NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F058892

Metagenome Family F058892

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F058892
Family Type Metagenome
Number of Sequences 134
Average Sequence Length 47 residues
Representative Sequence TRAKKELHFVYPAVDVYRGPETDGTPTLSRFLEPIPPSILPHASLAGE
Number of Associated Samples 97
Number of Associated Scaffolds 134

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 99.25 %
% of genes from short scaffolds (< 2000 bps) 94.78 %
Associated GOLD sequencing projects 86
AlphaFold2 3D model prediction Yes
3D model pTM-score0.19

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (97.761 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere
(10.448 % of family members)
Environment Ontology (ENVO) Unclassified
(52.239 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(75.373 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 3.95%    β-sheet: 0.00%    Coil/Unstructured: 96.05%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.19
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 134 Family Scaffolds
PF02675AdoMet_dc 67.16
PF04228Zn_peptidase 9.70
PF06224HTH_42 1.49
PF13785DUF4178 1.49
PF01914MarC 1.49
PF01120Alpha_L_fucos 0.75
PF12796Ank_2 0.75
PF12705PDDEXK_1 0.75
PF01564Spermine_synth 0.75
PF00082Peptidase_S8 0.75
PF03358FMN_red 0.75
PF14803Nudix_N_2 0.75
PF030614HBT 0.75
PF13361UvrD_C 0.75

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 134 Family Scaffolds
COG1586S-adenosylmethionine decarboxylaseAmino acid transport and metabolism [E] 67.16
COG2321Predicted metalloproteaseGeneral function prediction only [R] 9.70
COG2095Small neutral amino acid transporter SnatA, MarC familyAmino acid transport and metabolism [E] 1.49
COG3214DNA glycosylase YcaQ, repair of DNA interstrand crosslinksReplication, recombination and repair [L] 1.49
COG3669Alpha-L-fucosidaseCarbohydrate transport and metabolism [G] 0.75

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.76 %
UnclassifiedrootN/A2.24 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000364|INPhiseqgaiiFebDRAFT_104615428All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300000956|JGI10216J12902_102454619All Organisms → cellular organisms → Bacteria609Open in IMG/M
3300004114|Ga0062593_100274600All Organisms → cellular organisms → Bacteria1414Open in IMG/M
3300004114|Ga0062593_102662522All Organisms → cellular organisms → Bacteria569Open in IMG/M
3300004643|Ga0062591_102929198All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300004643|Ga0062591_102987160All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300005293|Ga0065715_10043046All Organisms → cellular organisms → Bacteria1329Open in IMG/M
3300005295|Ga0065707_10702814All Organisms → cellular organisms → Bacteria635Open in IMG/M
3300005331|Ga0070670_101386257All Organisms → cellular organisms → Bacteria644Open in IMG/M
3300005334|Ga0068869_101003773All Organisms → cellular organisms → Bacteria727Open in IMG/M
3300005336|Ga0070680_100852051All Organisms → cellular organisms → Bacteria → Proteobacteria786Open in IMG/M
3300005343|Ga0070687_100218654All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Rhodopirellula1165Open in IMG/M
3300005343|Ga0070687_100339722All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Rhodopirellula966Open in IMG/M
3300005345|Ga0070692_11327846All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300005355|Ga0070671_100299233All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium1370Open in IMG/M
3300005364|Ga0070673_100114303All Organisms → cellular organisms → Bacteria2243Open in IMG/M
3300005440|Ga0070705_100292747All Organisms → cellular organisms → Bacteria1163Open in IMG/M
3300005440|Ga0070705_100535327All Organisms → cellular organisms → Bacteria → Proteobacteria895Open in IMG/M
3300005440|Ga0070705_100704016All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Rhodopirellula794Open in IMG/M
3300005440|Ga0070705_101648943All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300005445|Ga0070708_100326302All Organisms → cellular organisms → Bacteria1446Open in IMG/M
