NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F058981

Metagenome / Metatranscriptome Family F058981

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F058981
Family Type Metagenome / Metatranscriptome
Number of Sequences 134
Average Sequence Length 43 residues
Representative Sequence IGMTTDEQGIALPADPSAGTVWFTFDGGQTWTASRLNGS
Number of Associated Samples 119
Number of Associated Scaffolds 134

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.59 %
% of genes near scaffold ends (potentially truncated) 87.31 %
% of genes from short scaffolds (< 2000 bps) 82.84 %
Associated GOLD sequencing projects 117
AlphaFold2 3D model prediction Yes
3D model pTM-score0.53

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (84.328 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(24.627 % of family members)
Environment Ontology (ENVO) Unclassified
(20.896 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(53.731 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 4.48%    β-sheet: 17.91%    Coil/Unstructured: 77.61%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.53
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 134 Family Scaffolds
PF12802MarR_2 41.04
PF01047MarR 18.66
PF03308MeaB 12.69
PF02803Thiolase_C 9.70
PF13669Glyoxalase_4 1.49
PF12850Metallophos_2 0.75
PF01642MM_CoA_mutase 0.75
PF13340DUF4096 0.75
PF13565HTH_32 0.75
PF13701DDE_Tnp_1_4 0.75
PF00196GerE 0.75
PF05088Bac_GDH 0.75
PF08281Sigma70_r4_2 0.75
PF05103DivIVA 0.75
PF00903Glyoxalase 0.75

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 134 Family Scaffolds
COG0183Acetyl-CoA acetyltransferaseLipid transport and metabolism [I] 9.70
COG1884Methylmalonyl-CoA mutase, N-terminal domain/subunitLipid transport and metabolism [I] 0.75
COG2902NAD-specific glutamate dehydrogenaseAmino acid transport and metabolism [E] 0.75


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms84.33 %
UnclassifiedrootN/A15.67 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2166559005|cont_contig41071All Organisms → cellular organisms → Bacteria919Open in IMG/M
2189573001|GZR05M101CR7J0All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia528Open in IMG/M
3300001356|JGI12269J14319_10326477All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia546Open in IMG/M
3300002245|JGIcombinedJ26739_100988898All Organisms → cellular organisms → Bacteria → Terrabacteria group726Open in IMG/M
3300003218|JGI26339J46600_10099991All Organisms → cellular organisms → Bacteria711Open in IMG/M
3300003505|JGIcombinedJ51221_10183939All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Nocardiopsaceae847Open in IMG/M
3300005158|Ga0066816_1027031All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia510Open in IMG/M
3300005437|Ga0070710_11146644All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300005591|Ga0070761_10111927All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1581Open in IMG/M
3300005591|Ga0070761_10175728All Organisms → cellular organisms → Bacteria1262Open in IMG/M
3300005591|Ga0070761_10911798Not Available556Open in IMG/M
3300005610|Ga0070763_10885970All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300005712|Ga0070764_10389225All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales822Open in IMG/M
3300005952|Ga0080026_10044404All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1151Open in IMG/M
3300006028|Ga0070717_11487111All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → unclassified Streptosporangiales → Streptosporangiales bacterium614Open in IMG/M
3300006579|Ga0074054_12063981All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia750Open in IMG/M
3300006580|Ga0074049_10015322All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia705Open in IMG/M
3300006797|Ga0066659_11930005All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → unclassified Streptosporangiales → Streptosporangiales bacterium502Open in IMG/M
3300009089|Ga0099828_10367083All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1297Open in IMG/M
3300009090|Ga0099827_10218423All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1592Open in IMG/M
