA | Environmental | Open in IMG/M |
3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
3300006924 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG | Environmental | Open in IMG/M |
3300006925 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG | Environmental | Open in IMG/M |
3300006929 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG | Environmental | Open in IMG/M |
3300006990 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG | Environmental | Open in IMG/M |
3300007074 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK8 | Environmental | Open in IMG/M |
3300007640 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 | Environmental | Open in IMG/M |
3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
3300008220 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_908 | Environmental | Open in IMG/M |
3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
3300009076 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511 | Environmental | Open in IMG/M |
3300009077 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 | Environmental | Open in IMG/M |
3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
3300009436 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome | Environmental | Open in IMG/M |
3300009438 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110506 | Environmental | Open in IMG/M |
3300009507 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 | Environmental | Open in IMG/M |
3300009508 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 | Environmental | Open in IMG/M |
3300009601 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_38 | Environmental | Open in IMG/M |
3300009604 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s16 | Environmental | Open in IMG/M |
3300009785 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 | Environmental | Open in IMG/M |
3300010299 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNA | Environmental | Open in IMG/M |
3300010392 | Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385 | Environmental | Open in IMG/M |
3300010430 | Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samples | Environmental | Open in IMG/M |
3300011011 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Top - Depth 1m | Environmental | Open in IMG/M |
3300011252 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_4, permeate | Environmental | Open in IMG/M |
3300012282 | Freshwater microbial communities from Central Basin Methane Hotpot in Lake Erie, Ontario, Canada - Station 1365 - Bottom - Depth 20.5m | Environmental | Open in IMG/M |
3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
3300012952 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 Metagenome | Environmental | Open in IMG/M |
3300013115 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, May cruise - 234m, 250-2.7um, replicate a | Environmental | Open in IMG/M |
3300013125 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_11.25m | Environmental | Open in IMG/M |
