Basic Information | |
---|---|
Family ID | F059186 |
Family Type | Metagenome |
Number of Sequences | 134 |
Average Sequence Length | 41 residues |
Representative Sequence | GAIVLIEWPERAGLWAPPLDRHFRLSYGEEPDIRELEEIR |
Number of Associated Samples | 107 |
Number of Associated Scaffolds | 134 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.75 % |
% of genes near scaffold ends (potentially truncated) | 97.76 % |
% of genes from short scaffolds (< 2000 bps) | 90.30 % |
Associated GOLD sequencing projects | 100 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.39 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (70.149 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (26.119 % of family members) |
Environment Ontology (ENVO) | Unclassified (45.522 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.731 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 10.29% β-sheet: 17.65% Coil/Unstructured: 72.06% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 134 Family Scaffolds |
---|---|---|
PF00814 | TsaD | 82.09 |
PF00436 | SSB | 5.97 |
PF00583 | Acetyltransf_1 | 5.97 |
PF05201 | GlutR_N | 1.49 |
PF00072 | Response_reg | 0.75 |
PF13673 | Acetyltransf_10 | 0.75 |
PF01476 | LysM | 0.75 |
PF01380 | SIS | 0.75 |
PF00902 | TatC | 0.75 |
PF01578 | Cytochrom_C_asm | 0.75 |
COG ID | Name | Functional Category | % Frequency in 134 Family Scaffolds |
---|---|---|---|
COG0533 | tRNA A37 threonylcarbamoyltransferase TsaD | Translation, ribosomal structure and biogenesis [J] | 82.09 |
COG1214 | tRNA A37 threonylcarbamoyladenosine modification protein TsaB | Translation, ribosomal structure and biogenesis [J] | 82.09 |
COG0629 | Single-stranded DNA-binding protein | Replication, recombination and repair [L] | 5.97 |
COG2965 | Primosomal replication protein N | Replication, recombination and repair [L] | 5.97 |
COG0373 | Glutamyl-tRNA reductase | Coenzyme transport and metabolism [H] | 1.49 |
COG0805 | Twin-arginine protein secretion pathway component TatC | Intracellular trafficking, secretion, and vesicular transport [U] | 0.75 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 70.15 % |
Unclassified | root | N/A | 29.85 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300005174|Ga0066680_10141549 | All Organisms → cellular organisms → Bacteria | 1500 | Open in IMG/M |
3300005174|Ga0066680_10632029 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 666 | Open in IMG/M |
3300005175|Ga0066673_10005609 | All Organisms → cellular organisms → Bacteria | 5048 | Open in IMG/M |
3300005175|Ga0066673_10367948 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
3300005176|Ga0066679_10275899 | All Organisms → cellular organisms → Bacteria | 1089 | Open in IMG/M |
3300005180|Ga0066685_10279482 | All Organisms → cellular organisms → Bacteria | 1154 | Open in IMG/M |
3300005180|Ga0066685_10322748 | All Organisms → cellular organisms → Bacteria | 1070 | Open in IMG/M |
3300005183|Ga0068993_10277571 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 601 | Open in IMG/M |
3300005186|Ga0066676_10561218 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 774 | Open in IMG/M |
3300005341|Ga0070691_10463729 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 726 | Open in IMG/M |
3300005536|Ga0070697_100150787 | All Organisms → cellular organisms → Bacteria | 1959 | Open in IMG/M |
3300005542|Ga0070732_10834629 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
3300005545|Ga0070695_100681313 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
3300005549|Ga0070704_100020313 | All Organisms → cellular organisms → Bacteria | 4280 | Open in IMG/M |
3300005552|Ga0066701_10146463 | All Organisms → cellular organisms → Bacteria | 1419 | Open in IMG/M |