3300010043|Ga0126380_10224183All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1279Open in IMG/M
3300010366|Ga0126379_10140087All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2234Open in IMG/M
3300010373|Ga0134128_12167871All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → unclassified Streptosporangiales → Streptosporangiales bacterium612Open in IMG/M
3300010379|Ga0136449_101251047All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1163Open in IMG/M
3300010398|Ga0126383_11234265All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia837Open in IMG/M
3300011067|Ga0138594_1041068All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia644Open in IMG/M
3300012285|Ga0137370_10897308All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia548Open in IMG/M
3300012492|Ga0157335_1016977All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia655Open in IMG/M
3300012918|Ga0137396_10463103All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → unclassified Frankia → Frankia sp. Ea1.12940Open in IMG/M
3300012971|Ga0126369_11385182All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia793Open in IMG/M
3300012988|Ga0164306_10048852All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2548Open in IMG/M
3300013100|Ga0157373_10574342All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia819Open in IMG/M
3300014169|Ga0181531_11101019All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia500Open in IMG/M
3300014838|Ga0182030_10207062All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2332Open in IMG/M
3300014968|Ga0157379_12574617All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia509Open in IMG/M
3300014969|Ga0157376_11085109All Organisms → cellular organisms → Bacteria → Terrabacteria group826Open in IMG/M
3300016357|Ga0182032_11008169All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia711Open in IMG/M
3300017942|Ga0187808_10603302All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia510Open in IMG/M
3300017959|Ga0187779_10875796All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium617Open in IMG/M
3300017974|Ga0187777_10254980All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1191Open in IMG/M
3300017974|Ga0187777_10974871All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia612Open in IMG/M
3300017975|Ga0187782_11647261Not Available507Open in IMG/M
3300017975|Ga0187782_11662008Not Available505Open in IMG/M
3300018090|Ga0187770_10082385All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2375Open in IMG/M
3300020070|Ga0206356_11496493All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1092Open in IMG/M
3300021404|Ga0210389_11065542All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia625Open in IMG/M
3300021479|Ga0210410_10187601All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1850Open in IMG/M
3300021479|Ga0210410_11770173All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia512Open in IMG/M
3300022714|Ga0242671_1047352All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia704Open in IMG/M
3300025509|Ga0208848_1083607All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia655Open in IMG/M
3300025972|Ga0207668_10566034All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria986Open in IMG/M
3300026551|Ga0209648_10020891All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae5724Open in IMG/M
3300026555|Ga0179593_1024330Not Available1713Open in IMG/M
3300026555|Ga0179593_1116485All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii2551Open in IMG/M
3300026998|Ga0208369_1013535All Organisms → cellular organisms → Bacteria → Terrabacteria group764Open in IMG/M
3300026999|Ga0207949_1025983Not Available540Open in IMG/M
3300027096|Ga0208099_1027558All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia810Open in IMG/M
3300027158|Ga0208725_1006877All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1920Open in IMG/M
3300027370|Ga0209010_1032120All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria899Open in IMG/M
3300027568|Ga0208042_1009622All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2586Open in IMG/M
