NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F059407

Metagenome / Metatranscriptome Family F059407

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F059407
Family Type Metagenome / Metatranscriptome
Number of Sequences 134
Average Sequence Length 37 residues
Representative Sequence LLYNEQGRRPEEIAQKLGLSTYLVTQIILSSRNRGKL
Number of Associated Samples 110
Number of Associated Scaffolds 134

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 8.21 %
% of genes near scaffold ends (potentially truncated) 91.79 %
% of genes from short scaffolds (< 2000 bps) 92.54 %
Associated GOLD sequencing projects 107
AlphaFold2 3D model prediction Yes
3D model pTM-score0.62

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (74.627 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(40.298 % of family members)
Environment Ontology (ENVO) Unclassified
(39.552 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(40.299 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 36.92%    β-sheet: 0.00%    Coil/Unstructured: 63.08%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.62
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 134 Family Scaffolds
PF01921tRNA-synt_1f 6.72
PF00383dCMP_cyt_deam_1 5.97
PF13460NAD_binding_10 5.22
PF13302Acetyltransf_3 4.48
PF02687FtsX 4.48
PF00583Acetyltransf_1 2.99
PF00271Helicase_C 2.24
PF00248Aldo_ket_red 2.24
PF13191AAA_16 1.49
PF01168Ala_racemase_N 1.49
PF00440TetR_N 1.49
PF00486Trans_reg_C 1.49
PF16859TetR_C_11 1.49
PF13649Methyltransf_25 1.49
PF13540RCC1_2 1.49
PF01791DeoC 1.49
PF00294PfkB 0.75
PF05368NmrA 0.75
PF03551PadR 0.75
PF01734Patatin 0.75
PF00903Glyoxalase 0.75
PF01243Putative_PNPOx 0.75
PF04434SWIM 0.75
PF01494FAD_binding_3 0.75
PF00561Abhydrolase_1 0.75
PF05163DinB 0.75
PF03176MMPL 0.75
PF03992ABM 0.75
PF00005ABC_tran 0.75
PF00455DeoRC 0.75
PF13463HTH_27 0.75
PF00296Bac_luciferase 0.75
PF13384HTH_23 0.75
PF07676PD40 0.75
PF11774Lsr2 0.75
PF03704BTAD 0.75
PF07883Cupin_2 0.75
PF08240ADH_N 0.75
PF07690MFS_1 0.75
PF13193AMP-binding_C 0.75
PF13411MerR_1 0.75
PF00274Glycolytic 0.75

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 134 Family Scaffolds
COG1384Lysyl-tRNA synthetase, class ITranslation, ribosomal structure and biogenesis [J] 6.72
COG06542-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductasesEnergy production and conversion [C] 1.49
COG1349DNA-binding transcriptional regulator of sugar metabolism, DeoR/GlpR familyTranscription [K] 1.49
COG0120Ribose 5-phosphate isomeraseCarbohydrate transport and metabolism [G] 0.75
COG0578Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 0.75
COG0644Dehydrogenase (flavoprotein)Energy production and conversion [C] 0.75
COG0665Glycine/D-amino acid oxidase (deaminating)Amino acid transport and metabolism [E] 0.75
COG1033Predicted exporter protein, RND superfamilyGeneral function prediction only [R] 0.75
COG1695DNA-binding transcriptional regulator, PadR familyTranscription [K] 0.75
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 0.75
COG1752Predicted acylesterase/phospholipase RssA, containd patatin domainGeneral function prediction only [R] 0.75
COG1846DNA-binding transcriptional regulator, MarR familyTranscription [K] 0.75
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 0.75
COG2318Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB)Secondary metabolites biosynthesis, transport and catabolism [Q] 0.75
COG2409Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamilyGeneral function prediction only [R] 0.75
COG3588Fructose-bisphosphate aldolase class 1Carbohydrate transport and metabolism [G] 0.75
COG3621Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotRGeneral function prediction only [R] 0.75
COG3629DNA-binding transcriptional regulator DnrI/AfsR/EmbR, SARP family, contains BTAD domainTranscription [K] 0.75
COG3947Two-component response regulator, SAPR family, consists of REC, wHTH and BTAD domainsTranscription [K] 0.75
COG4279Uncharacterized protein, contains SWIM-type Zn finger domainFunction unknown [S] 0.75