3300013133 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment s1_kivu2a2 | Environmental | Open in IMG/M |
3300013136 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_11.5m | Environmental | Open in IMG/M |
3300017714 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15 | Environmental | Open in IMG/M |
3300017725 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29 | Environmental | Open in IMG/M |
3300017728 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24 | Environmental | Open in IMG/M |
3300017737 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 (version 2) | Environmental | Open in IMG/M |
3300017740 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 41 SPOT_SRF_2013-03-13 | Environmental | Open in IMG/M |
3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017767 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20 | Environmental | Open in IMG/M |
3300017768 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2) | Environmental | Open in IMG/M |
3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017781 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14 | Environmental | Open in IMG/M |
3300017962 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
3300020175 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160321_2 | Environmental | Open in IMG/M |
3300020409 | Marine microbial communities from Tara Oceans - TARA_A100001403 (ERX555912-ERR599106) | Environmental | Open in IMG/M |
3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
3300020560 | Freshwater microbial communities from Lake Mendota, WI - 18JUN2009 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300022074 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2) | Environmental | Open in IMG/M |
3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300022842 | Saline water microbial communities from Ace Lake, Antarctica - #46 | Environmental | Open in IMG/M |
3300022929 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG | Environmental | Open in IMG/M |
3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
3300023235 | Saline water microbial communities from Ace Lake, Antarctica - #50 | Environmental | Open in IMG/M |
3300024261 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_100_MG | Environmental | Open in IMG/M |
3300025069 | Marine viral communities from the Pacific Ocean - LP-38 (SPAdes) | Environmental | Open in IMG/M |
3300025079 | Marine viral communities from the Pacific Ocean - LP-48 (SPAdes) | Environmental | Open in IMG/M |
3300025098 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025101 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025110 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025112 | Marine viral communities from the Pacific Ocean - ETNP_2_130 (SPAdes) | Environmental | Open in IMG/M |
3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
3300025125 | Marine viral communities from the Pacific Ocean - ETNP_2_1000 (SPAdes) | Environmental | Open in IMG/M |
3300025127 | Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes) | Environmental | Open in IMG/M |
