NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F059081

Metagenome / Metatranscriptome Family F059081

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F059081
Family Type Metagenome / Metatranscriptome
Number of Sequences 134
Average Sequence Length 38 residues
Representative Sequence IGVVEHVFAADAAHAAEEFAAELYSAQFDARRLMLE
Number of Associated Samples 118
Number of Associated Scaffolds 134

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.76 %
% of genes near scaffold ends (potentially truncated) 95.52 %
% of genes from short scaffolds (< 2000 bps) 93.28 %
Associated GOLD sequencing projects 114
AlphaFold2 3D model prediction Yes
3D model pTM-score0.47

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (84.328 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil
(12.687 % of family members)
Environment Ontology (ENVO) Unclassified
(31.343 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(45.522 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 39.06%    β-sheet: 0.00%    Coil/Unstructured: 60.94%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.47
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 134 Family Scaffolds
PF00903Glyoxalase 2.24
PF06441EHN 0.75
PF00420Oxidored_q2 0.75
PF03486HI0933_like 0.75
PF00140Sigma70_r1_2 0.75
PF04545Sigma70_r4 0.75
PF03349Toluene_X 0.75
PF05598DUF772 0.75
PF00005ABC_tran 0.75
PF07786HGSNAT_cat 0.75
PF04542Sigma70_r2 0.75
PF09413DUF2007 0.75
PF03979Sigma70_r1_1 0.75

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 134 Family Scaffolds
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 2.24
COG0493NADPH-dependent glutamate synthase beta chain or related oxidoreductaseAmino acid transport and metabolism [E] 1.49
COG06542-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductasesEnergy production and conversion [C] 1.49
COG0029Aspartate oxidaseCoenzyme transport and metabolism [H] 0.75
COG0446NADPH-dependent 2,4-dienoyl-CoA reductase, sulfur reductase, or a related oxidoreductaseLipid transport and metabolism [I] 0.75
COG0492Thioredoxin reductasePosttranslational modification, protein turnover, chaperones [O] 0.75
COG05962-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase MenH and related esterases, alpha/beta hydrolase foldCoenzyme transport and metabolism [H] 0.75
COG0644Dehydrogenase (flavoprotein)Energy production and conversion [C] 0.75
COG1053Succinate dehydrogenase/fumarate reductase, flavoprotein subunitEnergy production and conversion [C] 0.75
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 0.75
COG1249Dihydrolipoamide dehydrogenase (E3) component of pyruvate/2-oxoglutarate dehydrogenase complex or glutathione oxidoreductaseEnergy production and conversion [C] 0.75
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 0.75
COG2067Long-chain fatty acid transport proteinLipid transport and metabolism [I] 0.75
COG2072Predicted flavoprotein CzcO associated with the cation diffusion facilitator CzcDInorganic ion transport and metabolism [P] 0.75
COG2081Predicted flavoprotein YhiNGeneral function prediction only [R] 0.75
COG2509FAD-dependent dehydrogenaseGeneral function prediction only [R] 0.75
COG3503Uncharacterized membrane protein, DUF1624 familyFunction unknown [S] 0.75
COG3634Alkyl hydroperoxide reductase subunit AhpFDefense mechanisms [V] 0.75
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 0.75

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms84.33 %
UnclassifiedrootN/A15.67 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459013|GO6OHWN01DU14KAll Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria505Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_100233638All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium519Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_100372384All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium718Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_100403095All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria660Open in IMG/M
3300000886|AL3A1W_1700907All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria534Open in IMG/M
3300000955|JGI1027J12803_105301482All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria509Open in IMG/M