COG4667Predicted phospholipase, patatin/cPLA2 familyLipid transport and metabolism [I] 0.75
COG4715Uncharacterized protein, contains SWIM-type Zn finger domainFunction unknown [S] 0.75
COG5431Predicted nucleic acid-binding protein, contains SWIM-type Zn-finger domainGeneral function prediction only [R] 0.75

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms74.63 %
UnclassifiedrootN/A25.37 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000364|INPhiseqgaiiFebDRAFT_101996016All Organisms → cellular organisms → Bacteria850Open in IMG/M
3300005439|Ga0070711_101013857All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia713Open in IMG/M
3300005537|Ga0070730_10619381Not Available689Open in IMG/M
3300005541|Ga0070733_10581617Not Available751Open in IMG/M
3300005563|Ga0068855_102154306Not Available560Open in IMG/M
3300005719|Ga0068861_100319998All Organisms → cellular organisms → Bacteria1351Open in IMG/M
3300005764|Ga0066903_100521829All Organisms → cellular organisms → Bacteria2023Open in IMG/M
3300005764|Ga0066903_107630609All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia557Open in IMG/M
3300006162|Ga0075030_101133856All Organisms → cellular organisms → Bacteria615Open in IMG/M
3300006162|Ga0075030_101243178Not Available585Open in IMG/M
3300006163|Ga0070715_10184234All Organisms → cellular organisms → Bacteria1049Open in IMG/M
3300006572|Ga0074051_11540882All Organisms → cellular organisms → Bacteria → Terrabacteria group916Open in IMG/M
3300006918|Ga0079216_10632584All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia745Open in IMG/M
3300009011|Ga0105251_10385599Not Available643Open in IMG/M
3300009148|Ga0105243_12695581Not Available537Open in IMG/M
3300009698|Ga0116216_10590974Not Available669Open in IMG/M
3300010043|Ga0126380_11043672All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. 846.5692Open in IMG/M
3300010048|Ga0126373_10410404Not Available1381Open in IMG/M
3300010048|Ga0126373_12931768All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae532Open in IMG/M
3300010159|Ga0099796_10370988All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium621Open in IMG/M
3300010360|Ga0126372_10115130All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2061Open in IMG/M
3300010360|Ga0126372_12395350All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria578Open in IMG/M
3300010361|Ga0126378_11300285All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Actinopolymorphaceae → Actinopolymorpha → Actinopolymorpha pittospori822Open in IMG/M
3300010376|Ga0126381_100638355All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1518Open in IMG/M
3300010376|Ga0126381_103595761All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia608Open in IMG/M
3300010376|Ga0126381_104183070All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia560Open in IMG/M
3300010376|Ga0126381_105070098All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Nostocaceae → Nostoc505Open in IMG/M
3300010396|Ga0134126_12278306All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium590Open in IMG/M
3300010396|Ga0134126_12327128Not Available584Open in IMG/M
3300011270|Ga0137391_11020618All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium672Open in IMG/M
3300011271|Ga0137393_10849209All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium780Open in IMG/M
3300012354|Ga0137366_10373777Not Available1041Open in IMG/M
3300012354|Ga0137366_10919745All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium614Open in IMG/M
3300012356|Ga0137371_10397120All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1069Open in IMG/M
3300012361|Ga0137360_11805726All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300012363|Ga0137390_10670799All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1000Open in IMG/M
3300012948|Ga0126375_10461765All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria936Open in IMG/M
3300012971|Ga0126369_11293310All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Actinopolymorphaceae → Actinopolymorpha → Actinopolymorpha pittospori819Open in IMG/M