3300005466|Ga0070685_11261538All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium563Open in IMG/M
3300005539|Ga0068853_101028142All Organisms → cellular organisms → Bacteria794Open in IMG/M
3300005545|Ga0070695_101462548All Organisms → cellular organisms → Bacteria568Open in IMG/M
3300005547|Ga0070693_100185664All Organisms → cellular organisms → Bacteria1342Open in IMG/M
3300005549|Ga0070704_100872680All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Rhodopirellula808Open in IMG/M
3300005549|Ga0070704_101677390All Organisms → cellular organisms → Bacteria587Open in IMG/M
3300005552|Ga0066701_10441924All Organisms → cellular organisms → Bacteria807Open in IMG/M
3300005563|Ga0068855_101052492All Organisms → cellular organisms → Bacteria853Open in IMG/M
3300005564|Ga0070664_101736589All Organisms → cellular organisms → Bacteria592Open in IMG/M
3300005577|Ga0068857_100529208All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Rhodopirellula → Rhodopirellula europaea1108Open in IMG/M
3300005578|Ga0068854_100632896All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Rhodopirellula → Rhodopirellula baltica917Open in IMG/M
3300005578|Ga0068854_101543005All Organisms → cellular organisms → Bacteria604Open in IMG/M
3300005616|Ga0068852_101899639All Organisms → cellular organisms → Bacteria618Open in IMG/M
3300005617|Ga0068859_102152865All Organisms → cellular organisms → Bacteria616Open in IMG/M
3300005617|Ga0068859_102846172All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300005618|Ga0068864_100357864All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium1379Open in IMG/M
3300005618|Ga0068864_102484656All Organisms → cellular organisms → Bacteria524Open in IMG/M
3300005719|Ga0068861_100576713All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Rhodopirellula → Rhodopirellula europaea1029Open in IMG/M
3300005719|Ga0068861_102532667All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium517Open in IMG/M
3300005834|Ga0068851_10526271All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium712Open in IMG/M
3300005841|Ga0068863_100500435All Organisms → cellular organisms → Bacteria1197Open in IMG/M
3300005841|Ga0068863_101889580All Organisms → cellular organisms → Bacteria607Open in IMG/M
3300005841|Ga0068863_102626557All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300005842|Ga0068858_102385914All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300005844|Ga0068862_100568341All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Rhodopirellula → Rhodopirellula europaea1085Open in IMG/M
3300006755|Ga0079222_12689888All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300006844|Ga0075428_101482520All Organisms → cellular organisms → Bacteria → Acidobacteria711Open in IMG/M
3300006845|Ga0075421_100182838All Organisms → cellular organisms → Bacteria → Acidobacteria2605Open in IMG/M
3300006854|Ga0075425_101454096All Organisms → cellular organisms → Bacteria775Open in IMG/M
3300006881|Ga0068865_100653004All Organisms → cellular organisms → Bacteria894Open in IMG/M
3300006954|Ga0079219_12090429All Organisms → cellular organisms → Bacteria542Open in IMG/M
3300009011|Ga0105251_10508017All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300009101|Ga0105247_11023356All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Rhodopirellula647Open in IMG/M
3300009147|Ga0114129_10819162All Organisms → cellular organisms → Bacteria1186Open in IMG/M
3300009147|Ga0114129_11922138All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Rhodopirellula717Open in IMG/M
3300009147|Ga0114129_12726916All Organisms → cellular organisms → Bacteria588Open in IMG/M
3300009148|Ga0105243_10932929All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Rhodopirellula866Open in IMG/M
3300009148|Ga0105243_11161903All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Rhodopirellula → unclassified Rhodopirellula → Rhodopirellula sp.783Open in IMG/M
