Basic Information | |
---|---|
Family ID | F058802 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 134 |
Average Sequence Length | 42 residues |
Representative Sequence | SYPTNQPALVAMKVGAVTPLAVVVTPLVWGKDYPLGAKR |
Number of Associated Samples | 98 |
Number of Associated Scaffolds | 134 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 100.00 % |
% of genes from short scaffolds (< 2000 bps) | 74.63 % |
Associated GOLD sequencing projects | 92 |
AlphaFold2 3D model prediction | No |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (50.000 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine (32.090 % of family members) |
Environment Ontology (ENVO) | Unclassified (32.836 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (44.030 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 5.13% β-sheet: 5.13% Coil/Unstructured: 89.74% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 134 Family Scaffolds |
---|---|---|
PF13561 | adh_short_C2 | 37.31 |
PF11298 | DUF3099 | 26.87 |
PF02104 | SURF1 | 18.66 |
PF00005 | ABC_tran | 5.22 |
PF00664 | ABC_membrane | 4.48 |
PF01883 | FeS_assembly_P | 2.24 |
PF00355 | Rieske | 2.24 |
PF05198 | IF3_N | 0.75 |
PF00106 | adh_short | 0.75 |
PF00266 | Aminotran_5 | 0.75 |
PF00453 | Ribosomal_L20 | 0.75 |
COG ID | Name | Functional Category | % Frequency in 134 Family Scaffolds |
---|---|---|---|
COG3346 | Cytochrome oxidase assembly protein ShyY1 | Posttranslational modification, protein turnover, chaperones [O] | 18.66 |
COG0290 | Translation initiation factor IF-3 | Translation, ribosomal structure and biogenesis [J] | 0.75 |
COG0292 | Ribosomal protein L20 | Translation, ribosomal structure and biogenesis [J] | 0.75 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 50.00 % |
Unclassified | root | N/A | 50.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001282|B570J14230_10018878 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2542 | Open in IMG/M |
3300002161|JGI24766J26685_10065605 | Not Available | 796 | Open in IMG/M |
3300002161|JGI24766J26685_10102735 | Not Available | 608 | Open in IMG/M |
3300003413|JGI25922J50271_10001797 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 6200 | Open in IMG/M |
3300003413|JGI25922J50271_10002064 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5815 | Open in IMG/M |
3300003430|JGI25921J50272_10019379 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1855 | Open in IMG/M |
3300004772|Ga0007791_10064477 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1157 | Open in IMG/M |
3300004792|Ga0007761_11334478 | Not Available | 705 | Open in IMG/M |
3300004794|Ga0007751_11458796 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1611 | Open in IMG/M |
3300005662|Ga0078894_10842527 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 799 | Open in IMG/M |
3300005662|Ga0078894_11368404 | Not Available | 592 | Open in IMG/M |
3300006805|Ga0075464_10003529 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium SCGC AAA028-I14 | 7244 | Open in IMG/M |
3300006805|Ga0075464_10227016 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1113 | Open in IMG/M |
3300006805|Ga0075464_10243530 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1074 | Open in IMG/M |
3300006805|Ga0075464_10910338 | Not Available | 549 | Open in IMG/M |
3300006805|Ga0075464_10955601 | Not Available | 536 | Open in IMG/M |
3300007363|Ga0075458_10267618 | Not Available | 519 | Open in IMG/M |
3300007544|Ga0102861_1065758 | Not Available | 950 | Open in IMG/M |
3300007544|Ga0102861_1129404 | Not Available | 681 | Open in IMG/M |
3300007545|Ga0102873_1021360 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1993 | Open in IMG/M |
3300007545|Ga0102873_1083294 | Not Available | 971 | Open in IMG/M |
3300007547|Ga0102875_1125287 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 813 | Open in IMG/M |
3300007554|Ga0102820_1153747 | Not Available | 555 | Open in IMG/M |
3300007560|Ga0102913_1191629 | Not Available | 657 | Open in IMG/M |
3300007562|Ga0102915_1153226 | Not Available | 752 | Open in IMG/M |
3300007562|Ga0102915_1211901 | Not Available | 629 | Open in IMG/M |
3300007585|Ga0102916_1106140 | Not Available | 752 | Open in IMG/M |
3300007597|Ga0102919_1009212 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2927 | Open in IMG/M |
3300007597|Ga0102919_1078075 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1038 | Open in IMG/M |
3300007600|Ga0102920_1253695 | Not Available | 566 | Open in IMG/M |