3300027590|Ga0209116_1057812All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria841Open in IMG/M
3300027783|Ga0209448_10126740All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria854Open in IMG/M
3300027842|Ga0209580_10219887All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria943Open in IMG/M
3300027879|Ga0209169_10026570All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3090Open in IMG/M
3300027884|Ga0209275_10377506All Organisms → cellular organisms → Bacteria → Terrabacteria group797Open in IMG/M
3300028742|Ga0302220_10034225All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2252Open in IMG/M
3300028781|Ga0302223_10224900All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia619Open in IMG/M
3300028789|Ga0302232_10182560All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1049Open in IMG/M
3300028801|Ga0302226_10020405All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3558Open in IMG/M
3300028808|Ga0302228_10270559All Organisms → cellular organisms → Bacteria → Terrabacteria group764Open in IMG/M
3300028877|Ga0302235_10459269All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia542Open in IMG/M
3300028879|Ga0302229_10503987All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → unclassified Streptosporangiales → Streptosporangiales bacterium534Open in IMG/M
3300028881|Ga0307277_10074245All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1414Open in IMG/M
3300029636|Ga0222749_10279782All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria857Open in IMG/M
3300029701|Ga0222748_1040121All Organisms → cellular organisms → Bacteria → Terrabacteria group769Open in IMG/M
3300029944|Ga0311352_11273921All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia556Open in IMG/M
3300029951|Ga0311371_10102651All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales4546Open in IMG/M
3300029951|Ga0311371_10550988All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1501Open in IMG/M
3300030007|Ga0311338_10228417All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2113Open in IMG/M
3300030399|Ga0311353_11057835Not Available676Open in IMG/M
3300030617|Ga0311356_10183294All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2148Open in IMG/M
3300030618|Ga0311354_11918756All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia511Open in IMG/M
3300030706|Ga0310039_10091241All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae1284Open in IMG/M
3300030740|Ga0265460_12144747All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → unclassified Streptosporangiales → Streptosporangiales bacterium586Open in IMG/M
3300031028|Ga0302180_10089187All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1782Open in IMG/M
3300031090|Ga0265760_10347685All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → unclassified Streptosporangiales → Streptosporangiales bacterium530Open in IMG/M
3300031152|Ga0307501_10021932All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1223Open in IMG/M
3300031234|Ga0302325_11328493Not Available942Open in IMG/M
3300031234|Ga0302325_12944860Not Available552Open in IMG/M
3300031236|Ga0302324_102901426Not Available573Open in IMG/M
3300031681|Ga0318572_10600750All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia656Open in IMG/M
3300031715|Ga0307476_10775824All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia709Open in IMG/M
3300031715|Ga0307476_10850959All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia674Open in IMG/M
3300031723|Ga0318493_10013370All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3465Open in IMG/M
3300031723|Ga0318493_10096261All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1479Open in IMG/M
3300031740|Ga0307468_100656718All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia868Open in IMG/M
3300031747|Ga0318502_11040079Not Available500Open in IMG/M
3300031751|Ga0318494_10129430All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1411Open in IMG/M
3300031751|Ga0318494_10130545All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1405Open in IMG/M
3300031751|Ga0318494_10163398All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1258Open in IMG/M