3300005552|Ga0066701_10333940 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
3300005552|Ga0066701_10774008 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 573 | Open in IMG/M |
3300005553|Ga0066695_10073861 | All Organisms → cellular organisms → Bacteria | 2064 | Open in IMG/M |
3300005553|Ga0066695_10223876 | All Organisms → cellular organisms → Bacteria | 1184 | Open in IMG/M |
3300005555|Ga0066692_10217021 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1201 | Open in IMG/M |
3300005555|Ga0066692_10754095 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 600 | Open in IMG/M |
3300005555|Ga0066692_10908192 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
3300005558|Ga0066698_10283022 | All Organisms → cellular organisms → Bacteria | 1148 | Open in IMG/M |
3300005568|Ga0066703_10322207 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
3300005587|Ga0066654_10264771 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 910 | Open in IMG/M |
3300005598|Ga0066706_10271094 | All Organisms → cellular organisms → Bacteria | 1327 | Open in IMG/M |
3300005598|Ga0066706_10527958 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
3300005888|Ga0075289_1072365 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 562 | Open in IMG/M |
3300006031|Ga0066651_10068597 | All Organisms → cellular organisms → Bacteria | 1710 | Open in IMG/M |
3300006175|Ga0070712_101540427 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 581 | Open in IMG/M |
3300006755|Ga0079222_10354464 | All Organisms → cellular organisms → Bacteria | 993 | Open in IMG/M |
3300006796|Ga0066665_10104125 | All Organisms → cellular organisms → Bacteria | 2086 | Open in IMG/M |
3300006797|Ga0066659_10077242 | All Organisms → cellular organisms → Bacteria | 2198 | Open in IMG/M |
3300006800|Ga0066660_10567417 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 951 | Open in IMG/M |
3300006804|Ga0079221_10566116 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 756 | Open in IMG/M |
3300006844|Ga0075428_102678091 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 508 | Open in IMG/M |
3300006845|Ga0075421_102398132 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
3300006847|Ga0075431_101050299 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
3300006852|Ga0075433_11089585 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
3300006854|Ga0075425_101609960 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
3300006903|Ga0075426_10343809 | All Organisms → cellular organisms → Bacteria | 1095 | Open in IMG/M |
3300007004|Ga0079218_11717901 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 697 | Open in IMG/M |
3300007076|Ga0075435_100019035 | All Organisms → cellular organisms → Bacteria | 5233 | Open in IMG/M |
3300007255|Ga0099791_10145662 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1105 | Open in IMG/M |
3300007255|Ga0099791_10514084 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 582 | Open in IMG/M |
3300007258|Ga0099793_10215322 | Not Available | 923 | Open in IMG/M |
3300009088|Ga0099830_10051522 | All Organisms → cellular organisms → Bacteria | 2906 | Open in IMG/M |
3300009088|Ga0099830_10565440 | Not Available | 931 | Open in IMG/M |
3300009137|Ga0066709_101609422 | Not Available | 929 | Open in IMG/M |
3300009162|Ga0075423_10523149 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 1248 | Open in IMG/M |
3300009162|Ga0075423_12387106 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 576 | Open in IMG/M |
3300009177|Ga0105248_10298589 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1814 | Open in IMG/M |
3300010304|Ga0134088_10552437 | Not Available | 570 | Open in IMG/M |