3300007606|Ga0102923_1146219 | Not Available | 739 | Open in IMG/M |
3300007617|Ga0102897_1048793 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1342 | Open in IMG/M |
3300007618|Ga0102896_1066693 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Embleya → Embleya scabrispora | 1190 | Open in IMG/M |
3300007620|Ga0102871_1109827 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 789 | Open in IMG/M |
3300007634|Ga0102901_1059692 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1102 | Open in IMG/M |
3300007634|Ga0102901_1066182 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1042 | Open in IMG/M |
3300007644|Ga0102902_1006464 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3448 | Open in IMG/M |
3300007651|Ga0102900_1092618 | Not Available | 651 | Open in IMG/M |
3300007653|Ga0102868_1048290 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 932 | Open in IMG/M |
3300007653|Ga0102868_1129767 | Not Available | 590 | Open in IMG/M |
3300007653|Ga0102868_1136706 | Not Available | 577 | Open in IMG/M |
3300007661|Ga0102866_1069505 | Not Available | 864 | Open in IMG/M |
3300007665|Ga0102908_1026388 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1100 | Open in IMG/M |
3300007665|Ga0102908_1092297 | Not Available | 607 | Open in IMG/M |
3300007667|Ga0102910_1009362 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2184 | Open in IMG/M |
3300007670|Ga0102862_1014297 | Not Available | 1788 | Open in IMG/M |
3300007708|Ga0102859_1282188 | Not Available | 501 | Open in IMG/M |
3300007954|Ga0105739_1019598 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1380 | Open in IMG/M |
3300007972|Ga0105745_1230879 | Not Available | 590 | Open in IMG/M |
3300007973|Ga0105746_1216350 | Not Available | 656 | Open in IMG/M |
3300007974|Ga0105747_1126093 | Not Available | 814 | Open in IMG/M |
3300008055|Ga0108970_10459504 | Not Available | 703 | Open in IMG/M |
3300008055|Ga0108970_11718233 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1337 | Open in IMG/M |
3300008111|Ga0114344_1026319 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2935 | Open in IMG/M |
3300008111|Ga0114344_1030221 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2155 | Open in IMG/M |
3300008111|Ga0114344_1158129 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 766 | Open in IMG/M |
3300008117|Ga0114351_1082411 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2240 | Open in IMG/M |
3300008117|Ga0114351_1451174 | Not Available | 520 | Open in IMG/M |
3300008119|Ga0114354_1027163 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3983 | Open in IMG/M |
3300008261|Ga0114336_1007956 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 8837 | Open in IMG/M |
3300008261|Ga0114336_1060338 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1919 | Open in IMG/M |
3300008957|Ga0104239_1003459 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1558 | Open in IMG/M |
3300008961|Ga0102887_1070232 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1130 | Open in IMG/M |
3300008996|Ga0102831_1185906 | Not Available | 688 | Open in IMG/M |
3300009049|Ga0102911_1006839 | Not Available | 3542 | Open in IMG/M |
3300009180|Ga0114979_10663703 | Not Available | 592 | Open in IMG/M |
3300010354|Ga0129333_10604558 | Not Available | 951 | Open in IMG/M |
3300011268|Ga0151620_1004962 | Not Available | 4933 | Open in IMG/M |
3300011268|Ga0151620_1236178 | Not Available | 546 | Open in IMG/M |
3300012713|Ga0157544_1020622 | Not Available | 699 | Open in IMG/M |
3300012726|Ga0157597_1166347 | Not Available | 969 | Open in IMG/M |
3300013004|Ga0164293_10056247 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3150 | Open in IMG/M |
3300013004|Ga0164293_10057369 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3112 | Open in IMG/M |
3300013004|Ga0164293_10779511 | Not Available | 607 | Open in IMG/M |
3300013005|Ga0164292_10045749 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3465 | Open in IMG/M |
3300018815|Ga0187845_1068237 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1218 | Open in IMG/M |
3300020529|Ga0208233_1000454 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 7742 | Open in IMG/M |
3300020536|Ga0207939_1000521 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 11203 | Open in IMG/M |
3300020537|Ga0208722_1000669 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 9517 | Open in IMG/M |
3300020551|Ga0208360_1001191 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 5263 | Open in IMG/M |