3300031770|Ga0318521_10140736All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1363Open in IMG/M
3300031771|Ga0318546_10220040All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1301Open in IMG/M
3300031771|Ga0318546_10464016All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia887Open in IMG/M
3300031779|Ga0318566_10167905All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1089Open in IMG/M
3300031781|Ga0318547_10819689All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia580Open in IMG/M
3300031793|Ga0318548_10639305Not Available517Open in IMG/M
3300031797|Ga0318550_10064001All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1680Open in IMG/M
3300031819|Ga0318568_10376995All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia884Open in IMG/M
3300031823|Ga0307478_11574406All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia543Open in IMG/M
3300031846|Ga0318512_10218964All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria934Open in IMG/M
3300031880|Ga0318544_10335090All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia588Open in IMG/M
3300031897|Ga0318520_10169448All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1275Open in IMG/M
3300031942|Ga0310916_10179576All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1763Open in IMG/M
3300032059|Ga0318533_11071284All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia591Open in IMG/M
3300032063|Ga0318504_10369904All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → unclassified Streptosporangiales → Streptosporangiales bacterium682Open in IMG/M
3300032065|Ga0318513_10519875All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium583Open in IMG/M
3300032076|Ga0306924_10279808All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1916Open in IMG/M
3300032076|Ga0306924_11994586All Organisms → cellular organisms → Bacteria → Terrabacteria group598Open in IMG/M
3300032091|Ga0318577_10364481All Organisms → cellular organisms → Bacteria → Terrabacteria group691Open in IMG/M
3300032160|Ga0311301_12967255All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → unclassified Streptosporangiales → Streptosporangiales bacterium511Open in IMG/M
3300032828|Ga0335080_11211989Not Available758Open in IMG/M
3300032896|Ga0335075_10202110All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2374Open in IMG/M
3300032955|Ga0335076_10455687Not Available1162Open in IMG/M
3300033134|Ga0335073_11326149All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia709Open in IMG/M
3300033290|Ga0318519_10133325All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1373Open in IMG/M
3300033290|Ga0318519_10908588All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia544Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil24.63%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa13.43%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil5.97%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil5.22%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.48%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil4.48%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland4.48%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.73%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.73%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.73%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.99%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.99%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.24%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.49%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.49%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.75%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.75%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.75%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.75%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.75%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.75%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.75%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.75%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.75%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil0.75%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.75%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.75%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.75%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.75%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.75%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.75%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.75%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.75%
SimulatedEngineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated0.75%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.75%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2166559005Simulated microbial communities from Lyon, FranceEngineeredOpen in IMG/M
2189573001Grass soil microbial communities from Rothamsted Park, UK - FD2 (NaCl 300g/L 5ml)EnvironmentalOpen in IMG/M
3300001356Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300003218Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1EnvironmentalOpen in IMG/M
3300003505Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924)EnvironmentalOpen in IMG/M
3300005158Soil and rhizosphere microbial communities from Laval, Canada - mgHAAEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300005952Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006574Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006579Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006580Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006581Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010877Boreal forest soil eukaryotic communities from Alaska, USA - W3-2 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011067Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 41 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012492Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610Host-AssociatedOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300014169Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaGEnvironmentalOpen in IMG/M
3300014838Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300017942Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3EnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300020070Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021377Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7Host-AssociatedOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300022714Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300024295Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 1-5EnvironmentalOpen in IMG/M
3300025509Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 shallow-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300026555Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300026998Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF046 (SPAdes)EnvironmentalOpen in IMG/M
3300026999Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF044 (SPAdes)EnvironmentalOpen in IMG/M
3300027096Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF043 (SPAdes)EnvironmentalOpen in IMG/M
3300027158Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF011 (SPAdes)EnvironmentalOpen in IMG/M
3300027370Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027568Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027590Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027783Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027842Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027879Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300028742Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_3EnvironmentalOpen in IMG/M
3300028781Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_3EnvironmentalOpen in IMG/M
3300028789Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3EnvironmentalOpen in IMG/M
3300028801Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_3EnvironmentalOpen in IMG/M
3300028808Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2EnvironmentalOpen in IMG/M
3300028877Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3EnvironmentalOpen in IMG/M