3300009148|Ga0105243_12270461All Organisms → cellular organisms → Bacteria580Open in IMG/M
3300009162|Ga0075423_11747123All Organisms → cellular organisms → Bacteria670Open in IMG/M
3300009162|Ga0075423_12720790All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium541Open in IMG/M
3300009174|Ga0105241_10991597All Organisms → cellular organisms → Bacteria785Open in IMG/M
3300009174|Ga0105241_11867258All Organisms → cellular organisms → Bacteria588Open in IMG/M
3300009176|Ga0105242_10728164All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Rhodopirellula974Open in IMG/M
3300009176|Ga0105242_11305680All Organisms → cellular organisms → Bacteria749Open in IMG/M
3300009176|Ga0105242_12102407All Organisms → cellular organisms → Bacteria608Open in IMG/M
3300009176|Ga0105242_13200059All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300009177|Ga0105248_11005206All Organisms → cellular organisms → Bacteria942Open in IMG/M
3300009553|Ga0105249_12377897All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium602Open in IMG/M
3300010036|Ga0126305_10167260All Organisms → cellular organisms → Bacteria1378Open in IMG/M
3300010038|Ga0126315_10897150All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300010041|Ga0126312_10169791All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Rhodopirellula → Rhodopirellula maiorica1519Open in IMG/M
3300010358|Ga0126370_11227808All Organisms → cellular organisms → Bacteria698Open in IMG/M
3300010360|Ga0126372_13231823All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300010373|Ga0134128_12542868All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300010375|Ga0105239_10804636Not Available1077Open in IMG/M
3300010397|Ga0134124_10629669Not Available1054Open in IMG/M
3300010397|Ga0134124_11652378All Organisms → cellular organisms → Bacteria672Open in IMG/M
3300010397|Ga0134124_12072291All Organisms → cellular organisms → Bacteria607Open in IMG/M
3300010400|Ga0134122_10472276All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1128Open in IMG/M
3300010400|Ga0134122_11091190All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Rhodopirellula790Open in IMG/M
3300010400|Ga0134122_11805769All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium643Open in IMG/M
3300012015|Ga0120187_1041869All Organisms → cellular organisms → Bacteria577Open in IMG/M
3300012893|Ga0157284_10349151All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300012913|Ga0157298_10143447All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Rhodopirellula705Open in IMG/M
3300013100|Ga0157373_11422844All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300013296|Ga0157374_11370227All Organisms → cellular organisms → Bacteria730Open in IMG/M
3300013296|Ga0157374_12444977All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium550Open in IMG/M
3300013297|Ga0157378_13175995All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300013306|Ga0163162_11828100All Organisms → cellular organisms → Bacteria695Open in IMG/M
3300014325|Ga0163163_11084573All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae864Open in IMG/M
3300014326|Ga0157380_10027226All Organisms → cellular organisms → Bacteria4347Open in IMG/M
3300014745|Ga0157377_10785242All Organisms → cellular organisms → Bacteria700Open in IMG/M
3300014745|Ga0157377_11724852All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300015371|Ga0132258_12795896All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium1216Open in IMG/M
3300015373|Ga0132257_100240851All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium2157Open in IMG/M
3300015373|Ga0132257_100619874All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae1338Open in IMG/M
3300015374|Ga0132255_106337579All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300018422|Ga0190265_13554602All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium520Open in IMG/M
3300018466|Ga0190268_10456247All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae848Open in IMG/M
3300020060|Ga0193717_1029619All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium2159Open in IMG/M