3300020559|Ga0208083_1051289 | Not Available | 678 | Open in IMG/M |
3300020569|Ga0208229_1014785 | Not Available | 1416 | Open in IMG/M |
3300021141|Ga0214163_1026972 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1668 | Open in IMG/M |
3300021516|Ga0194045_1127503 | Not Available | 633 | Open in IMG/M |
3300024343|Ga0244777_10402168 | Not Available | 853 | Open in IMG/M |
3300024348|Ga0244776_10326039 | Not Available | 1040 | Open in IMG/M |
3300024348|Ga0244776_10439402 | Not Available | 856 | Open in IMG/M |
3300024571|Ga0256302_1103687 | Not Available | 669 | Open in IMG/M |
3300025455|Ga0208376_1027422 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1225 | Open in IMG/M |
3300025585|Ga0208546_1105599 | Not Available | 628 | Open in IMG/M |
3300025635|Ga0208147_1045554 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1131 | Open in IMG/M |
3300025896|Ga0208916_10074968 | Not Available | 1411 | Open in IMG/M |
3300025896|Ga0208916_10138674 | Not Available | 1042 | Open in IMG/M |
3300025896|Ga0208916_10291103 | Not Available | 711 | Open in IMG/M |
3300027084|Ga0208443_1000882 | Not Available | 8117 | Open in IMG/M |
3300027084|Ga0208443_1081745 | Not Available | 635 | Open in IMG/M |
3300027127|Ga0255071_1001855 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Planktophila | 3933 | Open in IMG/M |
3300027138|Ga0255064_1050521 | Not Available | 658 | Open in IMG/M |
3300027141|Ga0255076_1034160 | Not Available | 908 | Open in IMG/M |
3300027222|Ga0208024_1033716 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 998 | Open in IMG/M |
3300027225|Ga0208025_1016155 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1335 | Open in IMG/M |
3300027227|Ga0208929_1005355 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Planktophila | 3171 | Open in IMG/M |
3300027258|Ga0208558_1030472 | Not Available | 787 | Open in IMG/M |
3300027320|Ga0208923_1078517 | Not Available | 585 | Open in IMG/M |
3300027508|Ga0255072_1002023 | Not Available | 4593 | Open in IMG/M |
3300027596|Ga0255119_1053461 | Not Available | 770 | Open in IMG/M |
3300027732|Ga0209442_1316352 | Not Available | 533 | Open in IMG/M |
3300027785|Ga0209246_10233484 | Not Available | 714 | Open in IMG/M |
3300027785|Ga0209246_10252198 | Not Available | 683 | Open in IMG/M |
3300027805|Ga0209229_10011563 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Planktophila | 3740 | Open in IMG/M |
3300027805|Ga0209229_10097595 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1323 | Open in IMG/M |
3300027805|Ga0209229_10237838 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Planktophila | 811 | Open in IMG/M |
3300027892|Ga0209550_10013377 | Not Available | 7353 | Open in IMG/M |
3300027892|Ga0209550_10351702 | Not Available | 928 | Open in IMG/M |
3300027892|Ga0209550_10434241 | Not Available | 804 | Open in IMG/M |
3300027983|Ga0209284_10556128 | Not Available | 542 | Open in IMG/M |
3300031758|Ga0315907_10733759 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 747 | Open in IMG/M |
3300031784|Ga0315899_11456526 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Planktophila | 576 | Open in IMG/M |
3300031786|Ga0315908_10093461 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2400 | Open in IMG/M |
3300031786|Ga0315908_10422153 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Planktophila → Candidatus Planktophila vernalis | 1116 | Open in IMG/M |
3300031787|Ga0315900_10034350 | Not Available | 5577 | Open in IMG/M |
3300031787|Ga0315900_10429742 | Not Available | 1029 | Open in IMG/M |
3300031857|Ga0315909_10029897 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Planktophila → Candidatus Planktophila vernalis | 5306 | Open in IMG/M |
3300031857|Ga0315909_10133254 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Planktophila → Candidatus Planktophila vernalis | 2077 | Open in IMG/M |
3300031857|Ga0315909_10230863 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1437 | Open in IMG/M |
3300031951|Ga0315904_10537519 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1021 | Open in IMG/M |
3300031963|Ga0315901_10040690 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Planktophila → Candidatus Planktophila vernalis | 4638 | Open in IMG/M |
3300032050|Ga0315906_10665184 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 843 | Open in IMG/M |
3300032092|Ga0315905_11561268 | Not Available | 514 | Open in IMG/M |