3300028879Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3EnvironmentalOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029701Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029944II_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300029951III_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030399II_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300030617II_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030618II_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030706Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2)EnvironmentalOpen in IMG/M
3300030740Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assemblyEnvironmentalOpen in IMG/M
3300031028Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2EnvironmentalOpen in IMG/M
3300031090Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031152Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_SEnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031880Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032065Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032091Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032896Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
cont_0071.000033202166559005SimulatedMTTADQGIALPADPSAGTVWFTFDGGQSWTASRLNGS
FD2_093318802189573001Grass SoilIGMTTDEQGIALPADPSAGTVWFTFDGGQTWTASRLNGS
JGI12269J14319_1032647723300001356Peatlands SoilVGMTTDQQGVALPADPQAGTVWFTFDGGQTWAPSTVSGS*
JGIcombinedJ26739_10098889813300002245Forest SoilLDGPPPAGGFGYVGMTTDGQGIALPASPAAGAVWFTFDGGKTWAPSPVSS*
JGI26339J46600_1009999123300003218Bog Forest SoilPAGGFGYVGMTTSDQGIALPADPAGGTVWFTFDGGQTWKPSPLNGS*
JGIcombinedJ51221_1018393913300003505Forest SoilWRMATLATSGPAGGFGYVGMTTNVQGIALPADPSAGTVWFTLDGGQTWKPSHLAGS*
Ga0066816_102703113300005158SoilGGFRYIGMTTDEQGIALPADPSAGTVWFTFDGGQRWTASRLSA*
Ga0070710_1114664413300005437Corn, Switchgrass And Miscanthus RhizosphereVGMTSAEQGIALPADPSAGTVWFTYDGGLTWKPSAVASS*
Ga0070761_1011192733300005591SoilTDEQGIALPADATDGVVWFTFDGGAHWQPSPVSSPEVSGS*
Ga0070761_1017572833300005591SoilTDAQGIALPADPAAGTVWFTFDGGQTWRPSPVSS*
Ga0070761_1091179823300005591SoilYVGMTTDEQGIALPANPASGTVWFTFDAGQRWQPSRVASS*
Ga0070763_1088597023300005610SoilPAGGFGYVGMTTDAQGIALPADPAAGTVWFTFDGGKTWRPSPVSS*
Ga0070764_1038922533300005712SoilMTTDEQGIALPADPASGTVWFTFDGGLRWQPSRITSS*
Ga0080026_1004440413300005952Permafrost SoilTTDSQGIALPANPASGTVWFTYDGGQSWQPSHLNGS*
Ga0070717_1148711123300006028Corn, Switchgrass And Miscanthus RhizosphereEDQGIALPADPSAGTIWFTFDGGKTWKASRLNGS*
Ga0074056_1176316613300006574SoilWRTANLRGGGPASGFGYIGMTTADQGIALPADPSAGTVWFTFDGGQRWTASRLSA*
Ga0074054_1206398123300006579SoilIGMTTADQGIALPADPSAGTVWFTFDGGQRWTASRLNGS*
Ga0074049_1001532213300006580SoilLASLKGGAPPGGFGYVGMTTDDQGIALPADPSAGTVWFTFDGGQRWTASRLSGS*
Ga0074048_1004042113300006581SoilTWRTANLRGGGPAGGFGYIGMTTADQGIALPADPSAGTVWFTFDGGQRWTASRLSA*
Ga0066659_1193000513300006797SoilDDQGIALPADPSGGTVWFTFDGGQDWRPSPLSGS*
Ga0099828_1036708333300009089Vadose Zone SoilGYVGMTTDDQGIALPVDPSAGTVWFTFDGGQDWRPSRLAGT*
Ga0099827_1021842313300009090Vadose Zone SoilAPAGGFGYVGMTTDDQGIALPADPSGGTVWFTFDGGRDWRPSPLSGS*
Ga0126380_1022418313300010043Tropical Forest SoilMTTAEQGIALPADPSAGTVWFTFDGGRTWAPSRLNGP*
Ga0126382_1032879613300010047Tropical Forest SoilSWQAAELKAAGPAGGFGYVGMTTDEQGIALPADPSAGAVWFTFDGGQSWQPYRPNGT*
Ga0126379_1014008713300010366Tropical Forest SoilTDEQGIALPADPASGMVWFTFDGGQTWAPSRLNGS*
Ga0134128_1216787113300010373Terrestrial SoilPAGGFRYIGMTTDEQGIALPADPSAGTVWFTFDGGQSWTVSRLNGS*
Ga0136449_10125104733300010379Peatlands SoilFAGMTTDAQGVALSADPSAGTVWFTYDGGQTWKPSYLNGS*
Ga0126383_1123426513300010398Tropical Forest SoilTLEGTGPAGGFGYVGMTTGEQGIALPADPSAGTVWFTFDGGQTWASSRLNSS*
Ga0126356_1097348033300010877Boreal Forest SoilVGMTSPQQGVAVPADTAQHAVWFTFDGGQTWRASPIS*
Ga0138594_104106823300011067Peatlands SoilVGYMGMTTGVQGVALPADPSAGTVWFTFNGGQTWKPSHLGGG*
Ga0137370_1089730813300012285Vadose Zone SoilANLRGGGPAGGFGYIGMTTGEQGIALPADPSAGTVWFTFDGGQRWTASRLNGS*
Ga0157335_101697713300012492Arabidopsis RhizosphereTADQGIALPADPSAGTVWFTFDGGQRWTASRLSGS*
Ga0137396_1046310323300012918Vadose Zone SoilAPADGFRYIGITTDDQGIALPADPSAGTVWFTFDGGQSWTPSRLNGS*
Ga0126369_1138518213300012971Tropical Forest SoilMTTAEQGIALPADPSAGTVWFTFDGGQTWASSRLNSS*