3300010322|Ga0134084_10111388 | Not Available | 885 | Open in IMG/M |
3300010323|Ga0134086_10151454 | Not Available | 847 | Open in IMG/M |
3300010326|Ga0134065_10246048 | Not Available | 665 | Open in IMG/M |
3300010326|Ga0134065_10499600 | Not Available | 506 | Open in IMG/M |
3300010335|Ga0134063_10381900 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 688 | Open in IMG/M |
3300010361|Ga0126378_12043535 | Not Available | 653 | Open in IMG/M |
3300011271|Ga0137393_10629174 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 920 | Open in IMG/M |
3300011421|Ga0137462_1136274 | Not Available | 598 | Open in IMG/M |
3300012198|Ga0137364_10828572 | Not Available | 699 | Open in IMG/M |
3300012198|Ga0137364_11482667 | Not Available | 500 | Open in IMG/M |
3300012199|Ga0137383_11218588 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 540 | Open in IMG/M |
3300012203|Ga0137399_10607917 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 919 | Open in IMG/M |
3300012207|Ga0137381_10008039 | All Organisms → cellular organisms → Bacteria | 7939 | Open in IMG/M |
3300012208|Ga0137376_10508284 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1045 | Open in IMG/M |
3300012209|Ga0137379_10763309 | Not Available | 872 | Open in IMG/M |
3300012210|Ga0137378_11408945 | Not Available | 610 | Open in IMG/M |
3300012351|Ga0137386_10472372 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 904 | Open in IMG/M |
3300012351|Ga0137386_10633041 | Not Available | 770 | Open in IMG/M |
3300012354|Ga0137366_10165463 | All Organisms → cellular organisms → Bacteria | 1661 | Open in IMG/M |
3300012359|Ga0137385_10820227 | Not Available | 772 | Open in IMG/M |
3300012359|Ga0137385_11499479 | Not Available | 538 | Open in IMG/M |
3300012362|Ga0137361_10335788 | All Organisms → cellular organisms → Bacteria | 1386 | Open in IMG/M |
3300012918|Ga0137396_10204229 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1453 | Open in IMG/M |
3300012918|Ga0137396_10635463 | Not Available | 789 | Open in IMG/M |
3300012923|Ga0137359_10474574 | All Organisms → cellular organisms → Bacteria | 1105 | Open in IMG/M |
3300012972|Ga0134077_10281431 | Not Available | 694 | Open in IMG/M |
3300012975|Ga0134110_10045007 | All Organisms → cellular organisms → Bacteria | 1736 | Open in IMG/M |
3300012977|Ga0134087_10762825 | Not Available | 520 | Open in IMG/M |
3300014157|Ga0134078_10152666 | Not Available | 909 | Open in IMG/M |
3300014157|Ga0134078_10398818 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 617 | Open in IMG/M |
3300014166|Ga0134079_10127079 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1004 | Open in IMG/M |
3300014166|Ga0134079_10255006 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 760 | Open in IMG/M |
3300015054|Ga0137420_1252106 | Not Available | 753 | Open in IMG/M |
3300015242|Ga0137412_10650460 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 791 | Open in IMG/M |
3300015358|Ga0134089_10283118 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 685 | Open in IMG/M |
3300015359|Ga0134085_10082380 | All Organisms → cellular organisms → Bacteria | 1320 | Open in IMG/M |
3300015359|Ga0134085_10475005 | Not Available | 569 | Open in IMG/M |
3300017654|Ga0134069_1000018 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 23674 | Open in IMG/M |
3300018000|Ga0184604_10064654 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1051 | Open in IMG/M |
3300018052|Ga0184638_1283152 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 563 | Open in IMG/M |
3300018053|Ga0184626_10242916 | Not Available | 757 | Open in IMG/M |
3300018089|Ga0187774_10886337 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 611 | Open in IMG/M |