3300032093|Ga0315902_10130801 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Planktophila → Candidatus Planktophila vernalis | 2653 | Open in IMG/M |
3300033992|Ga0334992_0112349 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1442 | Open in IMG/M |
3300033993|Ga0334994_0240363 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales | 954 | Open in IMG/M |
3300034105|Ga0335035_0287965 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales | 974 | Open in IMG/M |
3300034167|Ga0335017_0000247 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Planktophila | 28060 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 32.09% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 10.45% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 9.70% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 8.21% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 7.46% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 5.97% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 5.22% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 4.48% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 3.73% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 2.99% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 2.24% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.49% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.49% |
Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 1.49% |
Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.75% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.75% |
Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 0.75% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.75% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001282 | Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion | Environmental | Open in IMG/M |
3300002161 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA | Environmental | Open in IMG/M |
3300003413 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD | Environmental | Open in IMG/M |
3300003430 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD | Environmental | Open in IMG/M |
3300004772 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0.5M | Environmental | Open in IMG/M |
3300004792 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004794 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
3300007363 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA | Environmental | Open in IMG/M |
3300007544 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3 | Environmental | Open in IMG/M |
3300007545 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-3 | Environmental | Open in IMG/M |
3300007547 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-02 | Environmental | Open in IMG/M |
3300007554 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.709 | Environmental | Open in IMG/M |
3300007560 | Estuarine microbial communities from the Columbia River estuary - metaG 1560A-02 | Environmental | Open in IMG/M |
3300007562 | Estuarine microbial communities from the Columbia River estuary - metaG 1561A-02 | Environmental | Open in IMG/M |
3300007585 | Estuarine microbial communities from the Columbia River estuary - metaG 1562A-3 | Environmental | Open in IMG/M |
3300007597 | Estuarine microbial communities from the Columbia River estuary - metaG 1563A-02 | Environmental | Open in IMG/M |
3300007600 | Estuarine microbial communities from the Columbia River estuary - metaG 1568A-3 | Environmental | Open in IMG/M |
3300007606 | Estuarine microbial communities from the Columbia River estuary - metaG 1569-02 | Environmental | Open in IMG/M |
3300007617 | Estuarine microbial communities from the Columbia River estuary - metaG 1554B-02 | Environmental | Open in IMG/M |
3300007618 | Estuarine microbial communities from the Columbia River estuary - metaG 1554A-02 | Environmental | Open in IMG/M |
3300007620 | Estuarine microbial communities from the Columbia River estuary - metaG 1546C-02 | Environmental | Open in IMG/M |
3300007634 | Estuarine microbial communities from the Columbia River estuary - metaG 1555A-02 | Environmental | Open in IMG/M |
3300007644 | Estuarine microbial communities from the Columbia River estuary - metaG 1555B-02 | Environmental | Open in IMG/M |
3300007651 | Estuarine microbial communities from the Columbia River estuary - metaG 1555C-3 | Environmental | Open in IMG/M |
3300007653 | Estuarine microbial communities from the Columbia River estuary - metaG 1546C-3 | Environmental | Open in IMG/M |
3300007661 | Estuarine microbial communities from the Columbia River estuary - metaG 1546A-3 | Environmental | Open in IMG/M |