Ga0164306_1004885213300012988SoilAGGFRYIGMTTDEQGIALPADPSAGTVWFTFDGGQSWTASRLNGS*
Ga0157373_1057434213300013100Corn RhizosphereTANLRGGVPAGGFRYIGMTTDDQGIALPADPSAGTVWFTFDGGQSWTASRLNGS*
Ga0181531_1110101913300014169BogMTTASQGVAVPADASLGEVFSTSDGGQSWTASPVSGGG*
Ga0182030_1020706213300014838BogMTTDEQGIALPANPASGTVWFTFDAGQRWQPSLITSS*
Ga0157379_1257461713300014968Switchgrass RhizosphereGFRYIGMTTDEQGIALPADASGGTVWFTFDGGQSWTASRLNGS*
Ga0157376_1108510913300014969Miscanthus RhizosphereSEQGIALPADPSAGTVWFTFNGGLTWTPSAVASS*
Ga0182032_1100816913300016357SoilVLAGAPAGGFSFVGMTTDEQGVAVPADAAAGTVWFTFDGGRDWQASSVSGS
Ga0187808_1060330213300017942Freshwater SedimentAAALEGPAPAAGFGYVGMTTDSQGIALSADPAAGTVWFTFDGGQTWRPFAVSS
Ga0187779_1087579623300017959Tropical PeatlandVLTGAPAGGFSFAGMTTDEQGVAVPADAAAGTVWLTFDGGRDWQPSSVSSP
Ga0187777_1025498023300017974Tropical PeatlandVLTGAPAGGFSFVGMTTDEQGVAVPADAAAGTVWLTFDGGRDWQPSSVSSP
Ga0187777_1097487123300017974Tropical PeatlandTTADQGIALPADPSAGTVWFTFDGGQTWVPSRLNGS
Ga0187782_1164726113300017975Tropical PeatlandPAGTGAWQAAVLDGPAPAGGFGYVGMTTQSQGVAVPADPAAGTVWFSYDGGETWHPSAVSGG
Ga0187782_1166200823300017975Tropical PeatlandALTLAPAGGFIFVGMTTAAQGVAVPADVAAGTVWFTFDAGQDWQPSSVSGS
Ga0187770_1008238533300018090Tropical PeatlandVGMTTAAQGVAVPADVAAGTVWFTFDAGQDWQPSSVSGS
Ga0206356_1149649333300020070Corn, Switchgrass And Miscanthus RhizosphereYIGMTTDEQGIALPADPSGGTVWFTFDGGQSWKASRLNGS
Ga0210395_1138247713300020582SoilPAGSGAWRAATLTGPMPAGGFGYVGMTTDAQGIALPADPAAGTVWFTFDGGQTWRPFGVS
Ga0213874_1019462323300021377Plant RootsTAWQRATLNGSEPAGGFGYVGMTTDKQGIALPANPASGTVWFTFDGGQSWAPSDVASS
Ga0210389_1106554223300021404SoilMTTDEQGIALPADPSAGTVWFTFDGGQSWTASRLNGS
Ga0210410_1018760143300021479SoilMTTDEQGIALPADPSAGTVWFTFDGGQTWKASRLNGS
Ga0210410_1177017323300021479SoilGMTTDAQGIALPADPAAGTVWFTFDGGKTWRPSPVSS
Ga0242671_104735223300022714SoilVQPAGSGAWQAATLTGPAPAGGFGYVGMTTDAQGIALPADPAAGTVWFTFDGGKTWRPFAVSS
Ga0224556_114169123300024295SoilQGDITWQQAHLTGPAPAGGFGYVGMTTDEQGIALPASPASGTVWFTFDGGQSWQPADLNG
Ga0208848_108360723300025509Arctic Peat SoilMTTDEQGIALPADPSAGAVWFTFDGGQTWKPSAVTSS
Ga0207668_1056603413300025972Switchgrass RhizosphereTTDEQGIALPADPSGGTVWFTFDGGQSWKASRLNGS
Ga0209648_1002089173300026551Grasslands SoilMTTDAQGIALPANPGVGTVWFTFDGGKTWTPSKVSS
Ga0179593_102433013300026555Vadose Zone SoilGGFGYVGMTTDAQGIALPADPAVGTVWFTFDGGTTWRPFAVS
Ga0179593_111648513300026555Vadose Zone SoilMTTDDQGIALPADPSAGTIWFTFDGGQTWKASRLNGS
Ga0208369_101353513300026998Forest SoilGGFGYVGMTTDAQGIALPADPAVGTVWFTFDGGQTWRPFAVS
Ga0207949_102598323300026999Forest SoilMTTDAQGIALPADPAAGTVWFTFDGGKTWRPFAVSS
Ga0208099_102755833300027096Forest SoilTDDQGVALPADPSAGTVWFTFDGGKTWRPSHLNGS
Ga0208725_100687743300027158Forest SoilVRRAPDVALPADPSAGTVWFTYDGGQSWHPSQLSGP
Ga0209010_103212013300027370Forest SoilVPAGGFGYVGMTTDEQGIALPADATDGVVWFTFDGGAHWQPSPVSSP
Ga0208042_100962213300027568Peatlands SoilMGMTTGVQGVALPADPSAGTVWFTFNGGQTWKPSHLGGG
Ga0209116_105781233300027590Forest SoilTDEQGIALPADATDGVVWFTFDGGAHWQPSPVSGP
Ga0209448_1012674033300027783Bog Forest SoilTNVQGVALPADPSAGTVWFTLDGGQTWKPSHLAGS
Ga0209580_1021988713300027842Surface SoilPATGFTFVGMTTGTQGVAVPADAAAGEIWFTFDGGQTWTPSAVAST
Ga0209169_1002657013300027879SoilSGAWRAATLNGPAPAGGFGYVGMTTDAQGIALPADPAVGTVWFTFDGGQTWRPFAVS
Ga0209275_1037750633300027884SoilATLTGPAPAGGFGYVGMTTDAQGIALPADPAAGTVWFTFDGGKTWRPFAVSS
Ga0302220_1003422543300028742PalsaYVGMTTDAQGIALPADPAVGTVWFTFDGGQSWTPSVVSG
Ga0302223_1022490013300028781PalsaVPAGGFGYVGMTTDEQGIALPADPASGTVWFTFDGGLRWQPSRITGS
Ga0302232_1018256013300028789PalsaPAGGFGYVGMTTDAQGIALPADPAVGTVWFTFDGGQSWTPSAVSG
Ga0302226_1002040513300028801PalsaMTTDEQGIALPANPASGTVWFTFDAGQRWQPSRITSS
Ga0302228_1027055913300028808PalsaDAPAPAGGFGYVGMTTDAQGIALPADPAVGTVWFTFDGGQSWTPSAVSG
Ga0302235_1045926913300028877PalsaAELTGTVPAGGFSYLGMTTDEQGIALPANPTSGTVWFTFDGGQRWQPSRIAGS
Ga0302229_1050398723300028879PalsaMTTDAQGIALPADPAVGTVWFTFDGGQSWTPSAVSG
Ga0307277_1007424533300028881SoilGYIGMTTADQGIALPADPSAGTVWFTFDGGQRWTASRLNGS
Ga0222749_1027978213300029636SoilGPAPAGGFGYVGMTTDAQGIALPADPAAGTVWFTFDGGKTWRPFAVS
Ga0222748_104012113300029701SoilTNVQGIALPADPSAGTVWFTLDGGQTWKPSHLAGS
Ga0311352_1127392113300029944PalsaVPAGGFSYLGMTTDEQGIALPANPTSGTVWFTFDGGQRWQPSRIAGS