3300021445|Ga0182009_10242327All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae892Open in IMG/M
3300024179|Ga0247695_1001170All Organisms → cellular organisms → Bacteria3822Open in IMG/M
3300025901|Ga0207688_10338493All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium925Open in IMG/M
3300025908|Ga0207643_10567983All Organisms → cellular organisms → Bacteria729Open in IMG/M
3300025911|Ga0207654_10440775All Organisms → cellular organisms → Bacteria912Open in IMG/M
3300025911|Ga0207654_10512542All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Rhodopirellula848Open in IMG/M
3300025911|Ga0207654_10949898All Organisms → cellular organisms → Bacteria624Open in IMG/M
3300025917|Ga0207660_11673195All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300025918|Ga0207662_10487092All Organisms → cellular organisms → Bacteria848Open in IMG/M
3300025918|Ga0207662_10644278All Organisms → cellular organisms → Bacteria740Open in IMG/M
3300025922|Ga0207646_10754050All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium868Open in IMG/M
3300025925|Ga0207650_11607809All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300025937|Ga0207669_10546054All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium934Open in IMG/M
3300025941|Ga0207711_11924810All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300025960|Ga0207651_10170173All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Rhodopirellula1717Open in IMG/M
3300025960|Ga0207651_10725696All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium877Open in IMG/M
3300025960|Ga0207651_10870841All Organisms → cellular organisms → Bacteria801Open in IMG/M
3300025960|Ga0207651_11294634All Organisms → cellular organisms → Bacteria655Open in IMG/M
3300026035|Ga0207703_10682207All Organisms → cellular organisms → Bacteria976Open in IMG/M
3300026075|Ga0207708_10198498All Organisms → cellular organisms → Bacteria1600Open in IMG/M
3300026088|Ga0207641_11438775All Organisms → cellular organisms → Bacteria690Open in IMG/M
3300026088|Ga0207641_11750778All Organisms → cellular organisms → Bacteria623Open in IMG/M
3300026116|Ga0207674_11199897All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium728Open in IMG/M
3300027909|Ga0209382_10690403All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Rhodopirellula1100Open in IMG/M
3300031538|Ga0310888_11070870All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300031854|Ga0310904_11044173All Organisms → cellular organisms → Bacteria584Open in IMG/M
3300031911|Ga0307412_10870809All Organisms → cellular organisms → Bacteria → Proteobacteria787Open in IMG/M
3300032005|Ga0307411_11146737All Organisms → cellular organisms → Bacteria703Open in IMG/M
3300032157|Ga0315912_10133250All Organisms → cellular organisms → Bacteria1947Open in IMG/M
3300032205|Ga0307472_102534694All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium522Open in IMG/M
3300033412|Ga0310810_10667364All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium977Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere10.45%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere8.96%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere6.72%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere5.97%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere5.97%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere5.97%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.22%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil5.22%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere4.48%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere3.73%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere3.73%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere3.73%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.99%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.99%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil2.24%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.24%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.24%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.49%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.49%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.49%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.49%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.49%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.75%
TerrestrialEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial0.75%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.75%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.75%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.75%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.75%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.75%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.75%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.75%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.75%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.75%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.75%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.75%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005293Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300005295Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3EnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005466Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaGEnvironmentalOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005834Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009011Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaGHost-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010036Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26EnvironmentalOpen in IMG/M
3300010038Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106EnvironmentalOpen in IMG/M
3300010041Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104AEnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300012015Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C3.rep1EnvironmentalOpen in IMG/M
3300012893Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1EnvironmentalOpen in IMG/M
3300012913Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2EnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300020060Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c2EnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300024179Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK36EnvironmentalOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300031538Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1EnvironmentalOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031911Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1Host-AssociatedOpen in IMG/M
3300032005Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1Host-AssociatedOpen in IMG/M
3300032157Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soilEnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
INPhiseqgaiiFebDRAFT_10461542823300000364SoilELHFVYPAVDVYRGPETDGGAPTLSRFLEPIPPSILPHASLAGEI*
JGI10216J12902_10245461913300000956SoilRDLHFVYPAVNVYYGPETDGSPTLSRFLEPIAPSILQHASLLDGN*
Ga0062593_10027460013300004114SoilERRLLYVATTRAKKELHFVYPAVDVYRGPETEGTPTLSRFLEPIPPSILPHASLAGE*
Ga0062593_10266252223300004114SoilKKDLHFVYPAVDVYRGPETDGTPTLSRFLEPIAPSILPHASLGTI*
Ga0062591_10292919813300004643SoilLLYVATTRAKKELHFVYPAVDVYRGPEDGTPTLSRFLEPIPPSILPHASLI*
Ga0062591_10298716013300004643SoilATTRAKKDLHFVYPAVDVYRGPETDGTPTLSRFLEPIPPSILPHASLAGE*
Ga0065715_1004304633300005293Miscanthus RhizosphereTTRAKKDLHFVYPAVDVYRGPETDGIPTLSRFLEPIPPSILPHASLGTI*
Ga0065707_1070281423300005295Switchgrass RhizosphereELHFVYPAVDVYRGPETDGTPTLSRFLEPIPPSILPHASLAE*
Ga0070670_10138625723300005331Switchgrass RhizosphereAKRDLHFVYPVNVYRGPGTDSLPALSRFLEPIPANILPHAALLGAE*
Ga0068869_10100377313300005334Miscanthus RhizosphereTRAKKDLHFVYPAVDVYRGPETDGVPTLSRFLEPIPPSILPHASLAGE*
Ga0070680_10085205113300005336Corn RhizosphereRLLYVATTRAKKELHFVYPAVDVYRGPETDGTPTLSRFLEPIPPSILPHASLAGE*
Ga0070687_10021865413300005343Switchgrass RhizosphereYPAVNVYMGPEVDGSPTLSRFLEPIPPTVLQHASLLDGN*
