Basic Information | |
---|---|
Family ID | F059053 |
Family Type | Metagenome |
Number of Sequences | 134 |
Average Sequence Length | 48 residues |
Representative Sequence | MPAPTVAPDDDERVPIFGTWPRIYAAVILCELAVMALIALFSSWKY |
Number of Associated Samples | 113 |
Number of Associated Scaffolds | 134 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 65.41 % |
% of genes near scaffold ends (potentially truncated) | 30.60 % |
% of genes from short scaffolds (< 2000 bps) | 86.57 % |
Associated GOLD sequencing projects | 102 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.45 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (99.254 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (16.418 % of family members) |
Environment Ontology (ENVO) | Unclassified (31.343 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (57.463 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 32.43% β-sheet: 0.00% Coil/Unstructured: 67.57% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 134 Family Scaffolds |
---|---|---|
PF00474 | SSF | 56.72 |
PF07690 | MFS_1 | 18.66 |
PF00083 | Sugar_tr | 11.94 |
PF06808 | DctM | 1.49 |
PF00664 | ABC_membrane | 0.75 |
PF13505 | OMP_b-brl | 0.75 |
PF00206 | Lyase_1 | 0.75 |
PF00472 | RF-1 | 0.75 |
PF05690 | ThiG | 0.75 |
PF01564 | Spermine_synth | 0.75 |
PF02887 | PK_C | 0.75 |
PF13462 | Thioredoxin_4 | 0.75 |
PF03109 | ABC1 | 0.75 |
PF02597 | ThiS | 0.75 |
COG ID | Name | Functional Category | % Frequency in 134 Family Scaffolds |
---|---|---|---|
COG0214 | Pyridoxal 5'-phosphate synthase subunit PdxS | Coenzyme transport and metabolism [H] | 0.75 |
COG0216 | Protein chain release factor RF1 | Translation, ribosomal structure and biogenesis [J] | 0.75 |
COG0469 | Pyruvate kinase | Carbohydrate transport and metabolism [G] | 0.75 |
COG0661 | Predicted protein kinase regulating ubiquinone biosynthesis, AarF/ABC1/UbiB family | Signal transduction mechanisms [T] | 0.75 |
COG1186 | Protein chain release factor PrfB | Translation, ribosomal structure and biogenesis [J] | 0.75 |
COG1977 | Molybdopterin synthase sulfur carrier subunit MoaD | Coenzyme transport and metabolism [H] | 0.75 |
COG2022 | Thiazole synthase ThiGH, ThiG subunit (thiamin biosynthesis) | Coenzyme transport and metabolism [H] | 0.75 |
COG2070 | NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase family | General function prediction only [R] | 0.75 |
COG2104 | Sulfur carrier protein ThiS (thiamine biosynthesis) | Coenzyme transport and metabolism [H] | 0.75 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 99.25 % |
Unclassified | root | N/A | 0.75 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000891|JGI10214J12806_11726805 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
3300000955|JGI1027J12803_100082145 | All Organisms → cellular organisms → Bacteria | 1083 | Open in IMG/M |
3300002906|JGI25614J43888_10213279 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
3300003324|soilH2_10279465 | All Organisms → cellular organisms → Bacteria | 1370 | Open in IMG/M |
3300004114|Ga0062593_101798562 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
3300004156|Ga0062589_101958324 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
3300004156|Ga0062589_102297664 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 554 | Open in IMG/M |
3300004463|Ga0063356_102488864 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
3300004480|Ga0062592_100904053 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 796 | Open in IMG/M |
3300005093|Ga0062594_100124058 | All Organisms → cellular organisms → Bacteria | 1617 | Open in IMG/M |
3300005172|Ga0066683_10635749 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
3300005293|Ga0065715_11028006 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
3300005330|Ga0070690_100156174 | All Organisms → cellular organisms → Bacteria | 1560 | Open in IMG/M |
3300005330|Ga0070690_101458352 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 552 | Open in IMG/M |
3300005347|Ga0070668_100231841 | All Organisms → cellular organisms → Bacteria | 1527 | Open in IMG/M |
3300005355|Ga0070671_101884735 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