3300018431|Ga0066655_10171453 | All Organisms → cellular organisms → Bacteria | 1312 | Open in IMG/M |
3300018468|Ga0066662_10225145 | All Organisms → cellular organisms → Bacteria | 1508 | Open in IMG/M |
3300018482|Ga0066669_10617850 | Not Available | 951 | Open in IMG/M |
3300018482|Ga0066669_11155766 | Not Available | 698 | Open in IMG/M |
3300018482|Ga0066669_11954609 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 548 | Open in IMG/M |
3300020004|Ga0193755_1019677 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 2229 | Open in IMG/M |
3300021080|Ga0210382_10257229 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 764 | Open in IMG/M |
3300021081|Ga0210379_10178091 | Not Available | 911 | Open in IMG/M |
3300021344|Ga0193719_10422366 | Not Available | 546 | Open in IMG/M |
3300022756|Ga0222622_10227119 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 1253 | Open in IMG/M |
3300024317|Ga0247660_1083493 | Not Available | 545 | Open in IMG/M |
3300025326|Ga0209342_11375057 | Not Available | 506 | Open in IMG/M |
3300025885|Ga0207653_10093526 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1055 | Open in IMG/M |
3300026297|Ga0209237_1125499 | Not Available | 1067 | Open in IMG/M |
3300026309|Ga0209055_1092347 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1229 | Open in IMG/M |
3300026310|Ga0209239_1027838 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2715 | Open in IMG/M |
3300026310|Ga0209239_1187001 | Not Available | 770 | Open in IMG/M |
3300026318|Ga0209471_1024959 | All Organisms → cellular organisms → Bacteria | 2975 | Open in IMG/M |
3300026318|Ga0209471_1131723 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1054 | Open in IMG/M |
3300026323|Ga0209472_1098578 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1168 | Open in IMG/M |
3300026323|Ga0209472_1189176 | Not Available | 723 | Open in IMG/M |
3300026329|Ga0209375_1000944 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 23113 | Open in IMG/M |
3300026334|Ga0209377_1122656 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1040 | Open in IMG/M |
3300026343|Ga0209159_1135683 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1003 | Open in IMG/M |
3300026523|Ga0209808_1053020 | All Organisms → cellular organisms → Bacteria | 1842 | Open in IMG/M |
3300026536|Ga0209058_1114667 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1338 | Open in IMG/M |
3300026536|Ga0209058_1358468 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 506 | Open in IMG/M |
3300026537|Ga0209157_1077018 | All Organisms → cellular organisms → Bacteria | 1650 | Open in IMG/M |
3300027643|Ga0209076_1063296 | Not Available | 1050 | Open in IMG/M |
3300027725|Ga0209178_1148289 | Not Available | 809 | Open in IMG/M |
3300027909|Ga0209382_11771361 | Not Available | 603 | Open in IMG/M |
3300028814|Ga0307302_10486534 | Not Available | 612 | Open in IMG/M |
3300031720|Ga0307469_10895772 | Not Available | 821 | Open in IMG/M |
3300031753|Ga0307477_10138693 | All Organisms → cellular organisms → Bacteria | 1697 | Open in IMG/M |
3300031962|Ga0307479_11455355 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 643 | Open in IMG/M |
3300032180|Ga0307471_100550286 | All Organisms → cellular organisms → Bacteria | 1308 | Open in IMG/M |
3300032180|Ga0307471_103609719 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 547 | Open in IMG/M |
3300032892|Ga0335081_12462300 | Not Available | 539 | Open in IMG/M |