3300012971|Ga0126369_11408416All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia787Open in IMG/M
3300012987|Ga0164307_11244882Not Available619Open in IMG/M
3300014150|Ga0134081_10095937All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium930Open in IMG/M
3300014169|Ga0181531_10834873Not Available575Open in IMG/M
3300016341|Ga0182035_11365556All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii635Open in IMG/M
3300016341|Ga0182035_11388413Not Available630Open in IMG/M
3300017822|Ga0187802_10297888Not Available628Open in IMG/M
3300017932|Ga0187814_10051977All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1509Open in IMG/M
3300017970|Ga0187783_10375577All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes1034Open in IMG/M
3300017972|Ga0187781_11039037Not Available600Open in IMG/M
3300017974|Ga0187777_10208381All Organisms → cellular organisms → Bacteria1319Open in IMG/M
3300018006|Ga0187804_10178465Not Available902Open in IMG/M
3300018007|Ga0187805_10557675All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium540Open in IMG/M
3300018025|Ga0187885_10377386All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia636Open in IMG/M
3300018062|Ga0187784_10206934All Organisms → cellular organisms → Bacteria1600Open in IMG/M
3300020583|Ga0210401_11437752All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria547Open in IMG/M
3300021178|Ga0210408_11008416All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia644Open in IMG/M
3300021374|Ga0213881_10101424Not Available1246Open in IMG/M
3300021402|Ga0210385_10018826All Organisms → cellular organisms → Bacteria4338Open in IMG/M
3300021405|Ga0210387_10372354All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1264Open in IMG/M
3300021433|Ga0210391_11079736All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria624Open in IMG/M
3300021476|Ga0187846_10147989Not Available995Open in IMG/M
3300024225|Ga0224572_1011886All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1649Open in IMG/M
3300025320|Ga0209171_10470256Not Available629Open in IMG/M
3300025908|Ga0207643_10354842Not Available921Open in IMG/M
3300025916|Ga0207663_11582285Not Available528Open in IMG/M
3300025927|Ga0207687_11446114All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia591Open in IMG/M
3300025929|Ga0207664_10590461All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia997Open in IMG/M
3300025961|Ga0207712_10099087All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2163Open in IMG/M
3300026557|Ga0179587_10491009All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium805Open in IMG/M
3300027096|Ga0208099_1003337Not Available1894Open in IMG/M
3300027371|Ga0209418_1009506All Organisms → cellular organisms → Bacteria1499Open in IMG/M
3300027787|Ga0209074_10285002All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium655Open in IMG/M
3300027884|Ga0209275_10242948All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia985Open in IMG/M
3300027905|Ga0209415_10467357All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria986Open in IMG/M
3300027911|Ga0209698_10695238All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium775Open in IMG/M
3300028789|Ga0302232_10149476All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1178Open in IMG/M
3300028885|Ga0307304_10336837Not Available672Open in IMG/M
3300030520|Ga0311372_10039778All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria9374Open in IMG/M
3300030969|Ga0075394_11415202Not Available594Open in IMG/M
3300031543|Ga0318516_10052383All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2223Open in IMG/M
3300031543|Ga0318516_10858969Not Available511Open in IMG/M
3300031545|Ga0318541_10029428All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2710Open in IMG/M
3300031545|Ga0318541_10443658Not Available726Open in IMG/M
3300031545|Ga0318541_10503162All Organisms → cellular organisms → Bacteria678Open in IMG/M
3300031546|Ga0318538_10376063Not Available768Open in IMG/M