3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
3300025137 | Marine viral communities from the Pacific Ocean - LP-32 (SPAdes) | Environmental | Open in IMG/M |
3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
3300025141 | Marine viral communities from the Pacific Ocean - ETNP_6_85 (SPAdes) | Environmental | Open in IMG/M |
3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025707 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI074_LV_165m_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
3300025830 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407 (SPAdes) | Environmental | Open in IMG/M |
3300025881 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 (SPAdes) | Environmental | Open in IMG/M |
3300025886 | Pelagic Microbial community sample from North Sea - COGITO 998_met_10 (SPAdes) | Environmental | Open in IMG/M |
3300025897 | Pelagic Microbial community sample from North Sea - COGITO 998_met_05 (SPAdes) | Environmental | Open in IMG/M |
3300026138 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
3300027292 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Law_RepC_8d | Environmental | Open in IMG/M |
3300027621 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300028394 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2) | Environmental | Open in IMG/M |
3300029930 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727 | Environmental | Open in IMG/M |
3300031510 | Marine microbial communities from water near the shore, Antarctic Ocean - #129 | Environmental | Open in IMG/M |
3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
3300031655 | Marine microbial communities from water near the shore, Antarctic Ocean - #282 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300032046 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40 | Environmental | Open in IMG/M |
3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
3300033742 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawater | Environmental | Open in IMG/M |
3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
3300034272 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156 | Environmental | Open in IMG/M |
3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
3300034375 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4) | Environmental | Open in IMG/M |
3300034654 | Seawater viral communities from Mid-Atlantic Ridge, Atlantic Ocean - 487_2244 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI24006J15134_102015011 | 3300001450 | Marine | VPGSTTASVAPGTNSIATLPGPAGGCKVASFTVTGTLTIS* |
JGI24003J15210_101532641 | 3300001460 | Marine | TSISAAPGTNTIATLPAPEGGCKVASFTVTGTLTIS* |
JGI25131J35506_10401752 | 3300002511 | Marine | PSSTILAVSPGCNSVATLPAPAGSYKVATFNANGTLTIS* |
Water_1023781 | 3300002930 | Estuary Water | PAGAGGSGIVVVRFPGSTGASVAPGTNSIATLPGPAGGCKVASFTVTGTLTIS* |
JGI25909J50240_11169532 | 3300003393 | Freshwater Lake | IRAPGTAGVSASPGTNTVTTLPAPAGGCKVATFTVSGSLTLS* |
Ga0070374_103239671 | 3300005517 | Freshwater Lake | NMSVSPGTNTVTTLPAPAGGCKVATFTVSGSNTLTLT* |