3300007665 | Estuarine microbial communities from the Columbia River estuary - metaG 1557A-3 | Environmental | Open in IMG/M |
3300007667 | Estuarine microbial communities from the Columbia River estuary - metaG 1558A-3 | Environmental | Open in IMG/M |
3300007670 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-3 | Environmental | Open in IMG/M |
3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
3300007954 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373B_0.2um | Environmental | Open in IMG/M |
3300007972 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0um | Environmental | Open in IMG/M |
3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
3300008111 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NA | Environmental | Open in IMG/M |
3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008119 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0110-C-NA | Environmental | Open in IMG/M |
3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
3300008957 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT2 | Environmental | Open in IMG/M |
3300008961 | Estuarine microbial communities from the Columbia River estuary - metaG 1550B-02 | Environmental | Open in IMG/M |
3300008996 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 | Environmental | Open in IMG/M |
3300009049 | Estuarine microbial communities from the Columbia River estuary - metaG 1558A-02 | Environmental | Open in IMG/M |
3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
3300012713 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES033 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012726 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES115 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
3300018815 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_68 | Environmental | Open in IMG/M |
3300020529 | Freshwater microbial communities from Lake Mendota, WI - 07SEP2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020536 | Freshwater microbial communities from Lake Mendota, WI - 02JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020537 | Freshwater microbial communities from Lake Mendota, WI - 21SEP2011 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020551 | Freshwater microbial communities from Lake Mendota, WI - 27JUL2010 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
3300020559 | Freshwater microbial communities from Lake Mendota, WI - 07JUL2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020569 | Freshwater microbial communities from Lake Mendota, WI - 22AUG2011 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300021141 | Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnion | Environmental | Open in IMG/M |
3300021516 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L626-11m | Environmental | Open in IMG/M |
3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
3300024571 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025455 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA2.5M (SPAdes) | Environmental | Open in IMG/M |
3300025585 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025635 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300027084 | Estuarine microbial communities from the Columbia River estuary - metaG 1554A-02 (SPAdes) | Environmental | Open in IMG/M |
3300027127 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepC_8h | Environmental | Open in IMG/M |
3300027138 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_0h | Environmental | Open in IMG/M |
3300027141 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepB_8h | Environmental | Open in IMG/M |
3300027222 | Estuarine microbial communities from the Columbia River estuary - metaG 1546B-02 (SPAdes) | Environmental | Open in IMG/M |
3300027225 | Estuarine microbial communities from the Columbia River estuary - metaG 1549A-3 (SPAdes) | Environmental | Open in IMG/M |
3300027227 | Estuarine microbial communities from the Columbia River estuary - metaG 1548A-02 (SPAdes) | Environmental | Open in IMG/M |
3300027258 | Estuarine microbial communities from the Columbia River estuary - metaG 1562A-3 (SPAdes) | Environmental | Open in IMG/M |
3300027320 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 (SPAdes) | Environmental | Open in IMG/M |
3300027508 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8h | Environmental | Open in IMG/M |