3300033004|Ga0335084_11595315 | Not Available | 643 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 26.12% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 19.40% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 12.69% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 7.46% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 6.72% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.48% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.73% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.99% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.24% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.24% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.49% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.49% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.49% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.75% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.75% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.75% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.75% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.75% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.75% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.75% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.75% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.75% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.75% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
3300005183 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1 | Environmental | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005888 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_103 | Environmental | Open in IMG/M |
3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300011421 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT769_2 | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300024317 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK01 | Environmental | Open in IMG/M |
3300025326 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_2 (SPAdes) | Environmental | Open in IMG/M |
3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0066680_101415493 | 3300005174 | Soil | DIGFEDMTRERATVLIEWPERAGPWAPALDRHFRLSHGGGADVRELEEIR* |
Ga0066680_106320291 | 3300005174 | Soil | FDDMVRDGAIVLIEWPERAGPWTPPLDRHFRLSYGADADTRELEEIR* |
Ga0066673_100056091 | 3300005175 | Soil | AFDDMAREGAVVLIEWPERGGPWTPPLDRHFHLSYGEQPDIRELEEIP* |
Ga0066673_103679481 | 3300005175 | Soil | ILIEWPERAGPWAPPLDRHLHLAYDDEPTRRLIEDTAAA* |
Ga0066679_102758991 | 3300005176 | Soil | RAIVLIEWPERAGPWAPPLDRHFHLSYGDEADIRILEEVR* |
Ga0066685_102794821 | 3300005180 | Soil | RAIVLIEWPERAGAWAPALDRHVVLAHDPDPAVRVIEGA* |
Ga0066685_103227482 | 3300005180 | Soil | GAVVLIEWPERAGAWTPRLDRHFRLSYGDEADTRELEEVR* |
Ga0068993_102775712 | 3300005183 | Natural And Restored Wetlands | GAVVLIEWPERAGGWAPPLDRHFRLAYDADPEVRQVDET* |
Ga0066676_105612182 | 3300005186 | Soil | GAIVLIEWPERAGLWAPPLDRHFRLSYGEEPDIRELEEIR* |
Ga0070691_104637291 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | FDDMVRERAIILIEWPERAGAWVPPLDRHFQLAYDADDARRVVQES* |
Ga0070697_1001507871 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | DMMREGAVVLIEWPERAGPWTPALGRHLHLTYDADPQFRVVNEG* |
Ga0070732_108346292 | 3300005542 | Surface Soil | IVLIEWPERATGWAPPLDRHFRLAYDADPDRRSVEEA* |
Ga0070695_1006813131 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | DDARDLGFDDMVREGAVVLIEWPEKAGPWTPPLDRQFHLAHDPDPEVRVVEET* |
Ga0070704_1000203137 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | ERAIVLIEWPERAGPWAPPLDRHFRLAHDPDPAIRVVEEGS* |
Ga0066701_101464634 | 3300005552 | Soil | GFDDMVREGAIVLIEWPERAGPWAPPLDRHFQLSYGEEPDARELGEIR* |
Ga0066701_103339401 | 3300005552 | Soil | EGAIVLIEWPERAGPWVPPLDRHFRLGYGPELDTRELEEIR* |
Ga0066701_107740082 | 3300005552 | Soil | LIEWPERAGPWTPPLDRQFRLGYSPDPDTRELEEIR* |
Ga0066695_100738614 | 3300005553 | Soil | RDAGIVLIEWPERAGPWAPPLDRHFQLSYGRDADTRELEEVR* |
Ga0066695_102238763 | 3300005553 | Soil | VILIEWPERAGSWAPPLDRHFQLSYDADPARRVLEEAA* |