Ga0049081_101174541 | 3300005581 | Freshwater Lentic | VIVRAPSARTLGASPGTNTVTTLPAPAGGCKVATFTVSGDLTIS* |
Ga0049081_103159232 | 3300005581 | Freshwater Lentic | PTISVSPGTNTKTTLPAPAGGCTVATFTVSGDLTISPY* |
Ga0075108_101744712 | 3300005913 | Saline Lake | RVPGAISVSAAPGTNTITTLSAPEGGCRVARFTVTGTLTVS* |
Ga0075108_102493002 | 3300005913 | Saline Lake | RVPGAISVSAAPGTNTITTLSAPEGGCRVARFTVTGTLTVT* |
Ga0075464_101237141 | 3300006805 | Aqueous | IVRGPSSAGFSASPGTNTVTTLPAPAGGCKVATFTVSGTLTIS* |
Ga0075477_101646591 | 3300006869 | Aqueous | APGSTSISAAPGTNTIATLPAPEGGCKVASFTVSGTLTIS* |
Ga0098060_11224501 | 3300006921 | Marine | GATGVAAAPGSNTVATLPGPAGGCKVATFNVSGTLTIS* |
Ga0098051_10328473 | 3300006924 | Marine | VIARFPGSTSASVAPGTNTLATLPAPAGGCKVATFTVTGTLTIS* |
Ga0098050_11898253 | 3300006925 | Marine | YTVAPGTNTKTTLPGPAGGCTVLTYTVTGTLTIS* |
Ga0098036_10669313 | 3300006929 | Marine | LRAPGSTSISAAPGTNTVTTLPAPAGGCKVARFTVTGTLTIS* |
Ga0098046_11407381 | 3300006990 | Marine | GIIIVRVPGSTDVSVAPGDNTLSTLPGPAGGCKVATFTVSGTLTV* |
Ga0075110_10920872 | 3300007074 | Saline Lake | GAISVSAAPGTNTITTLSAPEGGCRVARFTVTGTLTVS* |
Ga0070751_11805791 | 3300007640 | Aqueous | NISASPGTNTVTTLPAPAGGCKVATFTVSGTLTT* |
Ga0105746_10801463 | 3300007973 | Estuary Water | AGLSASPGTNTVTTLPAPAGGCKVATFTDSGTLTTV* |
Ga0114910_10942393 | 3300008220 | Deep Ocean | AGGSGIVVVRVPGSAGASVAPGTNSLATLPAPDGGCKVASFTVSGTLTIS* |
Ga0114363_11404452 | 3300008266 | Freshwater, Plankton | GIIVIRAPGAAGSTISLSPGANTKTTLPAPAGGCTVATFTVSGTLTIAP* |
Ga0114880_11471291 | 3300008450 | Freshwater Lake | ITVAPGTNTKTTLPAPAGGCTVATFTVSGTLTVS* |
Ga0115566_105871272 | 3300009071 | Pelagic Marine | PGSTGASVAPGTNSIATLPAPAGGCKVASFTVTGTLTIS* |
Ga0115550_11792471 | 3300009076 | Pelagic Marine | RDETGNSAGSNGGSGVVVVRVPGSTSASVAPGTNSIATLPAPAGGCKVASFTVTGTLTIS |
Ga0115552_14259981 | 3300009077 | Pelagic Marine | GGSGVVVVRVPGSTCASVAPGTNSIATLPAPAGGCKVASFTVTGTLTIS* |
Ga0114980_100646255 | 3300009152 | Freshwater Lake | VIVRAPGSASISAAPGTNTVTTLPAPAGGCKVANFTVPGTLTVS* |
Ga0114980_101802973 | 3300009152 | Freshwater Lake | IVIVRGPSTAGFSAAPGTNTVTTLPAPAGGCKVATFTVSGTLTVS* |
Ga0114968_101180401 | 3300009155 | Freshwater Lake | IVIVRGPSTAGFAAAPGTNTVTTLPAPAGGCKVATFTVSGTLTVS* |
Ga0114968_103752952 | 3300009155 | Freshwater Lake | RGPSTANFTAAPGTNTVTTSPAPDGSAKIATFTVSGTLTVS* |
Ga0114981_101356571 | 3300009160 | Freshwater Lake | AGFSAAPGTNTVTTLPAPAGGCKVATFTVSGTLTVS* |
Ga0114966_101015841 | 3300009161 | Freshwater Lake | AGLAASPGTNTVTTLPAPAGGCKVATFTVSGTLTVS* |
Ga0115008_110153221 | 3300009436 | Marine | GGSGIVVVRMPGSTCMSISPGPPVGTVSTLPAPAGGCKVAKFTATGTLTIS* |
Ga0115559_12111762 | 3300009438 | Pelagic Marine | ASVAPGTNTISTLPAPEGGCKVASFTVSGTLTIS* |
Ga0115572_106201321 | 3300009507 | Pelagic Marine | PGSTGVSVAPGTNSIATLPGPAGGCKVASFTVSGTLTIS* |
Ga0115567_102098671 | 3300009508 | Pelagic Marine | GPTNISAAPGSNTIATLPGPAGGCKVATFTVSGTLTIS* |
Ga0115567_105258202 | 3300009508 | Pelagic Marine | PSAATVAVAPGTNSVATLPAPEGGYKVATFTVSGTLTIS* |
Ga0114914_10745092 | 3300009601 | Deep Ocean | GIIITRVPGSITASVAPGTNSIATLPGPAGGCKVATFTVTGTLTIS* |
