NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F058271

Metagenome Family F058271

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F058271
Family Type Metagenome
Number of Sequences 135
Average Sequence Length 126 residues
Representative Sequence MVVRVLVRGTFASALAVLVVAAGLVLSVEPARAQNGFRVTYDVDRTRPDRARVTGRVVNERSEDVFEVNMTAEALDAKGKVLAKGIAYVDARIARGDGRPFSMSVPTVAGTSDFRVVVSSFRVGMATQGP
Number of Associated Samples 116
Number of Associated Scaffolds 135

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 21.48 %
% of genes near scaffold ends (potentially truncated) 40.00 %
% of genes from short scaffolds (< 2000 bps) 76.30 %
Associated GOLD sequencing projects 109
AlphaFold2 3D model prediction Yes
3D model pTM-score0.64

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.259 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil
(11.111 % of family members)
Environment Ontology (ENVO) Unclassified
(39.259 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(41.481 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 14.56%    β-sheet: 37.97%    Coil/Unstructured: 47.47%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.64
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 135 Family Scaffolds
PF08334T2SSG 19.26
PF00300His_Phos_1 11.11
PF07963N_methyl 9.63
PF00072Response_reg 8.15
PF13633Obsolete Pfam Family 7.41
PF05239PRC 5.93
PF13544Obsolete Pfam Family 5.93
PF13088BNR_2 0.74
PF08281Sigma70_r4_2 0.74
PF14417MEDS 0.74
PF09990DUF2231 0.74
PF00589Phage_integrase 0.74
PF13692Glyco_trans_1_4 0.74
PF13185GAF_2 0.74
PF02518HATPase_c 0.74
PF07244POTRA 0.74
PF01314AFOR_C 0.74
PF12867DinB_2 0.74
PF13419HAD_2 0.74

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 135 Family Scaffolds
COG2414Aldehyde:ferredoxin oxidoreductaseEnergy production and conversion [C] 0.74