3300031564|Ga0318573_10237453All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium970Open in IMG/M
3300031572|Ga0318515_10152903All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1230Open in IMG/M
3300031573|Ga0310915_11020427All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium577Open in IMG/M
3300031668|Ga0318542_10103568All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1377Open in IMG/M
3300031680|Ga0318574_10613786Not Available638Open in IMG/M
3300031680|Ga0318574_10851217All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae534Open in IMG/M
3300031682|Ga0318560_10349238All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia799Open in IMG/M
3300031708|Ga0310686_102486067All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium893Open in IMG/M
3300031713|Ga0318496_10230361All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1020Open in IMG/M
3300031713|Ga0318496_10384919Not Available775Open in IMG/M
3300031713|Ga0318496_10724556All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300031723|Ga0318493_10133943All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1271Open in IMG/M
3300031723|Ga0318493_10145086All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1224Open in IMG/M
3300031724|Ga0318500_10114170All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1242Open in IMG/M
3300031736|Ga0318501_10872284All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia500Open in IMG/M
3300031747|Ga0318502_10062545All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1988Open in IMG/M
3300031768|Ga0318509_10049914All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2128Open in IMG/M
3300031781|Ga0318547_10085019All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1780Open in IMG/M
3300031781|Ga0318547_10357131All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium893Open in IMG/M
3300031793|Ga0318548_10014698All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3176Open in IMG/M
3300031796|Ga0318576_10214919All Organisms → cellular organisms → Bacteria → Terrabacteria group905Open in IMG/M
3300031798|Ga0318523_10428104All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria657Open in IMG/M
3300031799|Ga0318565_10156024All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1107Open in IMG/M
3300031805|Ga0318497_10820635Not Available521Open in IMG/M
3300031819|Ga0318568_10182818All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Nostocaceae → Nostoc1290Open in IMG/M
3300031819|Ga0318568_10622298All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia672Open in IMG/M
3300031821|Ga0318567_10165694All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1226Open in IMG/M
3300031832|Ga0318499_10368024All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium552Open in IMG/M
3300031860|Ga0318495_10034489All Organisms → cellular organisms → Bacteria2216Open in IMG/M
3300031860|Ga0318495_10284399Not Available737Open in IMG/M
3300031880|Ga0318544_10272519All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Actinopolymorphaceae → Actinopolymorpha → Actinopolymorpha pittospori656Open in IMG/M
3300031894|Ga0318522_10038324All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1655Open in IMG/M
3300031896|Ga0318551_10073158All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1780Open in IMG/M
3300031896|Ga0318551_10141164All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Nostocaceae → Nostoc1310Open in IMG/M
3300031910|Ga0306923_10565816All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1279Open in IMG/M
3300031954|Ga0306926_11109557Not Available935Open in IMG/M
3300032008|Ga0318562_10086205All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1768Open in IMG/M
3300032008|Ga0318562_10331900All Organisms → cellular organisms → Bacteria → Terrabacteria group884Open in IMG/M
3300032009|Ga0318563_10171012All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1169Open in IMG/M
3300032009|Ga0318563_10419305All Organisms → cellular organisms → Bacteria → Terrabacteria group724Open in IMG/M