3300000956|JGI10216J12902_117748264All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria723Open in IMG/M
3300001664|P5cmW16_1055399All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria687Open in IMG/M
3300004157|Ga0062590_101270830All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria723Open in IMG/M
3300005187|Ga0066675_10434713All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria973Open in IMG/M
3300005336|Ga0070680_100752219Not Available839Open in IMG/M
3300005458|Ga0070681_10307783All Organisms → cellular organisms → Bacteria1494Open in IMG/M
3300005549|Ga0070704_100786981All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria849Open in IMG/M
3300005556|Ga0066707_10157331All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1444Open in IMG/M
3300005561|Ga0066699_10672195All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium741Open in IMG/M
3300005574|Ga0066694_10480626All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria580Open in IMG/M
3300005576|Ga0066708_10100136All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1720Open in IMG/M
3300005616|Ga0068852_102675283Not Available518Open in IMG/M
3300005842|Ga0068858_101845711Not Available597Open in IMG/M
3300005843|Ga0068860_101782192All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria637Open in IMG/M
3300005894|Ga0075270_1043947All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria646Open in IMG/M
3300005896|Ga0075282_1014326All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium980Open in IMG/M
3300005905|Ga0075269_10015042All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1187Open in IMG/M
3300006028|Ga0070717_10389272All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1251Open in IMG/M
3300006028|Ga0070717_10660064All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria949Open in IMG/M
3300006032|Ga0066696_10431462All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium862Open in IMG/M
3300006032|Ga0066696_10514438All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria785Open in IMG/M
3300006032|Ga0066696_10935805Not Available551Open in IMG/M
3300006237|Ga0097621_101211572Not Available711Open in IMG/M
3300006580|Ga0074049_12381801Not Available660Open in IMG/M
3300006800|Ga0066660_10327434All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1234Open in IMG/M
3300006804|Ga0079221_11474002All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium545Open in IMG/M
3300006806|Ga0079220_11922035All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria525Open in IMG/M
3300006846|Ga0075430_101384037All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium578Open in IMG/M
3300006904|Ga0075424_101167197Not Available820Open in IMG/M
3300009094|Ga0111539_12892778All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria556Open in IMG/M
3300009137|Ga0066709_101381965All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1026Open in IMG/M
3300009146|Ga0105091_10253267All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria850Open in IMG/M
3300009156|Ga0111538_10071808All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4408Open in IMG/M
3300009162|Ga0075423_11034778All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria873Open in IMG/M
3300010039|Ga0126309_11250534All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria512Open in IMG/M
3300010044|Ga0126310_11064131All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria641Open in IMG/M
3300010111|Ga0127491_1128521All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria758Open in IMG/M
3300010119|Ga0127452_1022246All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium864Open in IMG/M
3300010326|Ga0134065_10094404All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria985Open in IMG/M
3300010329|Ga0134111_10398445All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria589Open in IMG/M
3300010335|Ga0134063_10065546All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1608Open in IMG/M
3300010335|Ga0134063_10652443All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria540Open in IMG/M
3300010360|Ga0126372_12834737All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria537Open in IMG/M