3300005356|Ga0070674_100662945 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
3300005366|Ga0070659_100970728 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
3300005406|Ga0070703_10478241 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
3300005468|Ga0070707_102116320 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
3300005471|Ga0070698_100625352 | All Organisms → cellular organisms → Bacteria | 1017 | Open in IMG/M |
3300005471|Ga0070698_101923984 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 544 | Open in IMG/M |
3300005518|Ga0070699_101792905 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
3300005536|Ga0070697_100782991 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
3300005536|Ga0070697_102045982 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
3300005545|Ga0070695_100516537 | All Organisms → cellular organisms → Bacteria | 926 | Open in IMG/M |
3300005547|Ga0070693_101013012 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
3300005553|Ga0066695_10592252 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
3300005553|Ga0066695_10786594 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
3300005569|Ga0066705_10037252 | All Organisms → cellular organisms → Bacteria | 2662 | Open in IMG/M |
3300005718|Ga0068866_10747104 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
3300006049|Ga0075417_10613545 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 554 | Open in IMG/M |
3300006058|Ga0075432_10525118 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 531 | Open in IMG/M |
3300006353|Ga0075370_10382849 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 843 | Open in IMG/M |
3300006353|Ga0075370_10850834 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
3300006755|Ga0079222_11849261 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 586 | Open in IMG/M |
3300006844|Ga0075428_100564475 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1216 | Open in IMG/M |
3300006845|Ga0075421_100003047 | All Organisms → cellular organisms → Bacteria | 20036 | Open in IMG/M |
3300006845|Ga0075421_100168258 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2733 | Open in IMG/M |
3300006845|Ga0075421_101521810 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
3300006847|Ga0075431_101318701 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
3300006852|Ga0075433_10222369 | All Organisms → cellular organisms → Bacteria | 1677 | Open in IMG/M |
3300006852|Ga0075433_10937548 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
3300006854|Ga0075425_103077418 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300006871|Ga0075434_101253922 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
3300006894|Ga0079215_10569968 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
3300006904|Ga0075424_100578986 | All Organisms → cellular organisms → Bacteria | 1199 | Open in IMG/M |
3300006954|Ga0079219_11655871 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
3300006969|Ga0075419_11358337 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
3300007004|Ga0079218_12080935 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
3300007265|Ga0099794_10277802 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 866 | Open in IMG/M |
3300009089|Ga0099828_10623821 | All Organisms → cellular organisms → Bacteria | 970 | Open in IMG/M |
3300009090|Ga0099827_10496997 | All Organisms → cellular organisms → Bacteria | 1048 | Open in IMG/M |
3300009094|Ga0111539_10000712 | All Organisms → cellular organisms → Bacteria | 43173 | Open in IMG/M |
3300009100|Ga0075418_10170253 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2319 | Open in IMG/M |
3300009100|Ga0075418_11593667 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
3300009147|Ga0114129_10312266 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2092 | Open in IMG/M |
3300009147|Ga0114129_10754008 | All Organisms → cellular organisms → Bacteria | 1246 | Open in IMG/M |
3300009156|Ga0111538_13087085 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
3300010399|Ga0134127_11082539 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