Ga0114901_10911771 | 3300009604 | Deep Ocean | TFSVAPGTNTKTTLPGPAGGCTVMSFTVTGTLTIS* |
Ga0115001_108610382 | 3300009785 | Marine | GAVAVSVSPGANSVTTLPAPAGGCKLATFTVSGTNTVTV* |
Ga0129342_12153231 | 3300010299 | Freshwater To Marine Saline Gradient | IVIVRAPGTANLGASPGTNTVTTLPAPAGGCKVATFTVSGDLTIS* |
Ga0118731_1011535652 | 3300010392 | Marine | TRDELGNSSGSNGGSGIVVVRVPGSTSASVAPGTNSIATLPAPAGGCKVASFTVTGTLTIS* |
Ga0118733_1087474131 | 3300010430 | Marine Sediment | SASVAPGTNSIATLPAPAGGCKVASFTVTGTLTIS* |
Ga0139556_10283731 | 3300011011 | Freshwater | APGSANLTASPGTNTVTTLPAPAGGCKVATFTVSGDLTT* |
Ga0151674_10329941 | 3300011252 | Marine | VVVVRGPGSTCATVAPGTNSIATLPAPTGGCKVASFTVTGTLTIS* |
Ga0157136_10052483 | 3300012282 | Freshwater | IIRAPGSFGLTAAPGTNTVTTLPAPAGGCKVATFTVSGTLTTG* |
Ga0160423_111515482 | 3300012920 | Surface Seawater | VRFPASTCAAVAPGTNSIATLPAPAGGCKVASFTVSGTLTIS* |
Ga0163180_112851651 | 3300012952 | Seawater | VVLRFPGCASLAVAPGTNSLATLPGPAGGCKVASFTVSGTLTIS* |
Ga0171651_10490044 | 3300013115 | Marine | CAPACLAAAPGTNTITTLPAPAGGCKVATFTVDGTITL* |
(restricted) Ga0172369_102979473 | 3300013125 | Freshwater | RAPGNATFDVAPGTNTVTTLPAPAGGCKVATFTVSGTLTT* |
(restricted) Ga0172362_104100753 | 3300013133 | Sediment | SGIVIVRAPGSANIGASPGTNTVTTLPAPAGGCKVATFTVSGTLTT* |
(restricted) Ga0172370_104665652 | 3300013136 | Freshwater | GSGIIIVRTPSARTLSASPGTNTVTTLPAPAGGCKVATFTVSGDLTIS* |
Ga0181412_10853941 | 3300017714 | Seawater | AGGLGGSGVVVLRYPGTTNSSIAPGTNIIATLPAPAGGCKVATFTVSGTLTIS |
Ga0181398_11709562 | 3300017725 | Seawater | VILRAPGPTSISAAPGTNTVTTLPGPAGGCKVARFTVTGTLTIS |
Ga0181419_10797131 | 3300017728 | Seawater | GLGVFRFPGCASIAAAPVTNSIATLPGPAGGCKVASFTVSGTLTIS |
Ga0187218_11402651 | 3300017737 | Seawater | SISAAPGTNTIATLPAPAGGCKVATFTVTGTLTIS |
Ga0181418_10819631 | 3300017740 | Seawater | NSSIAPGTNSIATLPAPAGGCKVATFTVSGTLTIS |
Ga0181356_11732191 | 3300017761 | Freshwater Lake | LAPGTNVKTTAPAPSGGCGVATFTVSGTLTVAAKV |
Ga0181406_10339143 | 3300017767 | Seawater | VRVPGSTTASVAPGTNSLATLPGPAGGCKVASFTVTGTLTIS |
Ga0187220_10295743 | 3300017768 | Seawater | LRAPGPTSISAAPGTNTVTTLPGPAGGCKVARFTVTGTLTIS |
Ga0181358_11119771 | 3300017774 | Freshwater Lake | VIVRAPGSAGLAASPGTNTVTTLPAPAGGCKVATFTVSGDLTIS |
Ga0181358_11373661 | 3300017774 | Freshwater Lake | SAGFAAAPGTNTVTTLPAPAGGCKVATFTVSGTLTVS |
Ga0181358_12382612 | 3300017774 | Freshwater Lake | PSAAGFAAAPGTNTVTTLPAPAGGCKVATFTVSGTLTVS |
Ga0181423_12131331 | 3300017781 | Seawater | GIVVVRVPGSTTASVAPGTNSIATLPGPAGGCKVASFTVTGTLTIS |
Ga0181581_102816311 | 3300017962 | Salt Marsh | AACAPGSLAAAPGTNTITTLPAPAGGCKIATFTVSGTLTV |
Ga0181581_108779331 | 3300017962 | Salt Marsh | AGGSGLVVVRVPGSTCASVAPGTNSIATLPAPAGGCKVATFTISGTLTIS |
Ga0181553_102448393 | 3300018416 | Salt Marsh | GGGSGGSGIIIVRAPGSVQITASPGTNTITTLPAPAGGCKVATFTVSGSLIVP |
Ga0181359_10663801 | 3300019784 | Freshwater Lake | GSGIVIVRAPGSANISATPGTNTVTTLPAPAGGCKVATFTVSGDLTIS |
Ga0211732_12699343 | 3300020141 | Freshwater | SGIVIIRAPSAANLSVSPGTNTVTTLPAPAGGCKVATFTVSGDLTIS |