3300010362|Ga0126377_10627400All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1122Open in IMG/M
3300010371|Ga0134125_12476819All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300010371|Ga0134125_12856621Not Available525Open in IMG/M
3300010398|Ga0126383_12282736All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria627Open in IMG/M
3300010399|Ga0134127_11881766All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria675Open in IMG/M
3300010866|Ga0126344_1170673All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium623Open in IMG/M
3300011119|Ga0105246_11295822Not Available675Open in IMG/M
3300012204|Ga0137374_10132555Not Available2265Open in IMG/M
3300012204|Ga0137374_11216118Not Available526Open in IMG/M
3300012206|Ga0137380_11209280All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria641Open in IMG/M
3300012207|Ga0137381_10335309All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1318Open in IMG/M
3300012208|Ga0137376_11348714All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria604Open in IMG/M
3300012210|Ga0137378_11101649All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria709Open in IMG/M
3300012210|Ga0137378_11393945All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria614Open in IMG/M
3300012211|Ga0137377_10241542All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1735Open in IMG/M
3300012211|Ga0137377_11481160All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria605Open in IMG/M
3300012212|Ga0150985_100854639Not Available809Open in IMG/M
3300012212|Ga0150985_117108307All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria511Open in IMG/M
3300012362|Ga0137361_10064619All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3074Open in IMG/M
3300012469|Ga0150984_107668568All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria527Open in IMG/M
3300012469|Ga0150984_121364333All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria503Open in IMG/M
3300012532|Ga0137373_11174790Not Available543Open in IMG/M
3300012906|Ga0157295_10335720All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria541Open in IMG/M
3300012908|Ga0157286_10348413All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria558Open in IMG/M
3300012929|Ga0137404_11050061All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria746Open in IMG/M
3300012941|Ga0162652_100050260All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria677Open in IMG/M
3300012960|Ga0164301_10398318All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria963Open in IMG/M
3300012961|Ga0164302_10091464All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1654Open in IMG/M
3300012989|Ga0164305_12234041All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria504Open in IMG/M
3300013105|Ga0157369_11860964All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium611Open in IMG/M
3300013297|Ga0157378_12211152All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria601Open in IMG/M
3300013770|Ga0120123_1085633All Organisms → cellular organisms → Bacteria707Open in IMG/M
3300014325|Ga0163163_10682540Not Available1091Open in IMG/M
3300015053|Ga0137405_1320260All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1672Open in IMG/M
3300015241|Ga0137418_10851147All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium677Open in IMG/M
3300015371|Ga0132258_11959085All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1474Open in IMG/M
3300015373|Ga0132257_100156337All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2675Open in IMG/M
3300017792|Ga0163161_10072976All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Luteibacter → Luteibacter rhizovicinus2514Open in IMG/M
3300018027|Ga0184605_10013190All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3209Open in IMG/M
3300018061|Ga0184619_10371121All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria652Open in IMG/M
3300018431|Ga0066655_10886352All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium609Open in IMG/M
3300018468|Ga0066662_10536425All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1077Open in IMG/M
3300020018|Ga0193721_1073282All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria891Open in IMG/M