3300010400|Ga0134122_10021044 | All Organisms → cellular organisms → Bacteria | 4899 | Open in IMG/M |
3300010400|Ga0134122_10189083 | All Organisms → cellular organisms → Bacteria | 1701 | Open in IMG/M |
3300010401|Ga0134121_11618692 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 668 | Open in IMG/M |
3300010403|Ga0134123_12159403 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
3300012204|Ga0137374_10154497 | All Organisms → cellular organisms → Bacteria | 2043 | Open in IMG/M |
3300012350|Ga0137372_10254011 | All Organisms → cellular organisms → Bacteria | 1381 | Open in IMG/M |
3300012360|Ga0137375_10058352 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4156 | Open in IMG/M |
3300012532|Ga0137373_10407901 | All Organisms → cellular organisms → Bacteria | 1054 | Open in IMG/M |
3300012685|Ga0137397_10329895 | All Organisms → cellular organisms → Bacteria | 1137 | Open in IMG/M |
3300012903|Ga0157289_10149332 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
3300012912|Ga0157306_10260947 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
3300012922|Ga0137394_10111120 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2314 | Open in IMG/M |
3300012922|Ga0137394_11435067 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 550 | Open in IMG/M |
3300012922|Ga0137394_11446527 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 547 | Open in IMG/M |
3300012944|Ga0137410_10503814 | All Organisms → cellular organisms → Bacteria | 990 | Open in IMG/M |
3300012944|Ga0137410_11335390 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
3300012960|Ga0164301_11811941 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
3300014745|Ga0157377_10007159 | All Organisms → cellular organisms → Bacteria | 5368 | Open in IMG/M |
3300015245|Ga0137409_10777466 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 792 | Open in IMG/M |
3300015372|Ga0132256_100865387 | All Organisms → cellular organisms → Bacteria | 1020 | Open in IMG/M |
3300015374|Ga0132255_103800412 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
3300017792|Ga0163161_11768840 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
3300018054|Ga0184621_10323569 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
3300018056|Ga0184623_10049595 | All Organisms → cellular organisms → Bacteria | 1915 | Open in IMG/M |
3300018063|Ga0184637_10315438 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 945 | Open in IMG/M |
3300022756|Ga0222622_10246696 | All Organisms → cellular organisms → Bacteria | 1208 | Open in IMG/M |
3300022880|Ga0247792_1105744 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
3300023066|Ga0247793_1083328 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
3300023072|Ga0247799_1057918 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
3300025899|Ga0207642_10412944 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 810 | Open in IMG/M |
3300025899|Ga0207642_10685632 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
3300025899|Ga0207642_11039594 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
3300025900|Ga0207710_10110594 | All Organisms → cellular organisms → Bacteria | 1304 | Open in IMG/M |
3300025910|Ga0207684_10039011 | All Organisms → cellular organisms → Bacteria | 4030 | Open in IMG/M |
3300025921|Ga0207652_11841065 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300025922|Ga0207646_10028935 | All Organisms → cellular organisms → Bacteria | 5040 | Open in IMG/M |
3300025931|Ga0207644_10698759 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 846 | Open in IMG/M |
3300025933|Ga0207706_11381612 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
3300025972|Ga0207668_10978501 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
3300025981|Ga0207640_10146994 | All Organisms → cellular organisms → Bacteria | 1726 | Open in IMG/M |
3300026075|Ga0207708_11637527 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
3300026089|Ga0207648_11213454 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 708 | Open in IMG/M |
3300026304|Ga0209240_1072102 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1284 | Open in IMG/M |