Ga0070687_10033972213300005343Switchgrass RhizosphereTRAKKELHFVYPAVDVYRGPETDGTPTLSRFLEPIPPSILPHASLAGE*
Ga0070692_1132784613300005345Corn, Switchgrass And Miscanthus RhizosphereFVYPAVDVYRGPETEGVPTLSRFLEPIPPSILPHASLAGE*
Ga0070671_10029923313300005355Switchgrass RhizosphereKRDLNFVYPINVYRGPETDGTPALSRFLEPIPADILTHASLD*
Ga0070673_10011430333300005364Switchgrass RhizosphereTRAKKELHFIYPAVNVYMGPEVDGSPTLSRFLEPIPPTVLQHASLLDGN*
Ga0070705_10029274713300005440Corn, Switchgrass And Miscanthus RhizosphereLLYVATTRAKKQLHYVYPAVDVYRGPETDGTPTLSRFLEPIPPSILPHASLLG*
Ga0070705_10053532733300005440Corn, Switchgrass And Miscanthus RhizosphereVATTRAKRELHFVYPLNVYRYGENDAVPALSRFLEPIPATILPHASLSGGE*
Ga0070705_10070401633300005440Corn, Switchgrass And Miscanthus RhizosphereHFVYPAVDVYRGPETDGIPTLSRFLEPIPPSILPHASLAGG*
Ga0070705_10164894323300005440Corn, Switchgrass And Miscanthus RhizosphereEERRLLYVATTRAKKELHFVYPAVDVYRGPETDGTPTLSRFLEPIPPSILPHASLAGE*
Ga0070708_10032630213300005445Corn, Switchgrass And Miscanthus RhizosphereKRELHFVYPLNVYRYGESDSVPALSRFLEPIPSTILPHASLSGED*
Ga0070685_1126153813300005466Switchgrass RhizosphereATRAKRDLNFVYPINVYRGPETDGTPALSRFLEPISPEILAHASLD*
Ga0068853_10102814213300005539Corn RhizosphereATTRAKKELHFVYPAVDVYRGPETDGIPTLSRFLEPIPPSILPHASLA*
Ga0070695_10146254813300005545Corn, Switchgrass And Miscanthus RhizosphereAKKELHFVYPAVDVYRGPEADGGAPTLSRFLEPIPPSILPHASLS*
Ga0070693_10018566413300005547Corn, Switchgrass And Miscanthus RhizosphereRAKKELHFVYPAVDVYRGPETVGTPTLSRFLEPIPPSILPHASLAGE*
Ga0070704_10087268033300005549Corn, Switchgrass And Miscanthus RhizosphereVATTRAKKQLHYVYPAVDVYRGPETDGTPTLSRFLEPIPPSILPHASLLG*
Ga0070704_10167739023300005549Corn, Switchgrass And Miscanthus RhizosphereVATTRAKKELHFVYPAVDVYRGPETDGTPTLSRFLEPIPPSILPHASLAGE*
Ga0066701_1044192413300005552SoilNFVYPVNVYRGAEGDWLPSVSRFLEPIPPDILPQASLDGGE*
Ga0068855_10105249233300005563Corn RhizosphereLLYVATTRAKKQLHYVYPAVDVYRGPETDGTPTLSRFLEPIPPSILPHASLLGE*
Ga0070664_10173658913300005564Corn RhizosphereHFVYPAVDVYRGPETEGVPTLSRFLEPIPPSILPHASLAGE*
Ga0068857_10052920813300005577Corn RhizosphereRAKKELHFVYPAVDVYRGPETDGGAPTLSRFLEPIPLSILPHASLSGE*
Ga0068854_10063289633300005578Corn RhizosphereTTRAKRDLHFVYPAVDVYRGPETDGIPTLSRFLEPIPPAVLPHASLAGE*
Ga0068854_10154300513300005578Corn RhizosphereVYPAVDVYRGPETEGVPTLSRFLEPIPPAILPHASLAGE*
Ga0068852_10189963913300005616Corn RhizosphereVATTRAKKELHFVYPAVDVYRGPETDGTPTLSRFLEPIPPSILPHASLADH*
Ga0068859_10215286533300005617Switchgrass RhizosphereAKKDLHFVYPAVDVYRGPEADGVPTLSRFLEPIPPSILPHASLAGE*
Ga0068859_10284617213300005617Switchgrass RhizosphereTRAKKDLHFVYPAVDVYRGPETDGTPTLSRFLEPIPPSILPHASLAGE*
Ga0068864_10035786413300005618Switchgrass RhizosphereKSDLTFVYPVNVYRGPEADNTPALSRFLEPIPHNVLAHASLD*
Ga0068864_10248465613300005618Switchgrass RhizosphereYVATTRAKKELHFVYPANVYRGPDTDNTPALSRFLEPISPEILTHASLD*
Ga0068861_10057671313300005719Switchgrass RhizosphereVATTRAKKELHFVYPAVDVYRGPEADGTPTLSRFLEPIPQSILPHASLADH*
Ga0068861_10253266723300005719Switchgrass RhizosphereRARKELNFVYPVNVYRGPDTDGTPALSRFLEPIPPEILTHASLD*
Ga0068851_1052627133300005834Corn RhizosphereLNFVYPINVYRGPETDGTPALSRFLEPISPEILSHASLD*
Ga0068863_10050043533300005841Switchgrass RhizosphereHFVYPAVDVYRGPEADGVPTLSRFLEPIPPSILPHASLAGE*
Ga0068863_10188958023300005841Switchgrass RhizosphereTTRAKKELHFVYPAVNVYNGPEADGSPTLSRFLEPIPPSILQHAALLDGN*
Ga0068863_10262655723300005841Switchgrass RhizosphereRLLYVATTRAKKELHFVYPAVDVYRGPETDGTPTLSRFLEPIPQSILPHASLADH*
Ga0068858_10238591423300005842Switchgrass RhizosphereLHFVYPAVDVYRGPETEGTPTLSRFLEPIPPSILPHASLAGE*
Ga0068862_10056834133300005844Switchgrass RhizosphereTTRAKKELHFVYPAVDVYRGPEADGTPTLSRFLEPIPQSILPHASLADH*
Ga0079222_1268988823300006755Agricultural SoilYPAVDVYRGPETDGTPTLSRFLEPIPPSILPHASLAGE*
Ga0075428_10148252033300006844Populus RhizosphereQLNYVYPAVDVYRGPETDGAPTLSRFLEPIPPSILPHASLTGE*
Ga0075421_10018283833300006845Populus RhizosphereAKKQLNYVYPAVDVYRGPETDGTPTLSRFLEPIPPSILPHASLTGE*
Ga0075425_10145409613300006854Populus RhizosphereDLNFVYPVNVYRGPDSDGTPALSRFLEPIPPEILVHASLD*