3300021080|Ga0210382_10243983All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria785Open in IMG/M
3300021560|Ga0126371_11578505All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium783Open in IMG/M
3300022694|Ga0222623_10102852All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1111Open in IMG/M
3300024283|Ga0247670_1039491All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria849Open in IMG/M
3300025905|Ga0207685_10071351All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1409Open in IMG/M
3300025909|Ga0207705_11292053All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria557Open in IMG/M
3300025910|Ga0207684_11175046All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria636Open in IMG/M
3300025915|Ga0207693_11028255All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria628Open in IMG/M
3300025916|Ga0207663_10573255All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium884Open in IMG/M
3300025938|Ga0207704_11603239All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria559Open in IMG/M
3300025941|Ga0207711_11210067All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium697Open in IMG/M
3300026121|Ga0207683_11485463All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria626Open in IMG/M
3300026277|Ga0209350_1151897All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria522Open in IMG/M
3300026295|Ga0209234_1277679All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria539Open in IMG/M
3300026306|Ga0209468_1065988All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1217Open in IMG/M
3300026306|Ga0209468_1184826All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria527Open in IMG/M
3300026552|Ga0209577_10584887All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria683Open in IMG/M
3300027665|Ga0209983_1135309All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria564Open in IMG/M
3300027821|Ga0209811_10105738All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1015Open in IMG/M
3300027821|Ga0209811_10264454All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria658Open in IMG/M
3300027903|Ga0209488_11154534All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium525Open in IMG/M
3300028381|Ga0268264_10580110All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1103Open in IMG/M
3300028704|Ga0307321_1078050All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium654Open in IMG/M
3300028771|Ga0307320_10388675All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria559Open in IMG/M
3300028787|Ga0307323_10260778All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria624Open in IMG/M
3300028792|Ga0307504_10172658All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria749Open in IMG/M
3300028799|Ga0307284_10187140All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria810Open in IMG/M
3300028819|Ga0307296_10701699All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium553Open in IMG/M
3300028828|Ga0307312_10746640All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria648Open in IMG/M
3300031573|Ga0310915_10750213All Organisms → cellular organisms → Bacteria688Open in IMG/M
3300031716|Ga0310813_12125614Not Available531Open in IMG/M
3300031778|Ga0318498_10240563All Organisms → cellular organisms → Bacteria817Open in IMG/M
3300031779|Ga0318566_10122913All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1281Open in IMG/M
3300031805|Ga0318497_10528782All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium661Open in IMG/M
3300031820|Ga0307473_10689534All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria716Open in IMG/M
3300032043|Ga0318556_10388860Not Available730Open in IMG/M
3300032044|Ga0318558_10690945Not Available510Open in IMG/M
3300032782|Ga0335082_11243509Not Available613Open in IMG/M
3300032892|Ga0335081_10257035All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2353Open in IMG/M