3300032039|Ga0318559_10462971All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium591Open in IMG/M
3300032041|Ga0318549_10383490All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia633Open in IMG/M
3300032043|Ga0318556_10585622Not Available582Open in IMG/M
3300032060|Ga0318505_10191563Not Available956Open in IMG/M
3300032063|Ga0318504_10088311All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1372Open in IMG/M
3300032180|Ga0307471_101216523All Organisms → cellular organisms → Bacteria917Open in IMG/M
3300032261|Ga0306920_102974511All Organisms → cellular organisms → Bacteria640Open in IMG/M
3300032782|Ga0335082_10815789All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium795Open in IMG/M
3300033158|Ga0335077_11243705All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria726Open in IMG/M
3300034065|Ga0334827_158532All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia699Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil40.30%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil9.70%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.72%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.73%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.99%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.99%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.24%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.24%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.24%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.49%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.49%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil1.49%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.49%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.49%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.49%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.49%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa1.49%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.49%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.49%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.75%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.75%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.75%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.75%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.75%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.75%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.75%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.75%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.75%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.75%
BiofilmEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm0.75%
Exposed RockEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock0.75%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.75%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.75%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.75%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.75%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005537Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1EnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006572Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006918Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100EnvironmentalOpen in IMG/M
3300009011Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaGHost-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010159Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300014150Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300014169Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaGEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300017822Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2EnvironmentalOpen in IMG/M
3300017932Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4EnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300018006Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4EnvironmentalOpen in IMG/M
3300018007Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5EnvironmentalOpen in IMG/M