Ga0066692_102170211 | 3300005555 | Soil | GFDDMLREGAIILVEWPERAGPWVPPLDRHFKLSYGADSDSRELEEIP* |
Ga0066692_107540951 | 3300005555 | Soil | RDGAIVLIEWPERAGPWTPPLDRHFRLSYGADADTRELEEIR* |
Ga0066692_109081922 | 3300005555 | Soil | RDGAIVLIEWPERAGPWTPPLDRHFRLSYGADADTRELEAIR* |
Ga0066698_102830221 | 3300005558 | Soil | LGFDDMTREQAIVLIEWPERAGAWAPPLDRHLRLAHDPDAAYRIVEG* |
Ga0066703_103222072 | 3300005568 | Soil | MAREGAVVLIEWPERGGPWTPPLDRHFRLTYGETADVRELEEVR* |
Ga0066654_102647713 | 3300005587 | Soil | EWPERAGPWAPALDRHFRLSHGGGADVRELEEIR* |
Ga0066706_102710941 | 3300005598 | Soil | GIVLIEWPERAGPWAPPLQRHFRLSYGEQPDIRDLEEIR* |
Ga0066706_105279581 | 3300005598 | Soil | REGAVVLIEWPERGGPWTPPLDRHFRLTYGETADVRELEEVR* |
Ga0075289_10723652 | 3300005888 | Rice Paddy Soil | LIEWPERAGPWAPPLDRHFHLAYDDEPTLRVIEDTAA* |
Ga0066651_100685974 | 3300006031 | Soil | AIILIEWPERAGAWAPPLDRHFQLSYDAEPTRRIVEESATA* |
Ga0070712_1015404272 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | DMVRDGAIVLIEWPERAGPWLPPLHRHFQLTYGDEPDVREMDEIR* |
Ga0079222_103544643 | 3300006755 | Agricultural Soil | LIEWPERAGPWLPPLDRHIRLAHDRDPAVRLLEDA* |
Ga0066665_101041251 | 3300006796 | Soil | MLREGAIILVEWPERAGPWVPPLDRHFKLSYGADSDSRELEEIP* |
Ga0066659_100772421 | 3300006797 | Soil | IVLIEWPERAGAWVPLLTRHFKLSYGDRPDVRELDEIR* |
Ga0066660_105674172 | 3300006800 | Soil | PERAGAWVPRLDRHFQLSYDSDPARRVVQEMAPA* |
Ga0079221_105661162 | 3300006804 | Agricultural Soil | AIVLIEWPERAGVWAPALDRHILLAHDPDPAVRVLEGV* |
Ga0075428_1026780912 | 3300006844 | Populus Rhizosphere | VRERAIVLIEWPERAGPWAPPLDRHFRLAHDPDSDVRVVEEAT* |
Ga0075421_1023981322 | 3300006845 | Populus Rhizosphere | VVLIEWPERAGEWAPPLDRQFRLAYDADADVRQVDET* |
Ga0075431_1010502992 | 3300006847 | Populus Rhizosphere | GGGAIILIEWPERAGAWAPPLDRHFQLSYDEDPSRRIIEETATV* |
Ga0075433_110895851 | 3300006852 | Populus Rhizosphere | DMVRERAIVLIEWPERAGPWAPPLDRHFRLAHDPDPALRLVEEQA* |
Ga0075425_1016099601 | 3300006854 | Populus Rhizosphere | DMVREGAIVLIEWPERAGPWAPPLDRQFELAHDPDPAIRVVEETA* |
Ga0075426_103438091 | 3300006903 | Populus Rhizosphere | AIILIEWPERAGAWAPPLDRHLRLAYDADPAYRVVAEA* |
Ga0079218_117179011 | 3300007004 | Agricultural Soil | DMVREGAIDLIAWPERAGASAPPLDRHLQLSYDRDEARRVLEEVAH* |
Ga0075435_1000190357 | 3300007076 | Populus Rhizosphere | VLIEWPERAGLWTPPLDRHFRLSYGDDADIRLLEEVR* |
Ga0099791_101456621 | 3300007255 | Vadose Zone Soil | LIEWPERAGAWAPPLDRHFKLFYDSDPGSRVVEE* |
Ga0099791_105140842 | 3300007255 | Vadose Zone Soil | IMLIEWPERAGAWAPSLDRHFRLSYDSDPGSRVLEE* |
Ga0099793_102153221 | 3300007258 | Vadose Zone Soil | VRDGAIVLIEWPERAGPWLPPLDRHYQLSYGDEPDVREMEEIR* |
Ga0099830_100515225 | 3300009088 | Vadose Zone Soil | LGFDDMVRERAIILIEWPERAGAWVPPLDRHFRLSYDSDPWSRVVEE* |
Ga0099830_105654402 | 3300009088 | Vadose Zone Soil | FEDMVRDGAIVLIEWPERAGPWLPPLQRHFKLAYDADPEVRVVEEA* |
Ga0066709_1016094222 | 3300009137 | Grasslands Soil | AVVLIEWPERGGPWTPPLDRHFRLTYGETADVRELEEVR* |
Ga0075423_105231493 | 3300009162 | Populus Rhizosphere | IEWPERAGLWTPPLDRHFRLSYGDDADIRLLEEVR* |
Ga0075423_123871062 | 3300009162 | Populus Rhizosphere | PERAGPWAPPLDRHFRLSYDGDPSRRLVEELTPA* |
Ga0105248_102985891 | 3300009177 | Switchgrass Rhizosphere | LIEWPERAGSWAPRASRRVVLGHTPDPAVRRVELS* |
Ga0134088_105524372 | 3300010304 | Grasslands Soil | LVEWPERAGAWVPPLDRHFQLSHGEAPDIRVVEEIP* |
Ga0134084_101113882 | 3300010322 | Grasslands Soil | RAIVLIEWPERAGPWAPPLDRHFRLSYGDEADIRVLEEVR* |
Ga0134086_101514541 | 3300010323 | Grasslands Soil | EWPERAGAWAPPLDRHFRLSYGEEPDIREVEEIR* |
Ga0134065_102460481 | 3300010326 | Grasslands Soil | DDMVREGAIVLVEWPERAGAWVPPLDRQFQLSYGEAADIRVREEVP* |
Ga0134065_104996002 | 3300010326 | Grasslands Soil | VLIEWPERAGPWAPPLDRHLRLSHDPDPAYRVVEGA* |