Ga0206124_102182121 | 3300020175 | Seawater | GAGGSGIVVVRFPGSTGASVAPGTNSIATLPAPAGGCKVASFTVTGTLTIS |
Ga0211472_104680782 | 3300020409 | Marine | TCASVAPGTNSLSTLPAPAGGCKVASFTVSGTLTIS |
Ga0211576_104623732 | 3300020438 | Marine | STGASVAPGTNSIATLPGPAGGCKVASFTVTGTLTIS |
Ga0208852_10639421 | 3300020560 | Freshwater | PGSAGISASPGTNTVTTLPAPAGGCKVATFTVSGTLTT |
Ga0222716_103152302 | 3300021959 | Estuarine Water | ARTLGASPGTNTVTTLPAPAGGCKVATFTVSGDLTIS |
Ga0222714_102308531 | 3300021961 | Estuarine Water | PGSANLGASPGTNTVTTLPAPAGGCKVATFTVSGTLTT |
Ga0222714_105534332 | 3300021961 | Estuarine Water | GSGIVIVRAPGSANISASPGTNTVTTLPAPAGGCKVATFTVSGDLTIS |
Ga0222713_100170208 | 3300021962 | Estuarine Water | PGSANLGATPGTNTVTTLPAPAGGCKVATFTVSGTLTT |
Ga0224906_11296331 | 3300022074 | Seawater | AGGSGIVVVRVPGSTTASVAPGTNSIATLPGPAGGCKVASFTVTGTLTIS |
Ga0181354_10464574 | 3300022190 | Freshwater Lake | GIVIVRGPSAAGFSATPGTNTVTTLPAPAGGCKVATFTVSGDLTIS |
Ga0181354_11691522 | 3300022190 | Freshwater Lake | TLGASPGTNTVTTLPAPAGGCKVATFTVSGDLTIS |
Ga0181351_10661441 | 3300022407 | Freshwater Lake | VIIRAPAGAGISASPGTNTVTTLPAPAGGCKVATFTVSGTL |
Ga0222632_10503591 | 3300022842 | Saline Water | GAISVSAAPGTNTITTLSAPEGGCRVARFTVTGTLTVS |
Ga0255752_103907131 | 3300022929 | Salt Marsh | NGGSGGPGIVVVRVPGSTCASVAPGTNSIATLPAPAGGCKVATFTISGTLTIS |
Ga0214923_102742021 | 3300023179 | Freshwater | IRAPGPSNISASPGTNTVTTLPAPAGGCKVATFTVSGTLTVS |
Ga0214919_103682281 | 3300023184 | Freshwater | IVILRAPGSANISASPGTNTVTTLPAPAGGCKVATFTVSGTLTVS |
Ga0222634_10171623 | 3300023235 | Saline Water | IIRVPGAISVSAAPGTNTITTLSAPEGGCRVARFTVTGTLTVT |
Ga0222634_10214783 | 3300023235 | Saline Water | IIRVPGAISVSAAPGTNTITTLSAPEGGCRVARFTVTGTLTVS |
(restricted) Ga0233439_101913861 | 3300024261 | Seawater | VVARFPGSTGASVAPGTNTIATLPAPEGGCKVASFTVSGTLTIS |
Ga0207887_10847472 | 3300025069 | Marine | GDGIVIIRVPGTTTVSATPSPANPVATLPAPAGGCKVARFTETGTLTIS |
Ga0207890_10563162 | 3300025079 | Marine | GSTNASIAPGTNTISTLPAPAGGCKIATFTVSGTLTV |
Ga0208434_11106561 | 3300025098 | Marine | VVVRVPGSTTASVAPGTNSLATLPGPAGGCKVASFTVSGTLTIS |
Ga0208159_10995342 | 3300025101 | Marine | GSTSAAVAPGTNSIATLPAPAGGCKVASFTVSGTLTIS |
Ga0208158_11014282 | 3300025110 | Marine | NPAGAGGPGVVIARFPGSAGVAAAPGSNTVATLPGPAGGCKVATFTVTGTLTIS |
Ga0208158_11424281 | 3300025110 | Marine | IVRVPGSTSASVAPGTNSIATLPGPAGGCKVASFTVSGTLTIS |
Ga0209349_11673182 | 3300025112 | Marine | IIVRAPGSTNVSVAPGTNSVATLPGPAGGCKVATFTVSGTLTV |
Ga0209535_10454214 | 3300025120 | Marine | GPGVVVVRGPSTTSFAVTPGGSVATLPAPEGGYKVATFTASGTLTIS |
Ga0209535_12165442 | 3300025120 | Marine | GIVVVRVPGSTTASVAPGTNSIATLPGPAGGCKVASFTVSGTLTIS |
Ga0209644_10512943 | 3300025125 | Marine | PSSTILAVSPGCNSVATLPAPAGSYKVATFNANGTLTIS |
Ga0209348_10288703 | 3300025127 | Marine | CMSVAPGTNSLATLPAPAGGYKVATFTVSGTLTIS |
Ga0209232_12564222 | 3300025132 | Marine | CTSMSAAPGTNSVSTLPSPAGGCKVAQFTVSGTLTIS |
Ga0209336_101634171 | 3300025137 | Marine | SSGISVAPGSNSVATLPAPAGGCKVATFTVSGTLTIS |
Ga0209634_10995423 | 3300025138 | Marine | SGIVVVRVPGSTTASVAPGTNSIATLPGPAGGCKVASFTVTGTLTIS |