3300026319|Ga0209647_1121417 | All Organisms → cellular organisms → Bacteria | 1195 | Open in IMG/M |
3300027875|Ga0209283_10499914 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
3300027880|Ga0209481_10721729 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
3300027882|Ga0209590_10576680 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
3300027909|Ga0209382_10002739 | All Organisms → cellular organisms → Bacteria | 25135 | Open in IMG/M |
3300027909|Ga0209382_10089315 | All Organisms → cellular organisms → Bacteria | 3621 | Open in IMG/M |
3300028380|Ga0268265_10358934 | All Organisms → cellular organisms → Bacteria | 1333 | Open in IMG/M |
3300028589|Ga0247818_11045982 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
3300028819|Ga0307296_10749861 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
3300028828|Ga0307312_10236017 | All Organisms → cellular organisms → Bacteria | 1181 | Open in IMG/M |
3300028828|Ga0307312_10839954 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 609 | Open in IMG/M |
3300028885|Ga0307304_10173070 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
3300031184|Ga0307499_10274117 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
3300031226|Ga0307497_10447149 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
3300031229|Ga0299913_10023138 | All Organisms → cellular organisms → Bacteria | 5775 | Open in IMG/M |
3300031366|Ga0307506_10309189 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 621 | Open in IMG/M |
3300031366|Ga0307506_10376297 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
3300031538|Ga0310888_10598695 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 669 | Open in IMG/M |
3300031908|Ga0310900_10147858 | All Organisms → cellular organisms → Bacteria | 1586 | Open in IMG/M |
3300031965|Ga0326597_10405296 | All Organisms → cellular organisms → Bacteria | 1514 | Open in IMG/M |
3300032002|Ga0307416_102200485 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
3300032013|Ga0310906_11237155 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
3300032122|Ga0310895_10024592 | All Organisms → cellular organisms → Bacteria | 1991 | Open in IMG/M |
3300032770|Ga0335085_11428413 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
3300033433|Ga0326726_11688127 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
3300033550|Ga0247829_10875411 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
3300033803|Ga0314862_0083492 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 726 | Open in IMG/M |
3300033803|Ga0314862_0177441 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
3300034090|Ga0326723_0020190 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2716 | Open in IMG/M |
3300034151|Ga0364935_0135621 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 773 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 16.42% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 12.69% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.96% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.48% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.48% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.73% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.73% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.73% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.99% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.99% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.24% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.24% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.24% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 1.49% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.49% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.49% |
Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 1.49% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.49% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.75% |
Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.75% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.75% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.75% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.75% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.75% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.75% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.75% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.75% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.75% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.75% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.75% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.75% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.75% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.75% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.75% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.75% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300002906 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm | Environmental | Open in IMG/M |
3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
3300006353 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Host-Associated | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012903 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1 | Environmental | Open in IMG/M |
3300012912 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2 | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300022880 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S106-311C-6 | Environmental | Open in IMG/M |
3300023066 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S223-509R-6 | Environmental | Open in IMG/M |
3300023072 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S151-409C-6 | Environmental | Open in IMG/M |
3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
3300031184 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S | Environmental | Open in IMG/M |
3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
3300031366 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_S | Environmental | Open in IMG/M |
3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
3300032122 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4 | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
3300033803 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_0_10 | Environmental | Open in IMG/M |
3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
3300034151 | Sediment microbial communities from East River floodplain, Colorado, United States - 2_s17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI10214J12806_117268051 | 3300000891 | Soil | PVPDDDERVPIFGTWPRIYAAVILCELVSMALIALFSSWNY* |
JGI1027J12803_1000821451 | 3300000955 | Soil | TVAPDDDERVPIFGTWPRIYAAVILCELAVMALIAAFSHWKY* |
JGI25614J43888_102132792 | 3300002906 | Grasslands Soil | MSVGPEEDTMPVTMAPDEDERVPIFGTWPRIYAAVILCALAVMGLVAVFSSWKY* |
soilH2_102794652 | 3300003324 | Sugarcane Root And Bulk Soil | MQPTPRSAAPDDDERVPVFGTWPAIYTAVIATAITVMGLIAVFTNWPW* |
Ga0062593_1017985622 | 3300004114 | Soil | MSVGMQEDTMPPTSAAPDDDERVPIFGTWARIYAAVILCELVSMALIALFSAWKY* |
Ga0062589_1019583242 | 3300004156 | Soil | SIMSVGPVEDAMPAPSTTPDDDERVPIFGTWPRIYAAVILCELAVMALIALFSAWKY* |
Ga0062589_1022976642 | 3300004156 | Soil | MSVGPEEDTMPATSAPPDDDEHVPIFGTWPRIYAAVILCALAVMGLIAVFSGWKY* |
Ga0063356_1024888642 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MSVGSQEDTMPAPRAAPDDDERVPIFGTWARIYAAVILCELVSMALIAVFSAWKY* |
Ga0062592_1009040531 | 3300004480 | Soil | MPATTPVPDDDERVPIFGTWPRIYAAVILCELVSMALIALFSSWNY* |
Ga0062594_1001240582 | 3300005093 | Soil | MSVGFQEDRMPATTPVPDDDERVPIFGTWPRIYAAVILCELASMALIALFSSWNY* |
Ga0066683_106357492 | 3300005172 | Soil | MPVTMAPDEDERVPIFGTWPRIYAAVILCALAVMGLIAVFSAWKY* |
Ga0065715_110280062 | 3300005293 | Miscanthus Rhizosphere | MPAPTVAPDDDERVPIFGTWPRIYAAVILCELAVMALIALFSTWKY* |
Ga0070690_1001561742 | 3300005330 | Switchgrass Rhizosphere | MPAPTVAPDDDERVPIFGTWPRIYAAVILCELAVMALIALFSSWKY* |
Ga0070690_1014583522 | 3300005330 | Switchgrass Rhizosphere | MPATTPVPDDEERVPIFGTWPRIYAAVILCELVSMALIALFSSWNY* |
Ga0070668_1002318412 | 3300005347 | Switchgrass Rhizosphere | MPATTPVPDDDERVPIFGTWPRIYAAVILCELASMALIALFSSWNY* |
Ga0070671_1018847352 | 3300005355 | Switchgrass Rhizosphere | MPAPTVAPDDDERVPIFGTWPRIYAAVILCELTVMALIALFSSWKY* |
Ga0070674_1006629452 | 3300005356 | Miscanthus Rhizosphere | MDDPDHRVPIFRTWPRIYAAVIVVNVAAIALVALFAAWPF* |