3300027596 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepC_8h | Environmental | Open in IMG/M |
3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027983 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-03 (SPAdes) | Environmental | Open in IMG/M |
3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
3300031786 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA124 | Environmental | Open in IMG/M |
3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
3300033992 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035 | Environmental | Open in IMG/M |
3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
3300034105 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127 | Environmental | Open in IMG/M |
3300034167 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Apr2015-rr0082 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
B570J14230_100188784 | 3300001282 | Freshwater | PQGQEKYFSYPTNQPALVAMKVGAVTPLAVVVTPLVWGKDYPLGPKRRN* |
JGI24766J26685_100656053 | 3300002161 | Freshwater And Sediment | QEKYISYPTNQPALVAMKVGAVTPLAVVVTPLVWGQGYPLGRKR* |
JGI24766J26685_101027353 | 3300002161 | Freshwater And Sediment | QPALVAMKVGAVTPLAVVVTPLVWGKDYPLGXKR* |
JGI25922J50271_100017971 | 3300003413 | Freshwater Lake | YPTNQPALVAMKVGAVTPLAVVVTPLVWGKDYPLGPKRRN* |
JGI25922J50271_100020648 | 3300003413 | Freshwater Lake | KPQGQEKYFSYPTNQPALVAMKVGAVTPLAVVVTPLVWGQDYPLGRKR* |
JGI25921J50272_100193791 | 3300003430 | Freshwater Lake | KPQGQEKYISYPTNQPALVAMKVGAVTPLAVVVTPLVWGQGYPLGRKR* |
Ga0007791_100644773 | 3300004772 | Freshwater | CKRKPQGQEKYFSYPTNQPALVAMKVGAVTPLAVTVTPLVWVKGYPLRGKR* |
Ga0007761_113344782 | 3300004792 | Freshwater Lake | ISHPTNQLALVAKKVGAVTPLAVIIRPLVWGKDYPLGAKR* |
Ga0007751_114587961 | 3300004794 | Freshwater Lake | ISHPTNQLALVAKKVGAVTPLAVIIRPLVWSKDYPLGAKR* |
Ga0078894_108425271 | 3300005662 | Freshwater Lake | KYISYPTNQPALVAMKVGAVTPLAVVVTPLVWGKDYPFGLKRRN* |
Ga0078894_113684041 | 3300005662 | Freshwater Lake | NQLALVAKKVGAVTPLAVIIRPLVWGKDYRLGAKR* |
Ga0075464_100035291 | 3300006805 | Aqueous | GQEKYISYPTNQPALVAMKVGAVTPLAVVVTPLVWGKDYPLGPKRRN* |
Ga0075464_102270163 | 3300006805 | Aqueous | TNQPALVAMKVGAVTPLAVTVTPLVWGKDYPHRG* |
Ga0075464_102435301 | 3300006805 | Aqueous | GQEKYISYPTNQPALVAMKVGAVTPLAVVVTPLVWGKDYPLGAKR* |
Ga0075464_109103381 | 3300006805 | Aqueous | GQEKYFSYPTNQLALVAMKVGAVTPLAVVVTPLVWGKGYPYRGQKAN* |
Ga0075464_109556012 | 3300006805 | Aqueous | CKRKPQGQEKYFSYPTNQLALVAMKVGAVTPLAVVVTPLV* |
Ga0075458_102676182 | 3300007363 | Aqueous | GQEKYFSYPTNQPALVAMKVGAVTPLAVTVTPLVWGKDYPHRG* |
Ga0102861_10657582 | 3300007544 | Estuarine | PTNQLALVAKKVGAVTPLAVIIRPLVWGKDYPLGPKR* |
Ga0102861_11294043 | 3300007544 | Estuarine | FSYPTNQPALVAMKVGAVTPLAVVVTPLVWGKDYPLGPKRRN* |
Ga0102873_10213601 | 3300007545 | Estuarine | KPQGQEKYFSYPTNQPALVAMKVGAVTPLAVTVTPLVWGKDYPHRG* |
Ga0102873_10832941 | 3300007545 | Estuarine | KFSYPTNQPALVAMKVGAVTPLAVVVTPLVWDKGYPLTGKR* |
Ga0102875_11252873 | 3300007547 | Estuarine | YPTNQPALVAMKVGAVTPLAVVVTPLVWGKDYPFGLKRRN* |
Ga0102820_11537471 | 3300007554 | Estuarine | NQPALVAMKVGAVTPLAVVVTPLVWGKDYPLGPKRRN* |
Ga0102913_11916292 | 3300007560 | Estuarine | ISHPTNQLALVAKKVGAVTPLAVIIRPLVWGKDYLLGAKR* |
Ga0102915_11532261 | 3300007562 | Estuarine | GQEKYISYPTNQPALVAMKVGAVTPLAVVVTPLVWGKDYPFGLKRRN* |
Ga0102915_12119013 | 3300007562 | Estuarine | SYPTNQPALVAMKVGAVTPLAVVVTPLVWGQGYPLGRKR* |
Ga0102916_11061401 | 3300007585 | Estuarine | SHPTNQLALVAKKVGAVTPLAVIIRPLVWGKDYLLGAKR* |
Ga0102919_10092124 | 3300007597 | Estuarine | KPQGQEKYISYPTNQPALVAMKVGAVTPLAVVVTPLVWGKDYPLGPKRRN* |
Ga0102919_10780751 | 3300007597 | Estuarine | SYPTNQPALVAMKVGAVTPLAVVVTPLVWGKDYPFGLKRRN* |
Ga0102920_12536951 | 3300007600 | Estuarine | TNQLALVAKKVGAVTPLAVIIRPLVWSKDYPLGAKR* |
Ga0102923_11462191 | 3300007606 | Estuarine | KYISYPTNQPALVAMKVGAVTPLAVVVTPLVWGKDYPLGPKRRN* |
Ga0102897_10487934 | 3300007617 | Estuarine | NQPALVAMKVGAVTPLAVVVTPLVWGKDYPLGPKR* |
Ga0102896_10666931 | 3300007618 | Estuarine | QRCKRKPQGQEKYFSYPTNQPALVAMKVGAVTPLAVVVTPLVWGKDYTLGPKR* |
Ga0102871_11098271 | 3300007620 | Estuarine | EKYISYPTNQPALVAMKVGAVTPLAVVVTPLVWGKDYPLGPKR* |
Ga0102901_10596923 | 3300007634 | Estuarine | PTNQLALVAKKVGAVTPLAVIIRPLVWGKDYPLGAKR* |
Ga0102901_10661823 | 3300007634 | Estuarine | QLALVAKKVGAVTPLAVIIRPLVWGKDYRLGAKR* |
Ga0102902_10064641 | 3300007644 | Estuarine | PQGQEKYFSYPTNQPALVAMKVGAVTPLAVTVTPLVWGKDYPHRGKR* |
Ga0102900_10926182 | 3300007651 | Estuarine | FSYPTNQPALVAMKVGAVTPLAVTVTPLVWGKDYPHRGKR* |
Ga0102868_10482901 | 3300007653 | Estuarine | TNQPALVAMKVGAVTPLAVVVTPLVWGKDYPLGPKRRN* |