3300018025Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100EnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021374Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08EnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021476Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2)EnvironmentalOpen in IMG/M
3300024225Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU5Host-AssociatedOpen in IMG/M
3300025320Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300027096Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF043 (SPAdes)EnvironmentalOpen in IMG/M
3300027371Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027787Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028789Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3EnvironmentalOpen in IMG/M
3300028885Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185EnvironmentalOpen in IMG/M
3300030520III_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030969Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 Emin (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031832Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031880Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25EnvironmentalOpen in IMG/M
3300031894Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032060Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300034065Peat soil microbial communities from Stordalen Mire, Sweden - 714 S1 1-5EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
INPhiseqgaiiFebDRAFT_10199601613300000364SoilLALIYNEQGLRPAEIAQKLGVSPYMASQIVLAARNRAKR*
Ga0070711_10101385713300005439Corn, Switchgrass And Miscanthus RhizosphereLALLYNEQGRRPEEIAQKLGLSTYLVTQIILSSRNRGKL*
Ga0070730_1061938123300005537Surface SoilLLYNEQGRRPDEIASKLGLSTYTVTQIILGSRNRGKL*
Ga0070733_1058161723300005541Surface SoilNEQGLRPEEIAQKLGLSRYLVTQIILASRNRAKL*
Ga0068855_10215430623300005563Corn RhizosphereLLYNEQGRRPEEIADKLGLSTYLVTQIILTSRNRGKL*
Ga0068861_10031999823300005719Switchgrass RhizosphereLYNEQGRRPEEIADKLGLSTYLVSQIILTSRNRGKL*
Ga0066903_10052182933300005764Tropical Forest SoilLYNSQGLRPAEIAAKLRVSSHLVTQIILAAKNRGKA*
Ga0066903_10763060923300005764Tropical Forest SoilYNEQGLRPAEIAEKLGVSPYMASQIILAARNRAKR*
Ga0075030_10113385613300006162WatershedsNEQGLPPQEIADKLGLSTYTVTQIILTSRNRGKL*
Ga0075030_10124317813300006162WatershedsALLYNEQGLRPAEIAGKLGVSTYTATQIILAARNHPQH*
Ga0070715_1018423423300006163Corn, Switchgrass And Miscanthus RhizosphereALLYNEQGRRPEEIAQKLGLSPYLVTQIILSSRNRGKL*
Ga0074051_1154088213300006572SoilLIYNEQGLRPAEIAQKLGVSPYMASQIVLAARNRAKR*
Ga0079216_1063258423300006918Agricultural SoilQRQENLALIYRDQGLRPDEIAEKLRLSTYTVTQILLAAKPRGRRRLA*
Ga0105251_1038559913300009011Switchgrass RhizosphereKSQEKLALLYIEQGRRPEEIADKLGLGTYLVSQIILTSRNRGKL*
Ga0105243_1269558123300009148Miscanthus RhizosphereLYNEQGRRPEEIAQKLGLSTYLVTQIILSSRNRGKL*
Ga0116216_1059097413300009698Peatlands SoilLYNEQGKRPDEIAAKLGLSTYIVTQIILGSRNRGKL*
Ga0126380_1104367213300010043Tropical Forest SoilRLALIYNEQGLRPAEIAQKLGVTPYMASQIILAARNQAKR*
Ga0126373_1041040413300010048Tropical Forest SoilLYNEQGLRPSDIAAKLGISSHLATQIILAARNRGKS*
Ga0126373_1293176813300010048Tropical Forest SoilNAQGLRPEEIAAKLGLSVYTVTQIILTSKNRGKL*
Ga0099796_1037098813300010159Vadose Zone SoilLLYNEQGRRPEEIAQKLGLSTYLVTQIILSSRNRGKL*
Ga0126372_1011513013300010360Tropical Forest SoilLYNEQGLRPVEIADKLGVSAYLVTQIILAAKNRR*
Ga0126372_1239535013300010360Tropical Forest SoilNEQNLRPDEIAAKLGLSTYLVTQIILTSRGRGQP*
Ga0126378_1130028513300010361Tropical Forest SoilLLYNEQGRRPDEIAEKLGLSTYLVTQIILSSRNRGKL*
Ga0126381_10063835513300010376Tropical Forest SoilRLALLYNEQGLRPSDIAHKLGISSHLATQIILAAKNRGKS*
Ga0126381_10359576123300010376Tropical Forest SoilLLYNEQGRRPEEIAQKLGLSTYLVSQIILSSRNRGKL*
Ga0126381_10418307013300010376Tropical Forest SoilALLYNEQGLRPDEIAAKLGLSPYQVAQIILNSRSRGKL*
Ga0126381_10507009823300010376Tropical Forest SoilLYNSQGLRPAEIAAKLGVSSHLVTQIILAAKNRGKA*
Ga0134126_1227830613300010396Terrestrial SoilLLYNEQGRRPDEIAQKLGLSTYLVTQIILTSRNRGKL*
Ga0134126_1232712813300010396Terrestrial SoilLLYNEQGRRPEEIADKLGLSTYLVSQIILTSRNRGKL*