Ga0070659_1009707281 | 3300005366 | Corn Rhizosphere | MSVGFQEDRMPATTPVPDDEERVPIFGTWPRIYAAVILCELAVMALIALFSTWKY* |
Ga0070703_104782411 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | EDRMPATTPVPDDDERVPIFGTWPRIYAAVILCELASMALIALFSSWNY* |
Ga0070707_1021163201 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MPAPTVAPDDDERVPIFGTWPRIYAAVILCELVVMALIALFSHWKY* |
Ga0070698_1006253522 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | ARSSSAHNVRRPQEDTMPVTMAPDEDERVPIFGTWPRIYAAVILCALAVMGLIAVFSSWKY* |
Ga0070698_1019239842 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | RSSSAHNVRRPQEDTMPVTMAPDEDERVPIFGTWPRIYAAVIVCALAVMGLIAVFSGWKY |
Ga0070699_1017929052 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MPVTMAPDEDERVPIFGTWPRIYAAVILCALAVMGLIAVFSSWKY* |
Ga0070697_1007829912 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MSLGPEEHTMPATNPARDDDERVPIFGTWPRIYAAVILCELVVMALIALFSHWKY* |
Ga0070697_1020459822 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MPVTTAPDEDERVPIFRTWPRIYAAVILCALAVMGLIAVFSSWKY* |
Ga0070695_1005165371 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MSVGFQEDRMPATTPVPDDDERVPIFGTWPRIYAAVILCELAVMALIALFSTWKY* |
Ga0070693_1010130122 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MTVGPREDTMPATETAPDDEERVPIFGTWPRIYAAVILCELASLALIALFSSWKY* |
Ga0066695_105922522 | 3300005553 | Soil | EQVPIFRTWPRIYAAVIVCAVVVMALIGVFSAWPW* |
Ga0066695_107865941 | 3300005553 | Soil | ARSSSAHNVRRPEEDTMPVTMAPDEHERVPIFGTWPRIYAAVIVCAVAVMALVALFSSFHY* |
Ga0066705_100372522 | 3300005569 | Soil | MERPPDSPEPDEQEPVPIFGTWPRIYAAVIVCTLVAMGLIALFASWDY* |
Ga0068866_107471042 | 3300005718 | Miscanthus Rhizosphere | MDDPDDRVPIFRTWPRIYAAVIVVNVAAIALVALFAAWPF* |
Ga0075417_106135451 | 3300006049 | Populus Rhizosphere | MDEHDEEVPIFRTWPRIYAAVIVCAVVVMALIGVFSKWPW* |
Ga0075432_105251181 | 3300006058 | Populus Rhizosphere | APDEDERVPIFGTWPRIYAAVIVCALAVMGLIAVFSSWKY* |
Ga0075370_103828491 | 3300006353 | Populus Endosphere | MPATTPVPDDDERVPIFGTWPRIYAAVILCELAVMALIALFSAWKY* |
Ga0075370_108508341 | 3300006353 | Populus Endosphere | ERVPIFGTWPRIYAAVILCELVSMALIALFSSWNY* |
Ga0079222_118492612 | 3300006755 | Agricultural Soil | TPAPDDDERVPIFGTWPRIYAAVILCELVAMALIALFSSWNY* |
Ga0075428_1005644752 | 3300006844 | Populus Rhizosphere | MPATTPMPDDEERVPIFGTWPRIYAAVILCELVSMALIALFSSWNY* |
Ga0075421_10000304718 | 3300006845 | Populus Rhizosphere | MAVGPEEDTMPAPSPAPDDAENVPIFGTWPRIYAAVILCELVSMALIALFSAWKY* |
Ga0075421_1001682583 | 3300006845 | Populus Rhizosphere | MPVTMPAPDDEERVPIFGTWPRIYAAVILCELVTMGLIAIFSSWNY* |
Ga0075421_1015218102 | 3300006845 | Populus Rhizosphere | MPVSPAAPDDDERVPIFGTWPRIYAAVILCALAVMGLIAVFSGWKY* |
Ga0075431_1013187012 | 3300006847 | Populus Rhizosphere | MTVGPREDTMPATDAAPDDEERVPIFGTWPRIYAAVLLCELVSLALIALFSSWNY* |
Ga0075433_102223692 | 3300006852 | Populus Rhizosphere | MSVGPEEDTMPAPTPAPDDDERVPIFGTWPRIYAAVIFCELGVMALIAVFSHWKY* |
Ga0075433_109375482 | 3300006852 | Populus Rhizosphere | MPVTMAPDEDERVPIFRTWPRIYAAVILCALAVMGLIAVFSSWKY* |
Ga0075425_1030774182 | 3300006854 | Populus Rhizosphere | DERVPIFGTWPRIYAAVIVCELAVMALIALFSHWKY* |
Ga0075434_1012539222 | 3300006871 | Populus Rhizosphere | MPAPTVAPDDDERVPIFGTWPRIYAAVILCELAVMALIALFSAWKY* |
Ga0079215_105699682 | 3300006894 | Agricultural Soil | MSVGPEEDTMPATSAAPDDDERVPIFGTWPRIYAAVILCALAVMGLIAVFSGWKY* |
Ga0075424_1005789862 | 3300006904 | Populus Rhizosphere | DERVPIFGTWPRIYAAVILCELASLALIALFSSWNY* |
Ga0079219_116558711 | 3300006954 | Agricultural Soil | SSWTPAPDGDERVPIFGTWPRIYAAVILCELVAMALIALFSSWNY* |
Ga0075419_113583372 | 3300006969 | Populus Rhizosphere | MSVGPQEDTMPPTSAAPDDDERVPIFGTWARIYAAVILCALAVMGLIAVFSGWKY* |
Ga0079218_120809352 | 3300007004 | Agricultural Soil | MDEERDERVPIFGTWPRIYAAVIVCNLVSMALIALFSAWNF* |
Ga0099794_102778022 | 3300007265 | Vadose Zone Soil | MSVGPEEDTMAVTTPAPDDDERLPIFGTWPRIYAAVILCALAVMGLIAVFSSWKY* |
Ga0099828_106238211 | 3300009089 | Vadose Zone Soil | AGDDHDPVPIFGTWPRIYAAVIICALSVMGLIALFSSWKY* |
Ga0099827_104969972 | 3300009090 | Vadose Zone Soil | MPVTTAPDDDERVPIFGTWPRIYAAVILCALAVMGLIAVFSSWKY* |
Ga0111539_1000071216 | 3300009094 | Populus Rhizosphere | MSVGLQEDRMPATTPVPDDEERVPIFGTWPRIYAAVILCELVSMALIALFSSWNY* |