3300034147|Ga0364925_0276521Not Available627Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil12.69%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil11.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil10.45%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.22%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.22%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil4.48%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.73%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.73%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.99%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.24%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost2.24%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil2.24%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.24%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.49%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil1.49%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.49%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.49%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.49%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.49%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.49%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere1.49%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.49%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere1.49%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.75%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.75%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.75%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.75%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.75%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.75%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.75%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.75%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.75%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.75%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.75%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.75%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.75%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.75%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.75%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.75%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.75%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.75%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.75%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.75%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.75%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459013Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis soil at the rocks surface 0-21cmEnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000886Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-65cm-3A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001664Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - 5cm_reassembledEnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005574Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005894Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_203EnvironmentalOpen in IMG/M
3300005896Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_204EnvironmentalOpen in IMG/M
3300005905Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_105EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006580Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009146Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015EnvironmentalOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300010039Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56EnvironmentalOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010111Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_24_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010119Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_0_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015EnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010866Boreal forest soil eukaryotic communities from Alaska, USA - C1-3 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012532Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012906Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1EnvironmentalOpen in IMG/M
3300012908Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012941Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t4i015EnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013770Permafrost microbial communities from Nunavut, Canada - A15_5cm_18MEnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300015053Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300020018Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2EnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022694Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coexEnvironmentalOpen in IMG/M
3300024283Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK11EnvironmentalOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025909Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026277Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026295Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026306Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300027665Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027821Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028704Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_379EnvironmentalOpen in IMG/M
3300028771Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369EnvironmentalOpen in IMG/M
3300028787Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381EnvironmentalOpen in IMG/M
3300028792Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_SEnvironmentalOpen in IMG/M
3300028799Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300034147Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
N57_061760802170459013Grass SoilIGVVEHVFAADAAHAAEEFAAELYSAQFDARRLMLE
INPhiseqgaiiFebDRAFT_10023363823300000364SoilGVVEHMFAEDALATLEEFQAELWSTSFDARRLGLE*
INPhiseqgaiiFebDRAFT_10037238413300000364SoilHNDRRVGVVEHVFHXDVYATLEEFRTELXSSXFDARRLDL*
INPhiseqgaiiFebDRAFT_10040309523300000364SoilAEIGIVEHVFSADAEHIVEEFAAELDSAQFEARRLELE*
AL3A1W_170090713300000886PermafrostIGVVEHIFGPDAERGLEEFVSELYSARFDSRRLDLH*
JGI1027J12803_10530148223300000955SoilEVGVVEHVFSDDVAGTLEEFRAELYSASFDTRRLGL*
JGI10216J12902_11774826413300000956SoilGVVEHHFADDVLLTVEQFHAELYSGSFDARRLLLDEVA*
P5cmW16_105539913300001664PermafrostKVGVVEHVFNEDVAGALEEFRAELYSASFDTRRLAL*
Ga0062590_10127083013300004157SoilHNDAQIGVVEHVFAADAAHAAEEFAAELYSAQFDARRLLLE*
Ga0066675_1043471323300005187SoilFHNDAEIGVVEHVFAADAAHAAEEFAAELYSAQFDARRLTLE*
Ga0070680_10075221923300005336Corn RhizosphereEIGVVEHVFAGDALRTVEEFQAELYSASFDARRLLLDEMA*
Ga0070681_1030778333300005458Corn RhizosphereNDHEIGVVAHVFEQDAAATVEAFAAELYSEHFDARRLTLERGR*
Ga0070704_10078698133300005549Corn, Switchgrass And Miscanthus RhizosphereNDREIGVVEHMLDDDRHATIEEFHAELYSASFDARRLGLD*
Ga0066707_1015733113300005556SoilEIGVVEHVFPADAERAVEEFSDELYSARFDARRLSL*
Ga0066699_1067219513300005561SoilVGVVEHVFADDVDRTLEEFRDELYSARFDARRLDLQ*
Ga0066694_1048062623300005574SoilDAEIGVVEHVFRAGAERALEEFRSELYSGTFDARRLSL*
Ga0066708_1010013643300005576SoilEIGVVEHVFESDAARTLEEFSDQLYSAHFEAARLALA*
Ga0068852_10267528313300005616Corn RhizosphereEVGVVEHVFEADAAAALDEFRSELYSATFDARRLGL*
Ga0068858_10184571113300005842Switchgrass RhizosphereVVEHVFASDIRLTIDEFQAELYSASFDARRLLLDDMA*
Ga0068860_10178219223300005843Switchgrass RhizosphereVGVVEHVFSDDLARTFEDFRAELYSASFDTRRLGL*
Ga0075270_104394713300005894Rice Paddy SoilEIGVVEHVFAGDVDHAVAAFRAELDSASFDARRLGL*
Ga0075282_101432633300005896Rice Paddy SoilEIGVVEHLFVEDAPATLDEFRAELWSASFDARRLALE*
Ga0075269_1001504213300005905Rice Paddy SoilHNDREIAVVDHVFREDVDAAVEEFRAELSSSAFDIRRLGL*
Ga0070717_1038927213300006028Corn, Switchgrass And Miscanthus RhizosphereEIGVVEHVFPDDVHATVEEFRAELWSATFDARRIDLE*
Ga0070717_1066006423300006028Corn, Switchgrass And Miscanthus RhizosphereREIGVVEHVFERDADAAVAEFRAELESESFDARRLGLE*
Ga0066696_1043146223300006032SoilGVVEHVFAEDVHATLEEFRAELWSASFDARRLALE*
Ga0066696_1051443823300006032SoilNDPEVGVVEHVFAEDVARTLEAFREELYSSRFDARRLGLE*
Ga0066696_1093580523300006032SoilGVVEHVFREDALRTLEEFQSELYAGTFDARRLDLH*
Ga0097621_10121157223300006237Miscanthus RhizospherePEIGVVEHVFASDIRLTIDEFQAELYSANFDARRLLLDDMA*
Ga0074049_1238180123300006580SoilVEHVFAGDALLTVEEFRAELYSASFDARRLLLDEIA*
Ga0066660_1032743413300006800SoilDAEIGVVEHVFAADAAHAAEEFAAELYSAEFDARRLAL*
Ga0079221_1147400213300006804Agricultural SoilGVVEHLFADDVATTVEEFRAELWSARFDARRLAL*
Ga0079220_1192203523300006806Agricultural SoilEIGIVDHLFTADAERAVEAFAAELDSAGFDSRRLQL*
Ga0075430_10138403713300006846Populus RhizosphereFHNDREVGVVPHVFASDLERVAEEFAAELYSARFDSRRLAL*