Ga0068865_10065300423300006881Miscanthus RhizosphereLYVATTRAKRELHFVYPLNVYRYGENDAVPALSRFLEPIPPAILPHASLSGGE*
Ga0079219_1209042913300006954Agricultural SoilKKDLHFVYPALDVYRGPETDGTPTLSRFLEPIPPAILPHASLAGE*
Ga0105251_1050801723300009011Switchgrass RhizosphereYVATTRAKKDLHFVYPAVDVYRGPEADGIPTLSRFLEPIPPSVLPHASLAGE*
Ga0105247_1102335613300009101Switchgrass RhizosphereVDVYRGPETDGTPTLSRFLEPIPPSILPHASLAGE*
Ga0114129_1081916223300009147Populus RhizosphereRELNFVYPVNVYRGPDTDSLPAISRFLEPISPDILPHASIAGDE*
Ga0114129_1192213833300009147Populus RhizosphereATTRAKKELHFVYPAVDIYRGPEADGTPTLSRFLEPIPPSILPHASLSGE*
Ga0114129_1272691613300009147Populus RhizosphereKKELHFVYPAVDVYRGPEADGTPTLSRFLEPIPPSILPHASLAGE*
Ga0105243_1093292913300009148Miscanthus RhizosphereLHFVHPAVDVYRGPETDGTPTLSRFLEPIPPSILPHASLAGE*
Ga0105243_1116190333300009148Miscanthus RhizosphereHFVYPAVNVYNGPETDGTPTLSRFLEPIAPSILQHASLLDG*
Ga0105243_1226299413300009148Miscanthus RhizosphereVYPLNVYRYGESDSVPALSRFLEPIPSTILPHASLSGED*
Ga0105243_1227046113300009148Miscanthus RhizosphereERRLLYVATTRAKKELHFVYPAVDVYRGPETAGTPTLSRFLEPIPPSILPHASLAGE*
Ga0075423_1174712313300009162Populus RhizosphereELHFVYPAVDVYRGPETDGTPTLSRFLEPIPPSILPHASLAGE*
Ga0075423_1272079013300009162Populus RhizosphereTRAKRSLQFVYPVNVYRGPESDSLPALSRFLEPISPEVLHHASLEG*
Ga0105241_1099159713300009174Corn RhizosphereKELHFVYPAVDVYRGPETAGTPTLSRFLEPIPPSILPHASLAGE*
Ga0105241_1186725813300009174Corn RhizosphereELHFVYPAVDVYRGPETDGGAPTLSRFLEPIPPSILPHASLSGD*
Ga0105242_1072816413300009176Miscanthus RhizosphereKKDLHFVYPAVDVYRGPETDGVPTLSRFLEPIPPAILPHASLAGE*
Ga0105242_1130568013300009176Miscanthus RhizosphereVYRGPEADGGAPTLSRFLEPIPPSILPHGSLSGE*
Ga0105242_1210240713300009176Miscanthus RhizosphereLLYVATTRAKKDLHFVYPAVDVYRGPDTDGTPTLSRFLEPIPPSILPHASLAGE*
Ga0105242_1320005913300009176Miscanthus RhizosphereKELHFVYPAVDVYRGPETVGTPTLSRFLEPIPPSILPHASLAGE*
Ga0105248_1100520633300009177Switchgrass RhizosphereERRLLYVATTRAKKDLHFVHPAVDVYRGPETDATSTLSRFLEPISPSILPHA*
Ga0105249_1237789713300009553Switchgrass RhizosphereLYVATTRAKRDLNFVYPINVYRGPETDGTPALSRFLEPISPEILTHASLD*
Ga0126305_1016726033300010036Serpentine SoilDVYMGPETDGTPTLSRFLEPIPPSILPHASLLGD*
Ga0126315_1089715023300010038Serpentine SoilAKKDLHFVYPAVDIYRGPEADGTPTLSRFLEPIPPSILPHASLAGE*
Ga0126312_1016979133300010041Serpentine SoilVSGRARLLYVATTRAKKELHFVYPAVDVYRGPETDGTPTLSRFLEPIPPAVLPHASLDG*
Ga0126370_1122780833300010358Tropical Forest SoilAVDVYKGPETDGTPTLSRFLEPIPPSFLPHASLAGG*
Ga0126372_1323182313300010360Tropical Forest SoilERRLLYVATTRAKKDLHFVYPAVDVYRGPETDGVPTLSRFLEPIPPSILPHASLAGE*
Ga0134128_1254286813300010373Terrestrial SoilYPAVNVYFGPETDGSAPTLSRFLEPIPPSILPHAELS*
Ga0105239_1080463623300010375Corn RhizosphereYVAATRAKSDLTFVYPVNVYRGPEADNTPALSRFLEPIPHDVLAHASLD*
Ga0134124_1062966923300010397Terrestrial SoilFVYPVNVYRGPEADNTPALSRFLEPIPHNVLAHASLD*
Ga0134124_1165237813300010397Terrestrial SoilKKDLHFVYPAVDVYRGPETDGTPTLSRFLKPIPPSILPHASLAGE*
Ga0134124_1207229113300010397Terrestrial SoilRLLYVATTRAKRDLHFVYPAVNVYAGPETDGVPTLSRFLEPIPPSVLQHASLAVGE*
Ga0134122_1047227613300010400Terrestrial SoilTTRAKQDLSFVYPVNVYRGPDTDGTPALSRFLEPIPPEILAHASLD*
Ga0134122_1109119033300010400Terrestrial SoilVDVYRGPETDGTPTLSRFLEPIPGSILPHASLDGE*
Ga0134122_1180576913300010400Terrestrial SoilAATRARKDLSFVYPVNVYRGPEADGTPALSRFLEPIPQDILAHASLD*
Ga0120187_104186913300012015TerrestrialTRAKKQLNYVYPAVDVYRGPETDGIPTLSRFLEPISPSILPHASLLGE*
Ga0157284_1034915123300012893SoilTTRAKKELHFVYPAVNVYNGPETDGSPTLSRFLEPIAPSILPHASLMGSD*
Ga0157298_1014344733300012913SoilLLYVATTRAKKELHFVYPAVDVYRGPEADGTPTLSRFLEPIPQSILPHASLADH*
Ga0157373_1142284423300013100Corn RhizosphereYPAVDVYRGPETEGTPTLSRFLEPIPPSILPHASLAGE*
Ga0157374_1137022723300013296Miscanthus RhizosphereDLNFVYPINVYRGPETDGTPALSRFLEPISPEILTHASLD*
Ga0157374_1244497713300013296Miscanthus RhizosphereTTRAKSELHFVYPAVNVYAGPETDGVPTLSRFLEPIPPTILPHASLDGG*
Ga0157378_1317599513300013297Miscanthus RhizosphereRAKKELHFVYPAVDVYRGPETDSTPTLSRFLEPIPGSILPHASLDGE*
Ga0163162_1182810013300013306Switchgrass RhizospherePAVDVYRGPEADGVPTLSRFLEPIPPSILPHASLAGE*
Ga0163163_1108457313300014325Switchgrass RhizosphereTTRAKKELHFVYPAVDVYRGPETDGTPTLSRFLEPIPPSVLPHASLDGE*