Ga0075418_101702531 | 3300009100 | Populus Rhizosphere | MSVGLQEDRMPATTPMPDDEERVPIFGTWPRIYAAVILCELVSMALIALFSSWNY* |
Ga0075418_115936672 | 3300009100 | Populus Rhizosphere | MAVGLQEDRMPATTPMPDDDERVPIFGTWPRIYAAVILCELVSMALIALFSSWNY* |
Ga0114129_103122661 | 3300009147 | Populus Rhizosphere | MAVGPEEDTMPAPSPAPDDAENVPIFGTWPRIYAAVILCELVSMALIALFSA |
Ga0114129_107540082 | 3300009147 | Populus Rhizosphere | MSVGLQEDRMPATTPMPDDEERVPIFGTWPRIYAAVILCELVSMALIALFSAWKY* |
Ga0111538_130870851 | 3300009156 | Populus Rhizosphere | MSVGFQEDRMPATTPVPDDDERVPIFGTWPRIYAAVILCELAVMALIALFSSWNY* |
Ga0134127_110825392 | 3300010399 | Terrestrial Soil | MSVGSQEDAMPATTPVPDDDERVPIFGTWPRIYAAVILCELACLALIALFSSWKY* |
Ga0134122_100210442 | 3300010400 | Terrestrial Soil | MSVGFQEDRMPATTPVPDDDERVPIFGTWPRIYAAVMLCELASMALIALFSSWNY* |
Ga0134122_101890832 | 3300010400 | Terrestrial Soil | MTVGPREDTMPATETAPDDEERVPIFGTWPRIYAAVILCELASLALIALFSSWNY* |
Ga0134121_116186921 | 3300010401 | Terrestrial Soil | MPAPTVAPDDDERVPIFGTWPRIYAAVILCELVVMALIALFSTWKY* |
Ga0134123_121594031 | 3300010403 | Terrestrial Soil | GRPEGGHDAATETAPDDEERVPIFGTWPRIYAAVILCELASLALIALFSSWNY* |
Ga0137374_101544972 | 3300012204 | Vadose Zone Soil | MPVTMAPDEGERVPIFGTWPRIYAAVILCALAVMGLIAVFSSWKY* |
Ga0137372_102540112 | 3300012350 | Vadose Zone Soil | MPATSPAPDDDERVPIFGTWPGIYAAVILCALAVMGLIAVFSSWKY* |
Ga0137375_100583523 | 3300012360 | Vadose Zone Soil | MPVTMAPDDDERVPIFGTWPRIYAAVILCALAVMALIAVFSSWKY* |
Ga0137373_104079012 | 3300012532 | Vadose Zone Soil | MPVTMAPDEGERVPIFGTWPRIYAAVILCALAVMALIAVFSSWKY* |
Ga0137397_103298951 | 3300012685 | Vadose Zone Soil | APTVAPDDDERVPIFGTWPRIYAAVILCALAVMALIAVFSGWKY* |
Ga0157289_101493322 | 3300012903 | Soil | MAVGPRRTPMPAPTVAPDDDERVPIFGTWPRIYAAVILCELAVMALIALFSSWKY* |
Ga0157306_102609471 | 3300012912 | Soil | REDTMPATDAEPDDEERVPIFGTWPRIYAAVILCELAVMALIALFSTWKY* |
Ga0137396_104396753 | 3300012918 | Vadose Zone Soil | MNDDEAERVPIFGTWPRIYAAVVLCAVVVMALVYLFSVWPY* |
Ga0137394_101111203 | 3300012922 | Vadose Zone Soil | APDDDERVPIFGTWPRIYAAVILCALAVMGLIAVFSSWKY* |
Ga0137394_114350672 | 3300012922 | Vadose Zone Soil | MSVGPEEDTMPATSAAPDDDERVPIFGTWPRIYAAVILCALAVMGLIAVFSSWKY* |
Ga0137394_114465272 | 3300012922 | Vadose Zone Soil | MPAPTVAPDDDERVPIFGTWPRIYAAVILCALAVMGLIAVFSSWKY* |
Ga0137410_105038142 | 3300012944 | Vadose Zone Soil | MSVGPEEDMMPATSAAPDDDERVPIFGTWPRIYAAVILCALAVMGLIAVFSAWKY* |
Ga0137410_113353902 | 3300012944 | Vadose Zone Soil | MPAPTVAPDDDERVPIFGTWPRIYAAVILCALAVMALIAVFSGWKY* |
Ga0164301_118119411 | 3300012960 | Soil | MAVGPRRTPMPAPTVAPDDDERVPIFGTWPRIYAAVILCELAVMALIAAFSHWKF* |
Ga0157377_100071592 | 3300014745 | Miscanthus Rhizosphere | MSVGLQEDRMPATTPVPDDDERVPIFGTWPRIYAAVILCELASMALIALFSSWNY* |
Ga0137409_107774662 | 3300015245 | Vadose Zone Soil | MSVGPEEDMMPATSAAPDDDERVPIFGTWPRIYAAVILCALAVMGLIAVFSSWKY |
Ga0132256_1008653872 | 3300015372 | Arabidopsis Rhizosphere | DDEERVPIFGTWPRIYAAVILCELVSMALIALFSSWNY* |
Ga0132255_1038004121 | 3300015374 | Arabidopsis Rhizosphere | PVPDDDERVPIFGTWPRIYAAVILCELVSMALIAVFSAWNY* |
Ga0163161_117688401 | 3300017792 | Switchgrass Rhizosphere | DEERVPIFGTWPRIYAAVILCELVSMALIALFSSWNY |
Ga0184621_103235691 | 3300018054 | Groundwater Sediment | GDQGPRARVTSIMSVGSEEDTIPVSPAAPDDDEHVPIFGTWPRIYAAVILCALAIMGLIAVFSSWKY |
Ga0184623_100495951 | 3300018056 | Groundwater Sediment | MDEEPDERVPIFGTWPRIYAAVIVCNLAVMALIALFSAWNF |
Ga0184637_103154382 | 3300018063 | Groundwater Sediment | MDEEPDERVPIFGTWPRIYAAVIVCNLAVMALIALFSAWNY |
Ga0222622_102466962 | 3300022756 | Groundwater Sediment | MSVGPEEDTMPVSPAAPDDDEHVPIFGTWPRIYAAVIFCALAIMGLIAVFSSWKY |
Ga0247792_11057442 | 3300022880 | Soil | MSVGLQEDRMPATTPVPDDDERVPIFGTWPRIYAAVILCELVSMALIALFSSWNY |
Ga0247793_10833282 | 3300023066 | Soil | MSVGMQEDTMPPTSAAPDDDERVPIFGTWARIYAAVILCELVSMALIALFSAWKY |
Ga0247799_10579182 | 3300023072 | Soil | QGPPARVAPIMSVGMQEDTMPPTSAAPDDDERVPIFGTWARIYAAVILCELVSMALIALFSAWKY |
Ga0207642_104129442 | 3300025899 | Miscanthus Rhizosphere | MPATTPVPDDDERVPIFGTWPRIYAAVILCELAVMVLIALFSSWKY |
Ga0207642_106856322 | 3300025899 | Miscanthus Rhizosphere | MDDPDDRVPIFRTWPRIYAAVIVVNVAAIALVALFAAWPF |
Ga0207642_110395942 | 3300025899 | Miscanthus Rhizosphere | APDDDERVPIFGTWPRIYAAVILCELAVMVLIALFSSWKY |