Ga0075424_10116719713300006904Populus RhizosphereHNDREIGVLGHHFDTDLETTVDAFTSELYSAGFDARRLSLG*
Ga0111539_1289277823300009094Populus RhizosphereVGVVEHVFEADAERAIEEFRVELYSGTFDTRRLAL*
Ga0066709_10138196513300009137Grasslands SoilNDAEVGVVEHVLESDAAALVAEFREELLSSAFDARRMHFH*
Ga0105091_1025326723300009146Freshwater SedimentDREVGVLEHVFPADAPQVVEEFSAELYSARFDARRLWLD*
Ga0111538_1007180873300009156Populus RhizosphereIGVVEHVFAADAGHVLEEFEAELYSARFDSRRLHLDDPPHEV*
Ga0075423_1103477813300009162Populus RhizosphereVGVVEHMFAADVDHTLEEFRAELDSAAFDYRRLALE*
Ga0126309_1125053423300010039Serpentine SoilVGVVEHVFEDDARATVEEFRADLYGASFDARRLSLQ*
Ga0126310_1106413133300010044Serpentine SoilVGVVEHVFSDDVARTLEEFRTELYSASFDTRRLGL*
Ga0127491_112852113300010111Grasslands SoilNDPEVGVVEHVFSDDVARTLEELRAELYSASFDTRRLGL*
Ga0127452_102224623300010119Grasslands SoilGVVEHLFADDLHAALDEFRAELWSAGFDARRLALE*
Ga0134065_1009440433300010326Grasslands SoilIGVVEHVFRADAKRALGEFRGELYSGTFDARRLSL*
Ga0134111_1039844513300010329Grasslands SoilNDAHVGVVEHVFTADVPPALEEFRAELYSSTFDYRRLALE*
Ga0134063_1006554613300010335Grasslands SoilEIGVVEHLFRAGAERALEEFSSELYSGTFDARRLSL*
Ga0134063_1065244323300010335Grasslands SoilGVVEHVFDADVARAAEEFAAELDSAQFDARRLAL*
Ga0126372_1283473723300010360Tropical Forest SoilDRQIGVVEHVFAADAERVVDEFAAELYSARFDSRRLGLQ*
Ga0126377_1062740013300010362Tropical Forest SoilNDGAIGVIEHVFAADTLRTIEEFRVELHSASFDARRLLL*
Ga0134125_1247681923300010371Terrestrial SoilANDREVGVVEHLFAHDADAVLDEFREELYSASFDARRLTLN*
Ga0134125_1285662123300010371Terrestrial SoilDREIGVVGHVFASDVAATIDAFTDELYSASFDARRLALD*
Ga0126383_1228273613300010398Tropical Forest SoilDAEIGVVEHVFEADAARAVEEFSAELHSARFDARRLALE*
Ga0134127_1188176623300010399Terrestrial SoilEVGVVEHVFSDDLARTLEDFRAELYSASFDTRRLTL*
Ga0126344_117067313300010866Boreal Forest SoilGVVEHVFTGDVHATVEEFRAELWSSAFDARRLAL*
Ga0105246_1129582213300011119Miscanthus RhizosphereGVVEHVFASDIRLTIDEFQAELYSANFDARRLLLDDMA*
Ga0137374_1013255513300012204Vadose Zone SoilGVVEHVFARDALRTVEEFRTELYSASFDARRLLLD*
Ga0137374_1121611813300012204Vadose Zone SoilNDPHVGVVEHVFQADVMPTIEEFHSELYSSAFDYRRLTLQ*
Ga0137380_1120928023300012206Vadose Zone SoilVVEHVFCSDLERVVEEFHAELHSGLFDARRLTLD*
Ga0137381_1033530943300012207Vadose Zone SoilGVVEHVFSDDVAGALEEFRAELYSASFDTRRLAL*
Ga0137381_1116734213300012207Vadose Zone SoilGVLPYVFPADADRMLEEFRAELDSGSFDARRLSLD*
Ga0137376_1134871413300012208Vadose Zone SoilNDPEVGVVAHVFSEDVSTMLEEFRTELYSASFDARRMAL*
Ga0137378_1110164913300012210Vadose Zone SoilEVGVVEHVFGSDLERVVEEFHTELHSGLFDARRLTLD*
Ga0137378_1139394513300012210Vadose Zone SoilVVEHVFADDATRALDEFREELYSARLDARRLDLQ*
Ga0137377_1024154213300012211Vadose Zone SoilVGVVEHVFSDDVAGALEEFRAELYSASFDTRRLAL*
Ga0137377_1148116023300012211Vadose Zone SoilVVEHVFADDATRAVEEFRSELYSPRFDARRLDLQ*
Ga0150985_10085463913300012212Avena Fatua RhizosphereHVFAGDALLTMEQFHAELYSASFDARRLLLDDVA*
Ga0150985_11710830713300012212Avena Fatua RhizosphereNDREVGVLEHVFAHDAAAAADEFHAELWSGSFDARRLALE*
Ga0137361_1006461913300012362Vadose Zone SoilIGVVEHVFAGDLETTVEEFRSELWSAAFDARRLSLD*
Ga0150984_10766856813300012469Avena Fatua RhizosphereNDREIGVVGHVFPDDATSTVEAFNAELYSASFDARRLALD*
Ga0150984_12136433313300012469Avena Fatua RhizosphereHNDLEIGVVEHVFPGDILLTVEEFGAELYSATFDARRLLLDEMA*
Ga0137373_1117479013300012532Vadose Zone SoilFHNDPQVGVVEHVFEGDAERALEEFRVELYSAAFDTRRLAL*
Ga0157295_1033572013300012906SoilPEIGVVEHVFAGDALRTVEEFQAELYSASFDARRLLLDEMA*
Ga0157286_1034841323300012908SoilDREIGVVEHVFGPDAERAVEEFAHELYSARFDARRLDLQ*
Ga0137404_1105006113300012929Vadose Zone SoilVNDRELGVVEHHFSDDAAAAVAEFQAELWSGSFDGRRLGLE*
Ga0162652_10005026023300012941SoilGVVEHVFPADAAHAAEEFAAELYSAQFDARRLMLE*
Ga0164301_1039831833300012960SoilGVVEHVFNDDVAGAIEEFRAELYSASFDTRRLTL*
Ga0164302_1009146413300012961SoilVVEHMFAEDALATLDEFQAELWSSSFDARRLALE*
Ga0164305_1223404113300012989SoilDVEIGVVEHVFAADAERAVEEFAEELYSAHFDARRLSL*
Ga0157369_1186096423300013105Corn RhizosphereVGVVEHVFAGDLQATLEEFRAELWSARFDARRLALE*
Ga0157369_1226064123300013105Corn RhizosphereGVVEQVFPDDISATLEEFRAELWSTAFDARRLSLD*
Ga0157378_1221115213300013297Miscanthus RhizosphereHNDSEIGVVEHVFPADAAHAAEEFAAELYSAQFDARRLMLE*
Ga0120123_108563313300013770PermafrostVVEHHFRGDVVTAIEEFRDELYSARFDVRRLVGLE*
Ga0163163_1068254013300014325Switchgrass RhizosphereVVEHVFARDALRTVEEFQAELYSASFDARRLLLDDMA*