Ga0157380_1002722613300014326Switchgrass RhizosphereKKELHFIYPAVNVYMGPEVDGSPTLSRFLEPIPPTVLQHASLLDGN*
Ga0157377_1078524223300014745Miscanthus RhizosphereYVATTRAKKELHFVYPAVNVYNNLETDGSPTLSRFLEPIEQSILPHASLMGSD*
Ga0157377_1172485223300014745Miscanthus RhizosphereLYVATTRAKKELHFVYPAVDVYRGPETDGTPTLSRFLEPIPPSVLPHASLAGE*
Ga0132258_1279589623300015371Arabidopsis RhizosphereLHFVYPTNVYRGPESDSQPMVSRFLEPIPAEILPHASLFGGE*
Ga0132257_10024085113300015373Arabidopsis RhizospherePVNVYRGPEADNTPALSRFLEPIPHDVLAHASLD*
Ga0132257_10061987413300015373Arabidopsis RhizosphereRDLHFVYPAVNVYAGPETDGTPTLSRFLEPIPPTILPHAELS*
Ga0132255_10633757923300015374Arabidopsis RhizosphereKKELHFVYPAVDVYRGPETDGTPTLSRFLEPIPPSILPHASLAGE*
Ga0190265_1355460213300018422SoilLHFVYPAVNVYNGPETDGSPTLSRFLEPISPSILQHAVLG
Ga0190268_1045624733300018466SoilHFVYPAVDVYKGPETDGTPTLSRFLEPIPPSILPHASLLGE
Ga0193717_102961923300020060SoilAKRELHFVYPLNVYRGPETDSVPALSRFLEPISDTILPRASLLGVE
Ga0182009_1024232713300021445SoilVNVYAGPETDGTPTLSRFLEPIAPSILHHASLTGGE
Ga0247695_100117063300024179SoilDRRLLYVATTRAKRDLHFVYPAVNVYAGPETDGTPTLSRFLEPIPPSVLHHAELS
Ga0207688_1033849313300025901Corn, Switchgrass And Miscanthus RhizosphereRAKRDLNFVYPINVYRGPETDGTPALSRFLEPISPEILTHASLD
Ga0207643_1056798333300025908Miscanthus RhizosphereRLLYVATTRAKKELHFVYPAVDVYRGPEADGGAPTLSRFLEPIPPSILPHASLSGE
Ga0207654_1044077513300025911Corn RhizosphereAVDVYRGPETDGTPTLSRFLEPIPPSILPHASLAGE
Ga0207654_1051254213300025911Corn RhizosphereVDVYRGPETDGTPTLSRFLEPIPPSILPHASLAGE
Ga0207654_1094989823300025911Corn RhizosphereVYPAVDVYRGPETDGGAPTLSRFLEPIPPSILPHASLSGD
Ga0207660_1167319523300025917Corn RhizosphereRLLYVATTRAKKELHFVYPAVDVYRGPETDGTPTLSRFLEPIPPSILPHASLLG
Ga0207662_1048709233300025918Switchgrass RhizosphereRLLYVATTRAKKELHFVYPAVDVYRGPETDGTPTLSRFLEPIPPSILPHASLAGE
Ga0207662_1064427813300025918Switchgrass RhizosphereRRLLYVATTRAKKELHFVYPAVDVYRGPEADGGAPTLSRFLEPIPPSILPHASLSGE
Ga0207646_1075405023300025922Corn, Switchgrass And Miscanthus RhizosphereVATTRAKRELHFVYPLNVYRYGENDSVPALSRFLEPIPSTILPHAALSGEG
Ga0207650_1160780923300025925Switchgrass RhizosphereLLRRLLYVATTRAKRDLSFVYPVNVYRGPETDGTPALSRFLEPIPPEILTHASLD
Ga0207669_1054605413300025937Miscanthus RhizosphereNFVYPVNVYRGPDADGTPALSRFLEPIPPEVLTHASLD
Ga0207711_1192481023300025941Switchgrass RhizosphereLYVATTRAKKELHFVYPAVDVYRGPEADGGAPTLSRFLEPIPPSILPHASLSGE
Ga0207651_1017017333300025960Switchgrass RhizosphereTRAKKELHFIYPAVNVYMGPEVDGSPTLSRFLEPIPPTVLQHASLLDGN
Ga0207651_1072569613300025960Switchgrass RhizosphereATRAKRDLNFVYPINVYRGPETDGTPALSRFLEPISPEILAHASLD
Ga0207651_1087084133300025960Switchgrass RhizosphereEERRLLYVATTRAKKDLHFVYPAVDVYRGPETDGTPTLSRFLEPIPPSILPHASLAGE
Ga0207651_1129463413300025960Switchgrass RhizosphereVATTRAKKELHFVYPAVDVYRGPETDGTPTLSRFLEPIPPSVLPHASLDGE
Ga0207703_1068220733300026035Switchgrass RhizosphereVYPAVDVYRGPETDGGAPTLSRFLEPIPLSILPHASLSGE
Ga0207708_1019849813300026075Corn, Switchgrass And Miscanthus RhizosphereLHYVYPAVDVYRGPETDGTPTLSRFLEPIPPSILPHASLLG
Ga0207641_1143877523300026088Switchgrass RhizosphereYVATTRAKKELHFVYPAVDVYRGPETDGGAPTLSRFLEPIPLSILPHASLSGE
Ga0207641_1175077813300026088Switchgrass RhizosphereLLYVATTRAKKELHFVYPAVNVYNGPEADGSPTLSRFLEPIPPSILQHAALLDGN
Ga0207674_1119989713300026116Corn RhizosphereRKELNFVYPVNVYRGPDTDGTPALSRFLEPIPPQILTHASLD
Ga0209382_1069040333300027909Populus RhizosphereLLYVATTRAKKQLNYVYPAVDVYRGPETDGTPTLSRFLEPIPPSILPHASLTGE
Ga0310888_1107087023300031538SoilKELHFVYPAVDVYRGPEMDGTPTLSRFLEPIPPTILPHASLI
Ga0310904_1104417313300031854SoilLYVATTRAKKELHFVYPAVDVYRGPETDGTPTLSRFLEPIPPSILPHASLAGE
Ga0307412_1087080933300031911RhizosphereRRLLYVATTRAKKDLHFVYPAVDVYKGPETEGTPTLSRFLEPIPPTILPHASLAGE
Ga0307411_1114673733300032005RhizosphereYVATTRAKKELHFVYPAVDVYRGPETDGTPTLSRFLEPIPPSVLPHASLLGE
Ga0315912_1013325013300032157SoilVYPAVNVYAGPETDGTPTLSRFLEPIPPSILPHASLA
Ga0307472_10253469423300032205Hardwood Forest SoilTTRAKKELNFVYPVNAYRGPETDGTPALSRFLEPVPPEILVHASLD
Ga0310810_1066736413300033412SoilAATRAKSDLTFVYPVNVYRGPEADNTPALSRFLEPIPHDVLAHASLD

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.