Ga0134063_103819001 | 3300010335 | Grasslands Soil | MAREGAVVLIEWPERGGPWTPPLDRYFKLSYGDSTDIRELEEIR* |
Ga0126378_120435351 | 3300010361 | Tropical Forest Soil | AIVLIEWPERAAGWTPSLDRHFRLAHDADPARRSLEEG* |
Ga0137393_106291741 | 3300011271 | Vadose Zone Soil | IVLIEWPERAGPWLPPLQRHFKLAYDADPEVRVVEEA* |
Ga0137462_11362742 | 3300011421 | Soil | EGAVILIEWPERAGLWAPPLDRRFHLAHESDPDVRVLEEI* |
Ga0137364_108285721 | 3300012198 | Vadose Zone Soil | DGAIVLIEWPERAGPWLPPLDRHFKLSYGDAPDTRELEEVR* |
Ga0137364_114826671 | 3300012198 | Vadose Zone Soil | LGFDDMVRERAIVLIEWPERAGSWAPPLDRHFQLAHDPDPTIRVVEESA* |
Ga0137383_112185881 | 3300012199 | Vadose Zone Soil | ILIEWSERAGAWAPPLDRHFQLSYDADPARRLVEETTPV* |
Ga0137399_106079172 | 3300012203 | Vadose Zone Soil | PERAGAWAPPLDRRFQLSYDNDPARRVVEEMATA* |
Ga0137381_1000803911 | 3300012207 | Vadose Zone Soil | TREGAIVLIEWPERAGPWAPPLDRHFRLSYGPELDTRELEEIR* |
Ga0137376_105082843 | 3300012208 | Vadose Zone Soil | GFDDMTRERAIVLIEWPERAGAWAPPLDRHFTLSYDSDPGSRVVDE* |
Ga0137379_107633091 | 3300012209 | Vadose Zone Soil | REGAIVLVEWPERAGAWVPPLDRQFQLSYGEAVDIRVLEEIP* |
Ga0137378_114089451 | 3300012210 | Vadose Zone Soil | RDGAIVLIEWPERAGPWLPPLDRHFQLRYGDELDSRELEEIR* |
Ga0137386_104723722 | 3300012351 | Vadose Zone Soil | LIEWPERAGAWAPPLDRHFQLSYDADPARRLVEETTPV* |
Ga0137386_106330412 | 3300012351 | Vadose Zone Soil | IEWPERAGVWTPPLDRRFHLSYDDDPTRRVVADLGTA* |
Ga0137366_101654634 | 3300012354 | Vadose Zone Soil | FDDMIREHTIVLIEWPERAGAWAPPLDRHFQLSYDDDPRRRVVKELAHA* |
Ga0137385_108202272 | 3300012359 | Vadose Zone Soil | LIEWPERAGVWTPPLDRRFHLSYDDDPTRRVVADLGTA* |
Ga0137385_114994792 | 3300012359 | Vadose Zone Soil | IEWPERAGAWAPALDRHVVLAHDPDPTVRVIEGA* |
Ga0137361_103357881 | 3300012362 | Vadose Zone Soil | DDMVRDGAIMLIEWPERAGPWTPPLDRRFHLSYDDDPSRRAVVDLGMA* |
Ga0137396_102042294 | 3300012918 | Vadose Zone Soil | VLIEWPDRAGSWAPPLDRHFRLAHDPDPTIRVVEESA* |
Ga0137396_106354631 | 3300012918 | Vadose Zone Soil | REPAIILIEWPERAGAWAPPLDRHFQLTYDEEPTRRIVKELATA* |
Ga0137359_104745743 | 3300012923 | Vadose Zone Soil | WPERAGAWAPPLDRHFQLTYDEEPTRRIVEELATA* |
Ga0134077_102814312 | 3300012972 | Grasslands Soil | RERAIVLIEWPERAGPWAPPLDRHFHLSYGDEADIRVLEEVR* |
Ga0134110_100450074 | 3300012975 | Grasslands Soil | GAIVLIEWPERAGPWTPPLDRHFHLAYVEAADLRELEELR* |
Ga0134087_107628252 | 3300012977 | Grasslands Soil | EWPERAGPWAPPLDRHFRLGYGPELDTRELEEIR* |
Ga0134078_101526661 | 3300014157 | Grasslands Soil | DMIRERAIVLIEWPERAGPWAPPLDRQFRLAHDSDPAIRVVE* |
Ga0134078_103988182 | 3300014157 | Grasslands Soil | WPERAGAWAPPLDRHFRLSYDEEPTRRIVEETAGG* |
Ga0134079_101270791 | 3300014166 | Grasslands Soil | LIEWPERAGPWAPPLDRHFRLSYGEQPDIRELEETR* |
Ga0134079_102550061 | 3300014166 | Grasslands Soil | RAIILIEWPERAGAWIPPLDRHFRLFYDGDPARRIVEEMAIA* |
Ga0137420_12521062 | 3300015054 | Vadose Zone Soil | IVLIEWPERAGPWLPPLQRHFKLAHDADPEVRVVEEA* |
Ga0137412_106504603 | 3300015242 | Vadose Zone Soil | AFDDMVRERAIILIEWPERAGAWAPPLDRHFRLSHDVDPSRRIVEETALV* |
Ga0134089_102831182 | 3300015358 | Grasslands Soil | DLGFDDMIRERAIILIEWPERAGAWAPPLDRHFKLFYDSDPGSRVVEE* |
Ga0134085_100823801 | 3300015359 | Grasslands Soil | EGAIMLIEWPERAGAWTPPLDRRFHLSYDDDPTRRVVADLGTA* |
Ga0134085_104750052 | 3300015359 | Grasslands Soil | TRERAIVLIEWPERAGPWAPPLDRHFRLSHGDEPEIRELEEIR* |
Ga0134069_100001820 | 3300017654 | Grasslands Soil | AIVLIEWPERAGAWVPPLTRHFRLSYSDAPDVREVEEIR |
Ga0184604_100646543 | 3300018000 | Groundwater Sediment | VLIEWPERAGPWAPPLDRHFRLAHDPDPDLRIVEET |
Ga0184638_12831522 | 3300018052 | Groundwater Sediment | EGAIMLIEWPERAGAWAPSLDRHFRLSYDSDPGSRVLEE |
Ga0184626_102429162 | 3300018053 | Groundwater Sediment | VLIEWPERAGPWAPPLDRHFRLAHDSDPAIRVVEEAA |
Ga0187774_108863372 | 3300018089 | Tropical Peatland | VRARAIILIEWPERAGVWTPALDRHFRLSYDSDPARRVVEEMAIA |