Ga0102868_11297671 | 3300007653 | Estuarine | HPTNQLALVAKKVGAVTPLAVIIRPLVWGKDYRLGAKR* |
Ga0102868_11367062 | 3300007653 | Estuarine | HPTNQLALVAKKVGAVTPLAVIIRPLVWGKDYLLGAKR* |
Ga0102866_10695051 | 3300007661 | Estuarine | SHPTNQLALVAKKVGAVTPLAVIIRPLVWGKDYPLGAKR* |
Ga0102908_10263881 | 3300007665 | Estuarine | NQLALVAKKVGAVTPLAVIIRPLVWGKDYPLGTKR* |
Ga0102908_10922973 | 3300007665 | Estuarine | QEKYISYPTNQPALVAMKVGAVTPLAVVVTPLVWGKDYPLGPKRRN* |
Ga0102910_10093624 | 3300007667 | Estuarine | EKYISYPTNQPALVAMKVGAVTPLAVVVTPLVWGKDYPLGPKRRN* |
Ga0102862_10142974 | 3300007670 | Estuarine | HPTNQLALVAKKVGAVTPLAVIIRPLVWGKDYPLGAKR* |
Ga0102859_12821881 | 3300007708 | Estuarine | YPTNQPALVAMKVGAVTPLAVVVTPLVWGKDYPLGLKRRN* |
Ga0105739_10195984 | 3300007954 | Estuary Water | ALVAMKVGAVTPLAVVVTPLVWGKDYPLGPKRRN* |
Ga0105745_12308792 | 3300007972 | Estuary Water | SYPTNQPALVAMKVGAVTPLAVDVTPLVWGKDYP* |
Ga0105746_12163501 | 3300007973 | Estuary Water | ISHPTNQLALVAKKVGAVTPLAVIIRPLVWGKDYRLGAKR* |
Ga0105747_11260931 | 3300007974 | Estuary Water | NQPALVAMKVGAVTPLAVVVTPLVWGKDYPLTGKR* |
Ga0108970_104595041 | 3300008055 | Estuary | PQGQEKYFSYPTNQPALVAMKVGAVTPLAVVVTPLVWGQGYPLGRKR* |
Ga0108970_117182331 | 3300008055 | Estuary | PTNQPALVAMKVGAVTPLAVVVTPLVWGKDYPFGLKRRN* |
Ga0114344_10263191 | 3300008111 | Freshwater, Plankton | KPQGQEKYISYPTNQPALVAMKVGAVTPLAVVVTPLVWSKDYPLRPKR* |
Ga0114344_10302211 | 3300008111 | Freshwater, Plankton | KYISYPTNQPALVAMKVGAVTPLAVVVTPLVWGKDYPLGPKR* |
Ga0114344_11581293 | 3300008111 | Freshwater, Plankton | EKYISYPTNQPALVAMKVGAVTPLAVVVTPLVWGKDYPLRPKR* |
Ga0114351_10824111 | 3300008117 | Freshwater, Plankton | SYPTNQPALVAMKVGAVTPLAVVVTPLVWGKDYPLGAKR* |
Ga0114351_14511743 | 3300008117 | Freshwater, Plankton | NQPALVAMKVGAVTPLAVVITPLVWGKDYLLGPKRRN* |
Ga0114354_10271631 | 3300008119 | Freshwater, Plankton | FSYPTNQPALVAMKVGAVTPLAVVVTPLVWGKDYP* |
Ga0114336_100795612 | 3300008261 | Freshwater, Plankton | QRCKRKPQGQEKYFSYPTNQPALVAMKVGAVTPLAVVVTPLVWGQGYPLGRKR* |
Ga0114336_10603381 | 3300008261 | Freshwater, Plankton | QRCKRKPQGQEKYFSYPTNQPALVAMKVGAVTPLAVVATPLVWGKDYPLGAKRRN* |
Ga0104239_10034591 | 3300008957 | Freshwater | CKRKPQGQEKYFSYPTNQPALVAMKVGAVTPLAVTVTPKR* |
Ga0102887_10702321 | 3300008961 | Estuarine | QPALEAMKVGAVTPLAVVVTPLVWGKDYPLGPKRRN* |
Ga0102831_11859061 | 3300008996 | Estuarine | EKYFSYPTNQPALVAMKVGAVTPLAVVVTPLVWGQGYPLGRKR* |
Ga0102911_10068391 | 3300009049 | Estuarine | KRKPQGQEKYISYPTNQPALVAMKVGAVTPLAVVVTPLVWGKDYPLGPKRRN* |
Ga0114979_106637031 | 3300009180 | Freshwater Lake | NQPALVAMKVGAVTPLAVVVTPLVWSKGYPLRGKR* |
Ga0129333_106045581 | 3300010354 | Freshwater To Marine Saline Gradient | NQPALVAMKVGAVTPLAVVVTPLVWGKDYPLGAKR* |
Ga0151620_10049621 | 3300011268 | Freshwater | PTNQLALVAKKVGAVTPLAVIIRPLVWGKDYRLEAKR* |
Ga0151620_12361781 | 3300011268 | Freshwater | PTNQLALVAKKVGAVTPLAVIIRPLVWGKDYRLGAKR* |
Ga0157544_10206222 | 3300012713 | Freshwater | SYPTNQPALVAMKVGAVTPLAVVVTPLVWGKDYP* |
Ga0157597_11663471 | 3300012726 | Freshwater | QPALVAMKVGAVTPLAVVVTPLVWGQDYPLGAKRRN* |
Ga0164293_100562474 | 3300013004 | Freshwater | HPTNQLALVAMKVGAVTPLAVVVTPLVWAQGYPLGQKRGN* |
Ga0164293_100573691 | 3300013004 | Freshwater | PALVAMKVGAVTPLAVVVTPLVWGKDYPLGPKRRN* |
Ga0164293_107795113 | 3300013004 | Freshwater | SYPTNQPALVAMKVGAVTPLAVVVTPLVWGKDYPLGPKRRN* |
Ga0164292_100457496 | 3300013005 | Freshwater | KRKPQGQEKYFSYPTNQPALVAMKVGAVTPLAVVVTPLVWGKDYPLGPKRRN* |
Ga0187845_10682371 | 3300018815 | Freshwater | SHPTNQLALVAKKVGAVTPLAVIIRPLVWSKDYPLGAKR |
Ga0208233_100045411 | 3300020529 | Freshwater | PALVAMKVGAVTPLVVVVTPLVWGKDYPLGPKRRN |
Ga0207939_10005211 | 3300020536 | Freshwater | PTNQPALVAMKVGAVTPLAVVVTPLVWGKDYPLGPKRRN |
Ga0208722_10006691 | 3300020537 | Freshwater | SYPTNQPALVAMKVGAVTPLAVVVTPLVWGKDYPLGPKRRN |
Ga0208360_10011918 | 3300020551 | Freshwater | QRCKRKPQGQEKYISYPTNQFALVAKKVGAVTPLAVVVTPLVWGQDYPLGAKRRN |
Ga0208083_10512891 | 3300020559 | Freshwater | EKYFSYPTNQPALVAMKVGAVTPLAVVVTPLVWGQGYPLGRKR |
Ga0208229_10147854 | 3300020569 | Freshwater | GQEKYISYPTNQPALVAMKVGAVTPLAVVVTPLVWGKDYPLGPKRRN |
Ga0214163_10269724 | 3300021141 | Freshwater | QPALVAMKVGAVTPLAVVVTPLVWGKDYPLGPKRRN |
Ga0194045_11275032 | 3300021516 | Anoxic Zone Freshwater | SYPTNQLALVAMKVGAVTPLAVVVTPLVWVKITRIGVKR |
Ga0244777_104021681 | 3300024343 | Estuarine | CKRKPQGQEKYFSYPTNQPALVAMKVGAVTPLAVTVTPLVWGKDYPHRGKR |
Ga0244776_103260391 | 3300024348 | Estuarine | PTNQLALVAKKVGAVTPLAVIIRPLVWGKDYRLGAKR |