Ga0137391_1102061823300011270Vadose Zone SoilNQQGLRPDEIAQKLGISRYMVTQIILDARNRRKA*
Ga0137393_1084920923300011271Vadose Zone SoilIYNAQGLRPAEIAQKLGVSAHLVTQIILAAKNRGKA*
Ga0137366_1037377723300012354Vadose Zone SoilLLYNEQGLRPAEIAQKLGVSSYLVTQIILAAKNRAKT*
Ga0137366_1091974533300012354Vadose Zone SoilYNEQGIRPQVIAERLGLSTYIVTQIILSSKNRGKL*
Ga0137371_1039712023300012356Vadose Zone SoilALLYNEQGRRPDEIAQKLGLSTYLVTQIILSSRNRGKL*
Ga0137360_1180572613300012361Vadose Zone SoilYNEQGLRPAEIARKLGVSAYTVTQIILAARNRGKG*
Ga0137390_1067079923300012363Vadose Zone SoilYNEQRLRPEEIARKLGLSTYMVTQIILAARNQGKL*
Ga0126375_1046176513300012948Tropical Forest SoilALLYNEQGLRPAEIAQKLGLSSYAVIQIILNGRNKGKL*
Ga0126369_1129331013300012971Tropical Forest SoilLLYNEQGLRPDEIAKKLGLSTYAVTQIILGSRNRGKL*
Ga0126369_1140841623300012971Tropical Forest SoilLLYNEQGLRPEEIAHKLRLSTYTVTQIILGSRNRGKL*
Ga0164307_1124488213300012987SoilLIYNEQGLRPAEIAEKLGVTPYVASQIVLAARNRAKR*
Ga0134081_1009593723300014150Grasslands SoilLYNEQGQRPDEIAQKLGLSTYLVTQIILSSRNRGKL*
Ga0181531_1083487323300014169BogLALLYNEQGQRPDEIARKLGLSTYNVTQIILGSRNRGKL*
Ga0182035_1136555623300016341SoilYNEQGLRPDEIASKLGLSTYNVTQIILNARSRGKL
Ga0182035_1138841313300016341SoilLYNEQGLRPAEIAQKLGLSSYAVTQIILSARNQGKL
Ga0187802_1029788813300017822Freshwater SedimentLYNEQGLRPEEIAGKLGLSTYTVTQIILGSRNRGKL
Ga0187814_1005197723300017932Freshwater SedimentLALLYNEQGLRPEEIAGKLGLSTYTVTQIILGSRNRGKL
Ga0187783_1037557713300017970Tropical PeatlandKLALLYNEQGLRPAEIAAKLGISPHLATQIILAAKNRGKG
Ga0187781_1103903713300017972Tropical PeatlandRSQEKLALLYNEQGRRPAEIAQKLGLSTYTVTQIILASRNRGKL
Ga0187777_1020838113300017974Tropical PeatlandLLYNEQGLRPDEIAQKLGLSPYLVTQIILNTRSRGKL
Ga0187804_1017846513300018006Freshwater SedimentERLALLYNEQGKRPEEIAQKLGLSTYTVTQIILGPRNRGKL
Ga0187805_1055767523300018007Freshwater SedimentYNEQGLRPSDIASKLGISSHLVTQIILAARNRGKS
Ga0187885_1037738623300018025PeatlandLLYNQQRLRPEEIAQKLGLSTYMVTQIILAARNQGKL
Ga0187784_1020693413300018062Tropical PeatlandLLYNSEGLRPAEIAAKLGVSSHLVTQIILAARNRGKS
Ga0210401_1143775213300020583SoilLLYNEQGLRPADIAAKLGVSSHLVTQIILAARNRGKS
Ga0210408_1100841623300021178SoilLLYNEQGLRPEEIAQKLRLSTYTVTQIILGSRNRGKL
Ga0213881_1010142423300021374Exposed RockLLYNEQGLRPDEIAEKIGLSRYLVTQIILNNRTRGKL
Ga0210385_1001882613300021402SoilALLYNEQGKRPEEIAAKLGLSTYIVTQIILGSRNRGKL
Ga0210387_1037235413300021405SoilLLYNEQGRRPEEIASKLGLSTYTVTQIILGSRNRGKL
Ga0210391_1107973623300021433SoilLALLYNEQGLRPADIAAKLGVSSHLVTQIILAARNRGKS
Ga0187846_1014798923300021476BiofilmLYNEQGRRPEEIAAKLGLSTYTVTQIILTSRNQGKL
Ga0224572_101188633300024225RhizosphereALLYNEQGLPPQEIADKLGLSTYTVTQIILTTRNRGKL
Ga0209171_1047025623300025320Iron-Sulfur Acid SpringALLYNEQGKRPDEIAAKLGLSTYIVTQIILGSRNRGKL
Ga0207643_1035484213300025908Miscanthus RhizosphereLLYNEQGRRPEEIADKLGLSTYLVSQIILTSRNRGKL
Ga0207663_1158228523300025916Corn, Switchgrass And Miscanthus RhizosphereYNEQGQRPEEIARKLGLSTYLVSQIILASRNRGKV
Ga0207687_1144611423300025927Miscanthus RhizosphereRLALIYNEQGLRPAEIAEKLGVTPYVASQIVLAARNRAKR
Ga0207664_1059046123300025929Agricultural SoilEKLALLYNEQGRRPEEIAQKLGLSTYLVTQIILGSRNRGKL
Ga0207712_1009908733300025961Switchgrass RhizosphereLTLLYNEQGRRPEEIADKLGLSTYLVTQIILTSRNRGKL
Ga0179587_1049100933300026557Vadose Zone SoilQERLARIYNEQGLRPAEIAQKLGVSPYMASQIILAARNRAKG
Ga0208099_100333723300027096Forest SoilMLYNEQGLRPDEIAQKLGLSTYAVTQIILTSRNRGKL
Ga0209418_100950623300027371Forest SoilLLYNEQGRRPDEIAQKLGLSTYLVTQIILNARTRGKL
Ga0209074_1028500223300027787Agricultural SoilTARQERLALIYNEQGLRPAEIAQKLGVSPYLASQIVLAARNRPKG
Ga0209275_1024294813300027884SoilERLALLYNEQGQRPEEIARKLGLSTYTVTQIILGSRNRGKL
Ga0209415_1046735713300027905Peatlands SoilLTLLYNEQGLRPKEIADKLGLTPYIVAQIILTSRNRGKL
Ga0209698_1069523813300027911WatershedsYNEQGLRPAEIAGKLGVSTYTATQIVLTARNHPQH
Ga0302232_1014947613300028789PalsaLALLYNEQGRRPEEIAQKLGLSTYTVTQIILTARNQGKL
Ga0307304_1033683713300028885SoilYNEQGRRPEEIAQKLGLSTYLVTQIILSSRNRGKL
Ga0311372_10039778103300030520PalsaLLYNEQGQRPEEIARKLGLSTYNVTQIILGSRNRGKL
Ga0075394_1141520213300030969SoilLFFFIQGLRPGEIAHKLGVTSHLVTQIILAAKNRGKS
Ga0318516_1005238343300031543SoilLALLYNEQGLRPAEIADKLGVSSYLATQIILAAKNRGKL