Ga0066655_101714533 | 3300018431 | Grasslands Soil | FDDMVRDGAIVLIEWPERAGPWLPPLHRHFRLAYDADPEVRVVEEA |
Ga0066662_102251451 | 3300018468 | Grasslands Soil | MLREGAIILVEWPERAGPWVPPLDRHFKLSYGADSDSRELEEIP |
Ga0066669_106178502 | 3300018482 | Grasslands Soil | IEWPERAGAWTPRLDRHFRLSYGEQPDVRELEEIR |
Ga0066669_111557662 | 3300018482 | Grasslands Soil | EDMTRERAIVLIEWPERAGPWAPPLDRHFRLSYGDEADIRVLEEVR |
Ga0066669_119546092 | 3300018482 | Grasslands Soil | DLGFDDMVRERAIILIEWPERAGAWAPPLDRHFGLSYDSDDARRVVEELATA |
Ga0193755_10196773 | 3300020004 | Soil | MMRERAVVLIEWPERAGPWTPPLDRHFRLAHDPDPTVRVVEEAA |
Ga0210382_102572291 | 3300021080 | Groundwater Sediment | ILIEWPERAGAWAPPLDRHFRLSYDSDPGRRVVEE |
Ga0210379_101780912 | 3300021081 | Groundwater Sediment | NAIVLIEWPERAGPWAPPLDRHFRLAHDSDPTIRIVEEEA |
Ga0193719_104223662 | 3300021344 | Soil | FDDMIRDSAVILIEWPERAGPWAPPLDRHFRLAHDADPSIRIVEETT |
Ga0222622_102271193 | 3300022756 | Groundwater Sediment | VLIEWPERAGPWAPPLDRHFRLAHDPDLAIRVVEEAA |
Ga0247660_10834931 | 3300024317 | Soil | EGAVVLIEWPERAGPWTPALGRHLRLTYDADPQFRVVNEG |
Ga0209342_113750571 | 3300025326 | Soil | IVEWPERAGPWAPRLHRRFHLAHDPDPDVRILEEA |
Ga0207653_100935262 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | MTRERAIILIEWPERAGAWAPPLDRHFHLSYDDDPARRVVDELANA |
Ga0209237_11254992 | 3300026297 | Grasslands Soil | DGAIVLIEWPERAGPWTPPLDRHFRLSYGADADTRELEEIR |
Ga0209055_10923471 | 3300026309 | Soil | DDMAREGAVVLIEWPERGGPWTPPLDRHFRLTYGETADVRELEEVR |
Ga0209239_10278381 | 3300026310 | Grasslands Soil | LGFDDMVRDGAIVLIEWPERAGPWTPPLDRHFRLSYGADADTRELEAIR |
Ga0209239_11870011 | 3300026310 | Grasslands Soil | LGFDDMVRDGAIVLIEWPERAGPWTPPLDRHFRLSYGADADTRELEEIR |
Ga0209471_10249591 | 3300026318 | Soil | AIVLIEWPERAGPWTPPLDRHFRLSYGELPDIRELEEVR |
Ga0209471_11317233 | 3300026318 | Soil | IEWPERAGPWAPPLDRHFHLSYGDEADIRILEEVR |
Ga0209472_10985783 | 3300026323 | Soil | VRDEAIVLIEWPERAGAWTPRLDRHFRLSYGDEPDTRDLEEIR |
Ga0209472_11891761 | 3300026323 | Soil | HAIVLIEWPERAGAWVPQADRRFRLSYTDSPDIRELEEIR |
Ga0209375_10009441 | 3300026329 | Soil | ERAIVLIEWPERAGAWVPPLTRHFRLSYSDAPDVREVEEIR |
Ga0209377_11226561 | 3300026334 | Soil | EDMTRERAIVLIEWPERAGPWAPPLDRHFHLSYGDEADIRILEEVR |
Ga0209159_11356831 | 3300026343 | Soil | REGAIILIEWPERAGAWAPPLDRHFQLSYDDDPTRRVVTPLAHV |
Ga0209808_10530204 | 3300026523 | Soil | EGAIVLIEWPERAGPWAPPLDRQFRLSYGELPEIRELEEIP |
Ga0209058_11146671 | 3300026536 | Soil | IVLIEWPERAGVWVPPLDRHFQLSYDTDPVRRVVEEMAVA |
Ga0209058_13584682 | 3300026536 | Soil | EGAIILIEWPERAGAWAPPLDRHFQLSYDDDPSRRVVTALAHV |
Ga0209157_10770181 | 3300026537 | Soil | IVLIEWPERAGPWAPPLQRHFRLSYGEQPDIRDLEEIR |
Ga0209076_10632963 | 3300027643 | Vadose Zone Soil | DDMVRERAIVLIEWPERAGSWAPPLDRHFQLAHDPDPTIRVVEESA |
Ga0209178_11482891 | 3300027725 | Agricultural Soil | AIVLIEWPERAGVWAPALDRHILLAHDPDPAVRVLEGV |
Ga0209382_117713611 | 3300027909 | Populus Rhizosphere | AVVLIEWPERAGEWAPPLDRQFRLAYDADADVRQVDET |
Ga0307302_104865341 | 3300028814 | Soil | FDDMVRDRAIVLIEWPERAGAWAPPLDRHFQLSYGAEPDTRELEEIR |
Ga0307469_108957722 | 3300031720 | Hardwood Forest Soil | LIEWPERAGPWTPPLDRHFRLSYGDDADIRLLEEVR |
Ga0307477_101386931 | 3300031753 | Hardwood Forest Soil | AIVLIEWPERATGWAPPLDRHFRLAYDADPDRRSVEEA |
Ga0307479_114553551 | 3300031962 | Hardwood Forest Soil | MVREGAIVLIEWPERAGAWAPPLDRHFRLSYGADPATRELEERR |
Ga0307471_1005502861 | 3300032180 | Hardwood Forest Soil | FDDMVREGAVVLIEWPEKAGPWTPPLDRQLHLAHDPDPDVRVVEET |
Ga0307471_1036097191 | 3300032180 | Hardwood Forest Soil | EWPERAGAWAPPLDRHFQLSYDDDPGRRVVQDTARV |
Ga0335081_124623002 | 3300032892 | Soil | MQRENAVVLIEWPERAGAWAPPLDRHFRLAHDPDPARRSLEEE |
Ga0335084_115953151 | 3300033004 | Soil | FDDMMRAGATILIEWPERAGAWAPALDRHFRLTYGSNPETRELEEIQR |
⦗Top⦘ |