Ga0137405_132026043300015053Vadose Zone SoilGVVEHVFATDAAHAAEEFAAELYSAQFDARRLML*
Ga0137418_1085114713300015241Vadose Zone SoilVGVVEHVFNDDVAGALEEFRAELYSASFDTRRLAL*
Ga0132258_1195908513300015371Arabidopsis RhizosphereQVGVVGHVFEADAERALDEFRAELYSAAFDTRRLAL*
Ga0132257_10015633763300015373Arabidopsis RhizosphereGVVEHMFAEDALATLDEFQAELWSSSFDARRLALE*
Ga0163161_1007297643300017792Switchgrass RhizosphereHNDREVGVVPHVFASDLELVVEEFAAELYSGRFDSRRLAL
Ga0184605_1001319053300018027Groundwater SedimentEIGVVEHVFPADAERAVEEFAGELYSARFDARRLSL
Ga0184619_1037112123300018061Groundwater SedimentFHNDSEIGVVEHVFPADAAYAAAEFAAELYSAQFDARRLMLE
Ga0066655_1088635223300018431Grasslands SoilIGVVEHVFTGDAETAVEEFRAELWSSTFDARRLSL
Ga0066662_1053642513300018468Grasslands SoilRAVGVVEHVFPDDVHAAVEEFRAELWSASFDARRLALE
Ga0193721_107328213300020018SoilHNDPKVGVVEHVFSDDLAHTLEDFRAELYSASFDTRRLSL
Ga0210382_1024398323300021080Groundwater SedimentFHNDAEIGVVEHVFPADAERAVEEFAGELYSARFDARRLSL
Ga0126371_1157850523300021560Tropical Forest SoilEIGVVEHMFAEDALTTVEAFREELWSSSFDARRLALE
Ga0222623_1010285243300022694Groundwater SedimentEIGVVEHVFPADAAHAAEEFAAELYSAQFDARRLMLE
Ga0247670_103949113300024283SoilREIGVVEHVFATDAERVVEEFAAALYSASFDNRRLGLH
Ga0207685_1007135143300025905Corn, Switchgrass And Miscanthus RhizosphereIGVVEHMFAEDALATLEEFQAELWSTSFDARRLALQ
Ga0207705_1129205313300025909Corn RhizosphereGVVEHVFDHDVTTVVEEFRAELYSGSFDARRLTLE
Ga0207684_1117504623300025910Corn, Switchgrass And Miscanthus RhizosphereEIGVVEHVFAADAAHVAEEFAAELYSAQFDARRLTLE
Ga0207693_1102825523300025915Corn, Switchgrass And Miscanthus RhizosphereFLNDREIGVVEHVFERDADATVAEFRAELGSESFDARRLGLE
Ga0207663_1057325513300025916Corn, Switchgrass And Miscanthus RhizosphereRVGVVEHVFHDDAYATLEEFRTELWSSGFDARRLDL
Ga0207704_1160323923300025938Miscanthus RhizospherePEIGVVEHVFARDALRTVEEFQAELYSASFDARRLLLDEMA
Ga0207711_1121006713300025941Switchgrass RhizosphereGVVEHMFAEDALATLEEFQAELWSTSFDARRLALR
Ga0207683_1148546333300026121Miscanthus RhizosphereEVGVVEHVFSDDVARTLEEFREELYSASFDSRRLGL
Ga0209350_115189713300026277Grasslands SoilQIGIVEHVFQADAERALEEFAAELYSARFDARRLSL
Ga0209234_127767923300026295Grasslands SoilIGVVAHVFADDAAATIEAFSAELYSASFDARRLTLD
Ga0209468_106598833300026306SoilHNDAEIGVVEHVFEADAARAAEEFAAELDSAEFDARRLAL
Ga0209468_118482623300026306SoilFHNDAEIGVVEHVFEADAARAVEEFAAELHSARFDARRLALE
Ga0209577_1058488713300026552SoilDAEIGVVEHVFAADAAHAAEEFAAELYSAEFDARRLAL
Ga0209983_113530913300027665Arabidopsis Thaliana RhizosphereFHNDREVGVVPHVFASDLERVVEEFAAELYSARFDSRRLAL
Ga0209811_1010573813300027821Surface SoilEIGVVEHMFAADALATLEEFQAELWSTSFDARRLALQ
Ga0209811_1026445413300027821Surface SoilGVVEHLFADDAVATADEFHAELWSGSFDARRLALE
Ga0209488_1115453413300027903Vadose Zone SoilIGVVEHVFADDAHAAIEEFRSELWSGSFDARRLALE
Ga0268264_1058011013300028381Switchgrass RhizosphereVGVVEHVFSDDLARTFEDFRAELYSASFDTRRLGL
Ga0307321_107805013300028704SoilHNDPEVGVVEHVFSDDVTRTLQEFQAELYSASFDTRRLGL
Ga0307320_1038867513300028771SoilSEIGVVEHVFPADAAHAAEEFAAELYSAQFDARRLMLE
Ga0307323_1026077823300028787SoilRRIGVVEHVFGADADRAVEEFAAELYSARFDSRRLDLH
Ga0307504_1017265813300028792SoilPKVGVVEHVFSDDLARTLEDFRAELYSASFDTRRLSL
Ga0307284_1018714023300028799SoilPEVGVVEHVFIDDVARTLEEFRSELYSASFDTRRLHL
Ga0307296_1070169913300028819SoilREVGVVEHVFSDDLRTTVEEFRAELWSASFDARRLGLE
Ga0307312_1074664023300028828SoilDHEVGVVEHVFSEDVAGTVEAFRGELYSASFDTRRLSL
Ga0310915_1075021313300031573SoilVGVVEHLFADDAAAAVDEFRSELYSTSFDARRLSL
Ga0310813_1212561413300031716SoilIGVVEHLFGGDALRTVEEFQAELYSASFDARRMLL
Ga0318498_1024056333300031778SoilFVNDREVGVVEHLFADDATAAVDEFRSELYSTSFDARRLSL
Ga0318566_1012291343300031779SoilDREVGVVEHLFADDATAAVDEFRSELYSTSFDARRLSL
Ga0318497_1052878223300031805SoilDREIGVVEHMFAEDAVATLDEFRAELWSASSDARRLALE
Ga0307473_1068953423300031820Hardwood Forest SoilGIVEHVFSADAEHIVEQYAAELDSAQFEARRLELE
Ga0318556_1038886013300032043SoilTVGVVEHVFAADAQRTVEEFRTELDSSSFDARRLRLH
Ga0318558_1069094533300032044SoilHNDMTVGVVEHVFAADAQRTVEEFRTELDSSSFDARRLRLH
Ga0335082_1124350923300032782SoilPFHNDAAVGVVEHVFPEDAARTIDEFHDELHSAAFDVRRLKLH
Ga0335081_1025703573300032892SoilIGVVEHVFADDLQAAVEEFRAELWSAAFDARRLGLS
Ga0364925_0276521_1_1113300034147SedimentHIGVVEHVFEADALHAAEVFAAELESAVFDLRRLEL

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.