Ga0318516_1085896913300031543SoilYNEQGLRPDEIAKKLGLSVYNVTQIILNARSRGKL
Ga0318541_1002942843300031545SoilYNEQGLRPDEIADKLGVSVYTATQIILAARSHAKA
Ga0318541_1044365813300031545SoilLYNEQGQRPEEIARKLGLSTYTVTQIILGSRNRGKL
Ga0318541_1050316223300031545SoilLYNQQGLRPAEIAAKLGVNTYTATQIILAARDRRQP
Ga0318538_1037606333300031546SoilLALLYNEQGQRPEEIARKLGLSTYTVTQIILGSRNRGKL
Ga0318573_1023745313300031564SoilALLYNEQGLRPAEIAVKLGVSTYTATQIILAARNRAKA
Ga0318515_1015290313300031572SoilRLALIYNEQGLRPAEIAEKLGVSPYMASQIVLAARNRAKR
Ga0310915_1102042723300031573SoilQERLALIYNEQGLRPAEIAQKLGVSPYMASQIVLAARNRAKR
Ga0318542_1010356813300031668SoilERLALLYNEQGLRPAEIADKLGVSSYLATQIILAAKNRGKL
Ga0318574_1061378613300031680SoilYNEQGLRPDEIAEKLGLSVYNVTQIILNARSRGKL
Ga0318574_1085121723300031680SoilSQEKLALLYNEQGLRPEEIAQKLRLSTYTVTQIVLGSRNRGKL
Ga0318560_1034923823300031682SoilLYNEQGRRPEEIAQKLGLSTYLVTQIILSSRNRGKL
Ga0310686_10248606723300031708SoilLLYNEQGLRPAEIADKLGVSSYLVTQIILAAKNRGKL
Ga0318496_1023036113300031713SoilLYNEQGKRPDEIAQKLGLSTYLVTQIILNSRNRGKL
Ga0318496_1038491923300031713SoilLYNEQGLRPEEIAQKLRLSTYTVTQIILGSRNRGKL
Ga0318496_1072455623300031713SoilPEPLLYNEQGLRPGEIAQKLGLSTYAVTQIILTSRNRGKL
Ga0318493_1013394333300031723SoilPRQERLALIYNEQGLRPAEIAEKLGVSPYMASQIVLAARNRAKR
Ga0318493_1014508633300031723SoilALLYNEQGKRPDEIAQKLGLSTYLVTQIILNSRNRGKL
Ga0318500_1011417013300031724SoilERLALLYNEQGLRPDEIASKLRLSTYTVTQIILGSRNRGKL
Ga0318501_1087228413300031736SoilALLYNEQGLRPEEIAQKLRLSTYTVTQIVLGSRNRGKL
Ga0318502_1006254513300031747SoilLYNEQGLRPAEIAVKLGVSTYTATQIILAARNRAKA
Ga0318509_1004991443300031768SoilLYNEQGLRPAEIADKLGVSSYLATQIILAAKNRGKL
Ga0318547_1008501913300031781SoilLALLYNEQGRRPEEIAQKLGLSTYLVTQIILSSRNRGKL
Ga0318547_1035713113300031781SoilLLYNEQGLRPAEIAVKLGVSTYTATQIILAARNRAKA
Ga0318548_1001469853300031793SoilLYNQQGLRPAEIAAKLGVSTYTATQIILAAKNRREH
Ga0318576_1021491923300031796SoilYNEQGLRPDEIAQKLGLSTYAVTQIILDTRSRGKL
Ga0318523_1042810423300031798SoilLYNEQGLRPDEIADKLGVSSYLVTQIILAAKNRGKI
Ga0318565_1015602413300031799SoilYNEQGKRPDEIAQKLGLSTYLVTQIILNSRNRGKL
Ga0318497_1082063523300031805SoilYNEQGLRPAEIAQKLGLSSYAVTQIILSARNQGKL
Ga0318568_1018281823300031819SoilQERLAILYNSQGLRPAEIAAKLGVSSHVVTQIILATKNRGKA
Ga0318568_1062229823300031819SoilYNEQGLRPEEIAQKLRLSTYTVTQIILGSRNRGKL
Ga0318567_1016569413300031821SoilLLYNEQGLRPAEIAEKLGVSSYLVTQIILAARNRGKL
Ga0318499_1036802423300031832SoilLLYNEQGLQPGEIAQKLGLSTYLVTQIILGSRNRGKL
Ga0318495_1003448913300031860SoilLLYNEQGLRPAEIADKLGVSSYLATQIILAAKNRGKL
Ga0318495_1028439913300031860SoilQERLALLYNEQGLRPEEIAQKLRLSTYTVTQIILGSRNRGKL
Ga0318544_1027251923300031880SoilLLYNEQGLRPEEIAAKLGLSSYAVTQIILGARNRGKL
Ga0318522_1003832433300031894SoilLYNEQGKRPDEIAQKLGLSTYLVTQIILNSRSRGKL
Ga0318551_1007315833300031896SoilALLYNEQGLRPAEIAAKLGVSDYLATQIILAARNRPKA
Ga0318551_1014116433300031896SoilYNSQGLRPAEIAAKLGVSSHVVTQIILATKNRGKA
Ga0306923_1056581633300031910SoilERLALIYNEQGLRPAEIAEKLGVSPYMASQIVLAARNRAKR
Ga0306926_1110955723300031954SoilLLYNEQGLRPAEIAQKLGLSSYAVTQIILSARNQGKL
Ga0318562_1008620533300032008SoilLYNEQGLRPAEIAAKLGVSDYLATQIILAARNRPKA
Ga0318562_1033190013300032008SoilYNEQGLRPDEIADKLGVSSYLVTQIILAAKNRGKI
Ga0318563_1017101213300032009SoilALLYNEQGLRPDEIAEKLGLSVYTVTQIILNARSRGKL
Ga0318563_1041930523300032009SoilLYNEQGLRPAEIADKLGVSSYLVTQIILAAKNRGKL
Ga0318559_1046297123300032039SoilLYNEQGLRPEEIAQKLGLSSYAVTQIILTARNRGKL
Ga0318549_1038349013300032041SoilLYNEQGLRPEEIAAKLGLSSYAVTQIILGARNRGKL
Ga0318556_1058562223300032043SoilLLYNEQGQRPEEIARKLGLSTYTVTQIILGSRNRGKL
Ga0318505_1019156313300032060SoilLIYNEQGLRPAEIAEKLGVSPYMASQIVLAARNRAKR
Ga0318504_1008831113300032063SoilRLALLYNEQGLRPAEIADKLGVSSYLATQIILAAKNRGKL
Ga0307471_10121652323300032180Hardwood Forest SoilALLYNEQGRRPEEIAQKLGLSPYLVTQIILSSRNRGKL
Ga0306920_10297451113300032261SoilYNEQGLRPGEIAQKLGLSTYAVTQIILTSRNRGKL
Ga0335082_1081578913300032782SoilEKLALLYNEQGRRPAEIAQKLGLSTYLVTQIILNSRNRGKL
Ga0335077_1124370513300033158SoilALLYNEQGRRPEEIAQKLGLSTYLVTQIILSSRNRGKL
Ga0334827_158532_3_1223300034065SoilLALLYNEQRMRPDEIARKLGLSAYTVSQIILSARNQGKL

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.