Ga0209756_11668621 | 3300025141 | Marine | GSGGPGIVVVRVPGSTCAAVAPGTNSIATLPAPAGGCKVASFTVSGTLTIS |
Ga0209756_12441801 | 3300025141 | Marine | AGVAAAPGSNTVATLPGPAGGCKVATFTVTGTLTIS |
Ga0208643_10454711 | 3300025645 | Aqueous | NGGSGIVVIRVPGATGVAAAPGSNTVATLPGPAGGCKVATFNVSGTLTIS |
Ga0208162_11842832 | 3300025674 | Aqueous | GIVIARFPGPTSVSAAPGTNTITTLPGPAGGCKVATFTASGTLTIS |
Ga0209667_11136183 | 3300025707 | Marine | STSISAAPGTNTIATLPAPEGGCKVATFTVTGTLTIS |
Ga0208899_11491383 | 3300025759 | Aqueous | STCASVAPGTNTISTLPAPAGGCKVASFTVSGTLTIS |
Ga0209832_11940221 | 3300025830 | Pelagic Marine | GSTTASVAPGTNSIATLPGPAGGCKVASFTVTGTLTIS |
Ga0209309_102404151 | 3300025881 | Pelagic Marine | NGGSGIVVVRVPGSTGASVAPGTNSIATLPAPAGGCKVASFTVTGTLTIS |
Ga0209632_101981381 | 3300025886 | Pelagic Marine | VVVRVPGSTGASVAPGTNSIATLPAPAGGCKVASFTVTGTLTIS |
Ga0209425_100698813 | 3300025897 | Pelagic Marine | TSASVAPGTNSITTLPAPAGGCKVASFTVTGTLTIS |
Ga0209951_10274633 | 3300026138 | Pond Water | RVPGTTGVAAAPGSNTVATLPGPAGGCKVATFNVSGTLTIS |
Ga0255134_10790992 | 3300027292 | Freshwater | GAGGPGIVIIRAPGAAGMSASPGANTVTTLPAPAGGCKVATFTVSGTLTT |
Ga0208951_11083601 | 3300027621 | Freshwater Lentic | IIRAPGSVNMSVSPGTNTVTTLPAPAGGCKVATFTVSGTNTLTID |
Ga0208975_11817551 | 3300027659 | Freshwater Lentic | GGSGIVVVRAPSARTLGASPGTNTVATLPAPAGGCKVATFTVSGSLTIS |
Ga0209087_12958171 | 3300027734 | Freshwater Lake | GSANISAAPGTNTVTTLPAPAGGCKVATFTVSGTLTVS |
Ga0209086_101225603 | 3300027770 | Freshwater Lake | PSTAGFAAAPGTNTVTTLPAPAGGCKVATFTVSGTLTVS |
Ga0209550_103480451 | 3300027892 | Freshwater Lake | VRAPSARTLGASPGTNTVTTLPAPAGGCKVATFTVSGDLTVS |
Ga0304730_10638324 | 3300028394 | Freshwater Lake | TAGFAAAPGTNTVTTLPAPAGGCKVATFTVSGTLTVS |
Ga0119944_10228241 | 3300029930 | Aquatic | DPASPLSTGLAGQAGIVIVRGPSSISFAANPGTNTVTTLPAPAGGCKVATFTVSGDLTIS |
Ga0308010_12836352 | 3300031510 | Marine | TGVSIAPGSNSIATLPGPAGGCKVATFTVSGTLTLS |
Ga0307376_108953101 | 3300031578 | Soil | SGIVIVRAPSARTLAASPGTNTVTTLPAPAGGCKVATFTVSGDLTVS |
Ga0308018_101888771 | 3300031655 | Marine | PSPNNAGGPGIVILRTPGSNNIAVAPGANSITTLPAPAGGCKVATFTVSGTLTV |
Ga0315909_101048161 | 3300031857 | Freshwater | AAGASITVAPGTNTKTTLPAPAGGCTVATFTVSGTLTVS |
Ga0315289_104121754 | 3300032046 | Sediment | SVTFAAAPGTNTVTTLPAPAGGCKVATFTVSGTLTVS |
Ga0315284_106380791 | 3300032053 | Sediment | SAGFSAAPGTNTVTTLPAPAGGCKVATFTVSGTLTVS |
Ga0314858_184961_51_170 | 3300033742 | Sea-Ice Brine | MPGTSVISVAPGTNSIATLPAPAGGCKVATFTVSGTLTI |
Ga0335020_0097022_490_600 | 3300034082 | Freshwater | MGFAATPGTNTVATLPAPAGGCKVATFTVSGDLTIS |
Ga0335066_0547704_485_604 | 3300034112 | Freshwater | PSARTLGASPGTNTVTTLPAPAGGCKVATFTVSGTLTIS |
Ga0335049_0838919_3_128 | 3300034272 | Freshwater | RAPSARTLGASPGTNTVTTLPAPAGGCKVATFTVSGDLTIS |
Ga0348335_100176_1_183 | 3300034374 | Aqueous | GSGGIFSPGSNGGSGIVVVRVPGSTGASVAPGTNSIATLPGPAGGCKVASFTVTGTLTIS |
Ga0348336_142043_71_202 | 3300034375 | Aqueous | MLRYPGTTNSSIAPGTNSIATLPAPAGGCKVATFTVSGTLTIT |
Ga0326741_073673_1_120 | 3300034654 | Filtered Seawater | STACVSVSPGTNTVATLPAPAGSYKVATFTVSGTNTVTF |
⦗Top⦘ |