Ga0311371_1010265113300029951PalsaAGGFGYVGMTTDAQGIALPADPAVGTVWFTFDGGQSWTPSAVSG
Ga0311371_1055098833300029951PalsaYVGMTTDEQGIALPANPASGTVWFTFDGGLRWQPSRISRTTGS
Ga0311338_1022841743300030007PalsaGFSYLGMTTDEQGIALPANPTSGTVWFTFDGGQRWQPSRIAGS
Ga0311353_1105783523300030399PalsaMTTDEQGIALPANPAAGTVWFTFDGGLRWQPSRIASS
Ga0311356_1018329443300030617PalsaGYVGMTTDAQGIALPADPAVGTVWFTFDGGQSWTPSAVSG
Ga0311354_1191875623300030618PalsaGMTTDAQGIALPADPAVGTVWFTFDGGQSWTPSAVSG
Ga0310039_1009124123300030706Peatlands SoilSGFGFAGMTTDAQGVALSADPSAGTVWFTYDGGQTWKPSYLNGS
Ga0265460_1214474723300030740SoilFGYVGMTTDAQGIALPANPAVGTVWFTFDGGKTWIPSPVT
Ga0302180_1008918733300031028PalsaSYVGMTTDEQGIALPANPASGTVWFTFDGGLRWQPSRVASS
Ga0265760_1034768513300031090SoilVGMTTDAQGIALPADPAVGTVWFSFDGGQTWRPFAVS
Ga0307501_1002193213300031152SoilLRGGGPAGGFGYIGMTTGEQGIALPADPSAGTVWFTFDGGQSWTASRLNGS
Ga0302325_1132849323300031234PalsaVGMTTDLQGVALPASPAAGTVWFTFDGGKSWRPSPVRG
Ga0302325_1294486023300031234PalsaTDEQGIALPANPAAGTVWFTFDGGLRWQPSRIASA
Ga0302324_10290142623300031236PalsaFSYVGMTTDEQGIALPANPAAGTVWFTFDGGLRWQPSRIASA
Ga0318572_1060075013300031681SoilGFGYVGMTTAEQGIALPADPSDGTVWFTFDGGQTWAPSRLNGS
Ga0307476_1077582423300031715Hardwood Forest SoilGGFGYVGMTTDAQGIALPADPAVGTVWFTFDGGQTWRPSPVSA
Ga0307476_1085095923300031715Hardwood Forest SoilTTDDQGIALPADPSAGTVWFTFDGGQTWTPSRLNGS
Ga0318493_1001337013300031723SoilPAGGFSFVGMTTDEQGVAVPADAAAGTVWFTFDGGRDWQASSVSGS
Ga0318493_1009626133300031723SoilTNTQGVAIPADAAAGTVWFTFDGGQTWRPSSVSSQ
Ga0307468_10065671813300031740Hardwood Forest SoilMTTSEQGIALPADPSADTVWFTFDGGQRWTASRLNGS
Ga0318502_1104007913300031747SoilTTSEQGIALPADPYYGTIWFTFDGGRTWQASRLNGS
Ga0318494_1012943033300031751SoilGFTFVGMTTNTQGVAIPADAAAGTVWFTFDGGQTWRPSSVSSQ
Ga0318494_1013054513300031751SoilAGGFSFVGMTTDEQGVAVPADTAAGTVWFTFDGGRDWQASSVSGS
Ga0318494_1016339813300031751SoilFGYVGMTTDQQGIALPANPATGAVWFTFDGGKTWAPSHVS
Ga0318521_1014073633300031770SoilSWQHAAVTDTPAGGFTFVGMTTNTQGVAIPADAAAGTVWFTFDGGQTWRPSSVSSQ
Ga0318546_1022004033300031771SoilTFVGMTTNTQGVAIPADAAAGTVWFTFDGGQTWRPSSVSSQ
Ga0318546_1046401613300031771SoilVLAGAPAGGFSFVGMTTDEQGVAVPADTAAGTVWFTFDGGRDWQASSVSGS
Ga0318566_1016790513300031779SoilTTDEQGVAVPADTAAGTVWFTFDGGRDWQASSVSGS
Ga0318547_1081968913300031781SoilGYAGMTTDAQGVALPADPRAGTVWFTFDGGKTWTPTPISS
Ga0318548_1063930523300031793SoilYVGMTTSEQGIALPADPYYGTIWFTFDGGRTWQASRLNGS
Ga0318550_1006400113300031797SoilFSFVGMTTDEQGVAVPADAAAGTVWFTFDGGRDWQASSVSGS
Ga0318568_1037699533300031819SoilAGAPAGGFSFVGMTTDEQGVAVPADTAAGTVWFTFDGGRDWQASSVSGS
Ga0307478_1157440613300031823Hardwood Forest SoilATLNGPAPAGGFGYVGMTTDAQGIALPADPAVGTVWFTFDGGKTWRPSPVSS
Ga0318512_1021896433300031846SoilFTFVGMTTNTQGVAIPADAAAGTVWFTFDGGQTWRPSSVSSQ
Ga0318544_1033509023300031880SoilDTPAGGFTFVGMTTNTQGVAIPADAAAGTVWFTFDGGQTWRPSSVSSQ
Ga0318520_1016944833300031897SoilMTTDAQGVALPANPAAGTVWFTFDGGETWTPTRLS
Ga0310916_1017957613300031942SoilQHAAVTDTPAGGFTFVGMTTNTQGVAIPADAAAGTVWFTFDGGQTWRPSSVSSQ
Ga0307479_1172136013300031962Hardwood Forest SoilRPAGSGAWQAATLTGPAPAGGFGYVGMTTDAQGIALPADPAAGTVWFTFDGGKTWRPSAV
Ga0318533_1107128413300032059SoilGGSGPAGGFGYVGMTTGKQGIALPADPSSGTVWFTFDGGQSWAPSRLNGS
Ga0318504_1036990413300032063SoilKGDAPAGGFGYVGMTTDDQGIALPADPSDGAVWFTFDGGQTWRPSSVSSQ
Ga0318513_1051987513300032065SoilKGGAPSGGFGYVGMTTAEQGIALPADPSDGTVWFTFDGGQTWAPSRLNGS
Ga0306924_1027980813300032076SoilGGFSFVGMTTDEQGVAVPADTAAGTVWFTFDGGRDWQASSVSGS
Ga0306924_1199458623300032076SoilTDDQGIALPADPSAGTVWFTFDGGQSWAPSRLNGS
Ga0318577_1036448123300032091SoilGYTGMTTDAQGVALPADPAAGTVWFTFDGGKTWTPTRVS
Ga0311301_1296725523300032160Peatlands SoilTTGGQGVALPANPSAGTVWFTYDGGQNWKPSYLNGS
Ga0335080_1121198913300032828SoilGMTTDDQGIALPANPSSGTIWFTFDGGRSWHASRLNGS
Ga0335075_1020211013300032896SoilYVGMTTDKQGIALPADPAGGTVWFTFDGGLIWKPSKVGRS
Ga0335076_1045568713300032955SoilGGGGPAGGFGYVGMTTDDQGIALPANPSSGTIWFTFDGGRSWHASRLNGS
Ga0335073_1132614923300033134SoilGAPAGGFQYVGMTTDMQGIALPVNATDGVVWFTFDGGASWQPSLVSGP
Ga0318519_1013332513300033290SoilSWQRVVLAGAPAGGFSFVGMTTDEQGVAVPADTAAGTVWFTFDGGRDWQASSVSGS
Ga0318519_1090858823300033290SoilKGQAPSGGFGYVGMTTDDQGIALPADPSAGTVWFTFDGGQSWAPSRLNGS


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.