Ga0207710_101105941 | 3300025900 | Switchgrass Rhizosphere | MSVGFQEDRMPATTPVPDDDERVPIFGTWPRIYAAVILCELASMALIALFSSWNY |
Ga0207684_100390113 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MPVTMAPDEDERVPIFATWPRIYAAVIVCALAVMGLIAVFSGWKY |
Ga0207652_118410651 | 3300025921 | Corn Rhizosphere | IMSVGFQEDRMPATTPVPDDDERVPIFGTWPRIYAAVILCELASMALIALFSSWNY |
Ga0207646_100289352 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MPVTMAPDEDERVPIFGTWPRIYAAVIVCALAVMGLIAVFSGWKY |
Ga0207644_106987592 | 3300025931 | Switchgrass Rhizosphere | MPAPTVAPDDDERVPIFGTWPRIYAAVILCELTVMALIALFSSWKY |
Ga0207706_113816122 | 3300025933 | Corn Rhizosphere | MPATTPVPDDDERVPIFGTWPRIYAAVILCELVSMALIALFSSWNY |
Ga0207668_109785012 | 3300025972 | Switchgrass Rhizosphere | TTPVPDDEERVPIFGTWPRIYAAVILCELVSMALIALFSSWNY |
Ga0207640_101469942 | 3300025981 | Corn Rhizosphere | MPAPTVAPDDDERVPIFGTWPRIYAAVILCELASMALIALFSSWNY |
Ga0207708_116375272 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MPATTPVPDDEERVPIFGTWPRIYAAVILCELVSMALIALFSSWNY |
Ga0207648_112134542 | 3300026089 | Miscanthus Rhizosphere | MPAPTVAPDDDERVPIFGTWPRIYAAVILCELAVMALIALFSAWKY |
Ga0209240_10721022 | 3300026304 | Grasslands Soil | MPVTTAPDDDERVPIFGTWPRIYAAVILCALAVMGLIAVFSSWKY |
Ga0209647_11214172 | 3300026319 | Grasslands Soil | MPVTMAPDEDERVPIFGTWPRIYAAVILCALAVMGLVAVFSSWKY |
Ga0209283_104999142 | 3300027875 | Vadose Zone Soil | VDDDDEPVPIFGTWPRIYAAVALCAVVVMALVYVFSVWPY |
Ga0209481_107217292 | 3300027880 | Populus Rhizosphere | DDEERVPIFGTWPRIYAAVILCELVSMALIALFSSWNY |
Ga0209590_105766801 | 3300027882 | Vadose Zone Soil | PFSCRRPRAARSSSAHNVRRHEEDTMPVTTAPDDDERVPIFGTWPRIYAAVILCALAVMGLIAVFSSWKY |
Ga0209382_1000273915 | 3300027909 | Populus Rhizosphere | MAVGPEEDTMPAPSPAPDDAENVPIFGTWPRIYAAVILCELVSMALIALFSAWKY |
Ga0209382_100893152 | 3300027909 | Populus Rhizosphere | MPVTMPAPDDEERVPIFGTWPRIYAAVILCELVTMGLIAIFSSWNY |
Ga0268265_103589342 | 3300028380 | Switchgrass Rhizosphere | MPATTPVPDDDERVPIFGTWPRIYAAVILCELASMALIALFSSWNY |
Ga0247818_110459822 | 3300028589 | Soil | ARDEGPPARVASIMSVGLQEDRMPATTSVPDDDERVPIFGTWPRIYAAVILCELASMALIALFSVWKY |
Ga0307296_107498611 | 3300028819 | Soil | ARVAPIMSLGPEEDTMPVTTAPDDDERVPIFGTWPRIYAAVIFCALAVMGLIAVFSGWKY |
Ga0307312_102360172 | 3300028828 | Soil | MPVTMAPDEDERVPIFGTWPRIYAAVILCALAVMGLIAVFSGWKY |
Ga0307312_108399542 | 3300028828 | Soil | MSVGPEEDTMPATNAAPDDDERVPIFGTWPRIYAAVILCELVSLALIALFSAWKY |
Ga0307304_101730701 | 3300028885 | Soil | RVASIMSVGPEEDTMPATNAAPDDDERVPIFGTWPRIYAAVILCELVSLALIALFSAWKY |
Ga0307499_102741172 | 3300031184 | Soil | MPATDAAPEDDERVPIFGTWPRIYGAVILCELVAMALIALFSSWNY |
Ga0307497_104471492 | 3300031226 | Soil | EDDERVPIFGTWPRIYAAVILCELVSMALIAVFSSWNY |
Ga0299913_100231381 | 3300031229 | Soil | MDEPPDDPVPIFGTWPRIYAAVIVWTLANLALIALFSAWAY |
Ga0307506_103091892 | 3300031366 | Soil | MAVGPREDTMPATDAAPDDEERVPIFGTWPRIYAAVILCELVSMALIAVFSAWNY |
Ga0307506_103762972 | 3300031366 | Soil | DTMPVTSAPPNDDERVPIFGTWPRIYAAVLLCALAVMALIAVFSGWKY |
Ga0310888_105986952 | 3300031538 | Soil | MPATTPVPDDDERVPIFGTWPRIYAAVILCELASLALIALFSSWNY |
Ga0310900_101478582 | 3300031908 | Soil | DDERVPIFGTWPRIYAAVILCELASMALIALFSSWNY |
Ga0326597_104052962 | 3300031965 | Soil | MDEEPDERVPIFGTWPRIYAAVIVCNLAIMALIALFSAWNY |
Ga0307416_1022004851 | 3300032002 | Rhizosphere | MSVGPQEDTMPPTSAAPDDDERVPIFGTWARIYAAVILCALAVMGLIAVFSGWKY |
Ga0310906_112371551 | 3300032013 | Soil | MSVGFQEDRMPATTPVPDDEERVPIFGTWPRIYAAVILCELASMALIALFSSWNY |
Ga0310895_100245922 | 3300032122 | Soil | MPATTPVPDDDERVTIFGTWPRIYAAVILCELASMALIALFSSWNY |
Ga0335085_114284132 | 3300032770 | Soil | VEPPDDERVPLFGTWPRIYAAVILVNLLVLALVALFSAGTY |
Ga0326726_116881272 | 3300033433 | Peat Soil | LPDDDHVPIFGTWPRIYAAVVISALAVMALVALFSSWTY |
Ga0247829_108754112 | 3300033550 | Soil | MAVPTMQEPPDDPVPVFGTWPRIYAAVILCALFSMALIALFSGWPF |
Ga0314862_0083492_368_508 | 3300033803 | Peatland | VEPAGQPPTDDERVPIFGSWPRIYAAVVLCALAWMGLIAAFQRWPY |
Ga0314862_0177441_341_472 | 3300033803 | Peatland | MDQEGPDEGTVPVFGTWRRIYAAVILTALIAIGLTAVFSHWDY |
Ga0326723_0020190_209_328 | 3300034090 | Peat Soil | LPDDDHVPIFGTWPRIYAAVVATALVVMAFVALFSSWPY |
Ga0364935_0135621_61_195 | 3300034151 | Sediment | VKEDRPEVEERVPLFGTWPRIYAAVIVNALILMALITVFSRWRY |
⦗Top⦘ |