Ga0244776_104394022 | 3300024348 | Estuarine | FVNALVLQRCKRKPQGQEKYFSYPTNQPALVAIKVGAVTPLAVTVTPLV |
Ga0256302_11036871 | 3300024571 | Freshwater | TNQLALVAKKVGAVTPLAVIIRPLVWGKDYRLRAKR |
Ga0208376_10274221 | 3300025455 | Freshwater | CNSVCKRKPQGQENYFSYPTNQPALVAMKVGAVTPLAVVVTPLVWGKGYPLKGKR |
Ga0208546_11055991 | 3300025585 | Aqueous | TNQLALAAKKVGAVTPLAVIIRPLVWGKDYRLGAKR |
Ga0208147_10455543 | 3300025635 | Aqueous | QEKYFSYPTNQPALVAMKVGAVTPLAVVVTPLVWGKGYPLRGKR |
Ga0208916_100749684 | 3300025896 | Aqueous | QGQEKYISYPTNQPALVAMKVGAVTPLAVVVTPLVWGKDYPLGPKRRN |
Ga0208916_101386741 | 3300025896 | Aqueous | HPTNQLALVAKKVGAVTPLAVIIRPLVWGKDYRLGAKR |
Ga0208916_102911032 | 3300025896 | Aqueous | QGQEKYFSYPTNQLALVAMKVGAVTPLAVVVTPLVWSKGYP |
Ga0208443_100088212 | 3300027084 | Estuarine | NQLALVAKKVGAVTPLAVIIRPLVWGKDYPLGAKR |
Ga0208443_10817452 | 3300027084 | Estuarine | SHPTNQLALVAKKVGAVTPLAVIIRPLVWGKDYRLGAKR |
Ga0255071_10018551 | 3300027127 | Freshwater | SHPTNQPALVAKKVGAVTPLAVIIRPLVWGKDYRLGAKR |
Ga0255064_10505212 | 3300027138 | Freshwater | HPTNQPALVAKKVGAVTPLAVIIRPLVWGKDYRLGAKR |
Ga0255076_10341601 | 3300027141 | Freshwater | TNQLALVAKKVGAVTPLAVIIRPLVWGKDYRLGAKR |
Ga0208024_10337161 | 3300027222 | Estuarine | ISHPTNQLALVAKKVGAVTPLAVIIRPLVWGKDYPLGAKR |
Ga0208025_10161553 | 3300027225 | Estuarine | TNQLALVAKKVGAVTPLAVIIRPLVWGKDYPLGAKR |
Ga0208929_10053556 | 3300027227 | Estuarine | SHPTNQLALVAKKVGAVTPLAVIIRPLVRGKDYPLGAKR |
Ga0208558_10304722 | 3300027258 | Estuarine | TNQPALVAKKVGAVTPLAVIIRPLVWGKDYRLGAKR |
Ga0208923_10785172 | 3300027320 | Estuarine | SHPTNQLALVAKKVGAVTPLAVIIRPLVWGKDYPLGAKR |
Ga0255072_10020231 | 3300027508 | Freshwater | ISHPTNQPALVAKKVGAVTPLAVIIRPLVWGKDYRLGAKR |
Ga0255119_10534613 | 3300027596 | Freshwater | NQPALVAMKVGAVTPLAVVVTPLVWGKDYPLGPKRRN |
Ga0209442_13163521 | 3300027732 | Freshwater Lake | RCKRKPQGQEKYFSYPTNQLALVAMKVGAVTPLAVVVTPLVWGKGYP |
Ga0209246_102334842 | 3300027785 | Freshwater Lake | ISHPTNQLALVAKKVGAVTPLAVIIRPLVWGKDYRLGAKR |
Ga0209246_102521981 | 3300027785 | Freshwater Lake | RKPQGQEKYISYPTNQPALVAMKVGAVTPLAVVVTPLVWGQGYPLGRKR |
Ga0209229_100115631 | 3300027805 | Freshwater And Sediment | PALVAMKVGAVPPLAVVVTPLVWGKDYPLGPKRRN |
Ga0209229_100975951 | 3300027805 | Freshwater And Sediment | NQPALVAMKVGAVTPLAVVVTPLVWGKDYLLGPKRRN |
Ga0209229_102378383 | 3300027805 | Freshwater And Sediment | PQGQEKYFSYPTNQPALVAMKVGAVTPLAVVVTPLVWGQGYPLGRKR |
Ga0209550_100133771 | 3300027892 | Freshwater Lake | PTNQPALVAMKVGAVTPLAVVVTPLVWGKDYPYRG |
Ga0209550_103517023 | 3300027892 | Freshwater Lake | VLQRCKRKPQGQEKYFSYPTNQPAQVAMKVGAVTPLAVVVTPLVWGQDY |
Ga0209550_104342412 | 3300027892 | Freshwater Lake | PQGQEKYFSYPTNQLALVAMKVGAVTPLAVVVTPLVWSKGYP |
Ga0209284_105561282 | 3300027983 | Freshwater | PTNQLALVAMKVGAVTPLAVTITPLVWGKGYLFVVKR |
Ga0315907_107337593 | 3300031758 | Freshwater | KISHPTNQLALVAMKVGAVTPLAVVVTPLVWAQGYPLGQKRGN |
Ga0315899_114565263 | 3300031784 | Freshwater | QEKYFSYPTNQPALVAMKVGAVTPLAVVVTPLVWGQGYPLGRKR |
Ga0315908_100934614 | 3300031786 | Freshwater | EKYISYPTNQPALVAMKVGAVTPLAVVVTPLVWSKDYPLRPKR |
Ga0315908_104221531 | 3300031786 | Freshwater | QEKYISYPTNQPALVAMKVGAVTPLAVVVTPLVWGKDYPLRPKR |
Ga0315900_100343508 | 3300031787 | Freshwater | YISYPTNQPALVAMKVGAVTPLAVVVTPLVWGKDYPLRPKR |
Ga0315900_104297421 | 3300031787 | Freshwater | KYISYPTNQPALVAMKVGAVTPLAVVVTPLVWGKEYP |
Ga0315909_100298971 | 3300031857 | Freshwater | PQGQEKYISYPTNQPALVAMKVGAVTPLAVVVTPLVWGKDYPLRPKRRN |
Ga0315909_101332541 | 3300031857 | Freshwater | CKRKPQGQEKYISYPTNQPALVAMKVGAVTPLAVVVTPLVWGKEYP |
Ga0315909_102308631 | 3300031857 | Freshwater | YPTNQPALVAMKVGAVTPLAVVVTPLVWGKDYPLGPKRRN |
Ga0315904_105375193 | 3300031951 | Freshwater | PQGQEKYISYPTNQPALVAMKVGAVTPLAVVVTPLVWGKDYPLRPKR |
Ga0315901_100406907 | 3300031963 | Freshwater | YPTNQPALVAMKVGAVTPLAVVVTPLVWGKDYPLRPKR |
Ga0315906_106651843 | 3300032050 | Freshwater | CKRKPQGQEKYISYPTNQPALVAMKVGAVTPLAVVVTPLV |
Ga0315905_115612682 | 3300032092 | Freshwater | PQGQEKYISYPTNQPALVAMKVGAVTPLAVVVTPLVWGKDYPLGPKRRN |
Ga0315902_101308014 | 3300032093 | Freshwater | RKPQGQEKYISYPTNQPALVAMKVGAVTPLAVVITPLVWGKDYLLGPKRRN |
Ga0334992_0112349_1298_1441 | 3300033992 | Freshwater | PQGQEKYISYPTNQPALVAMKVGAVTPLAVVVTPLVWGQGYPLGRKR |
Ga0334994_0240363_1_147 | 3300033993 | Freshwater | KPQGQEKYISYPTNQPALVAMKVGAVTPLAVVVTPLVWGQDYPFGLKR |
Ga0335035_0287965_1_126 | 3300034105 | Freshwater | YFSYPTNQPALVAMKVGAVTPLAVVVTPLVWGQGYPLGRKR |
Ga0335017_0000247_27915_28058 | 3300034167 | Freshwater | GQEKYISYPTNQLALVAKKVGAVTPLAVVVTPLVWGQDYPLGAKRRN |
⦗Top⦘ |