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.26 %
UnclassifiedrootN/A0.74 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000550|F24TB_10811396All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1125Open in IMG/M
3300000550|F24TB_10841651All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium505Open in IMG/M
3300000559|F14TC_104239148All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium572Open in IMG/M
3300004114|Ga0062593_100023068All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3350Open in IMG/M
3300004157|Ga0062590_100090941All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1892Open in IMG/M
3300004157|Ga0062590_102502646All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium547Open in IMG/M
3300004643|Ga0062591_101599186All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium656Open in IMG/M
3300005093|Ga0062594_102214149All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium595Open in IMG/M
3300005543|Ga0070672_100014532All Organisms → cellular organisms → Bacteria → Proteobacteria5581Open in IMG/M
3300005546|Ga0070696_100061053All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium2637Open in IMG/M
3300005617|Ga0068859_100339999All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1595Open in IMG/M
3300005617|Ga0068859_101628235All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium713Open in IMG/M
3300005718|Ga0068866_10504502All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium801Open in IMG/M
3300005841|Ga0068863_100376974All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1385Open in IMG/M
3300005843|Ga0068860_100058019All Organisms → cellular organisms → Bacteria3679Open in IMG/M
3300005843|Ga0068860_101868959All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium622Open in IMG/M
3300005844|Ga0068862_100544426All Organisms → cellular organisms → Bacteria1108Open in IMG/M
3300006049|Ga0075417_10450795All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium642Open in IMG/M
3300006196|Ga0075422_10030049All Organisms → cellular organisms → Bacteria1887Open in IMG/M
3300006844|Ga0075428_100000576All Organisms → cellular organisms → Bacteria37515Open in IMG/M
3300006845|Ga0075421_100555876All Organisms → cellular organisms → Bacteria1355Open in IMG/M
3300006845|Ga0075421_101376490All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium778Open in IMG/M
3300006847|Ga0075431_101805195All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium568Open in IMG/M
3300006852|Ga0075433_10567935All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium997Open in IMG/M
3300006881|Ga0068865_102151358All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides fragilis508Open in IMG/M
3300009094|Ga0111539_10034920All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium6090Open in IMG/M
3300009098|Ga0105245_11867930All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium654Open in IMG/M
3300009100|Ga0075418_10007761All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium12061Open in IMG/M
3300009148|Ga0105243_10224736All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1661Open in IMG/M
3300009162|Ga0075423_10097853All Organisms → cellular organisms → Bacteria3068Open in IMG/M
3300009174|Ga0105241_11437389All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium661Open in IMG/M
3300009177|Ga0105248_11728059All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium709Open in IMG/M
3300009545|Ga0105237_12254020All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium554Open in IMG/M
3300009553|Ga0105249_10557086All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1197Open in IMG/M
3300010397|Ga0134124_10001135All Organisms → cellular organisms → Bacteria21336Open in IMG/M
3300010397|Ga0134124_12177746All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium594Open in IMG/M
3300010399|Ga0134127_11342383All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium785Open in IMG/M
3300010400|Ga0134122_10034413All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium3846Open in IMG/M
3300010400|Ga0134122_10621005All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1002Open in IMG/M
3300010403|Ga0134123_11915598All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium649Open in IMG/M
3300011419|Ga0137446_1148184All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium566Open in IMG/M
3300012355|Ga0137369_10122473All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium2101Open in IMG/M
3300012360|Ga0137375_10143085All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium2349Open in IMG/M
3300012922|Ga0137394_10052186All Organisms → cellular organisms → Bacteria → Proteobacteria3380Open in IMG/M
3300012922|Ga0137394_11014467All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium689Open in IMG/M
3300012923|Ga0137359_11033214All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium704Open in IMG/M
3300012929|Ga0137404_10014569All Organisms → cellular organisms → Bacteria5543Open in IMG/M
3300013100|Ga0157373_10600080All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium801Open in IMG/M
3300013100|Ga0157373_10894292All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium658Open in IMG/M
3300015371|Ga0132258_10755448All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium2450Open in IMG/M
3300015372|Ga0132256_101768248All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium727Open in IMG/M
3300015373|Ga0132257_102299303All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium699Open in IMG/M
3300017792|Ga0163161_10095744All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium2203Open in IMG/M
3300017997|Ga0184610_1040228All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1349Open in IMG/M
3300018028|Ga0184608_10009266All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium3314Open in IMG/M
3300018031|Ga0184634_10040746All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1884Open in IMG/M
3300018052|Ga0184638_1016949All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium2542Open in IMG/M
3300018053|Ga0184626_10126334All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1087Open in IMG/M
3300018054|Ga0184621_10084053All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1110Open in IMG/M
3300018056|Ga0184623_10026543All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium2595Open in IMG/M
3300018059|Ga0184615_10064454All Organisms → cellular organisms → Bacteria2046Open in IMG/M
3300018059|Ga0184615_10298634All Organisms → cellular organisms → Bacteria898Open in IMG/M
3300018063|Ga0184637_10096541All Organisms → cellular organisms → Bacteria1818Open in IMG/M
3300018075|Ga0184632_10005428All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium5324Open in IMG/M
3300018078|Ga0184612_10352160All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium747Open in IMG/M
3300018082|Ga0184639_10232936All Organisms → cellular organisms → Bacteria975Open in IMG/M
3300018422|Ga0190265_10405907All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1462Open in IMG/M
3300020004|Ga0193755_1067552All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1157Open in IMG/M
3300021073|Ga0210378_10205970All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium750Open in IMG/M
3300021080|Ga0210382_10311506All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium693Open in IMG/M
3300021081|Ga0210379_10170994All Organisms → cellular organisms → Bacteria930Open in IMG/M
3300021090|Ga0210377_10187792All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1324Open in IMG/M
3300021344|Ga0193719_10311794All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium659Open in IMG/M
3300022534|Ga0224452_1108389All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium851Open in IMG/M
3300025318|Ga0209519_10685636All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium554Open in IMG/M
3300025324|Ga0209640_10621435All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium869Open in IMG/M
3300025899|Ga0207642_10690331All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium642Open in IMG/M
3300025911|Ga0207654_10148040All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1504Open in IMG/M
3300025912|Ga0207707_10162556All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1952Open in IMG/M
3300025930|Ga0207701_10627222All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium914Open in IMG/M
3300025930|Ga0207701_11470821All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium553Open in IMG/M
3300025933|Ga0207706_10110769All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria2415Open in IMG/M
3300025936|Ga0207670_10473176All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1013Open in IMG/M
3300025937|Ga0207669_11682973All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium542Open in IMG/M
3300025938|Ga0207704_11748645All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium535Open in IMG/M
3300026089|Ga0207648_10148867All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium2065Open in IMG/M
3300026118|Ga0207675_100064796All Organisms → cellular organisms → Bacteria3416Open in IMG/M
3300027873|Ga0209814_10064773All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1532Open in IMG/M
3300027880|Ga0209481_10021238All Organisms → cellular organisms → Bacteria2876Open in IMG/M
3300027907|Ga0207428_10028298All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium4657Open in IMG/M
3300028380|Ga0268265_10388435All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1286Open in IMG/M
3300028380|Ga0268265_10470917All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1178Open in IMG/M
3300028381|Ga0268264_10121825All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium2299Open in IMG/M
3300028587|Ga0247828_10037770All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium2021Open in IMG/M
3300028807|Ga0307305_10344804All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium676Open in IMG/M
3300028814|Ga0307302_10062079All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1749Open in IMG/M
3300028878|Ga0307278_10036704All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium2233Open in IMG/M
3300028878|Ga0307278_10319712All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium685Open in IMG/M
3300030606|Ga0299906_10946795All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium632Open in IMG/M
3300030620|Ga0302046_10002213All Organisms → cellular organisms → Bacteria18171Open in IMG/M
3300031184|Ga0307499_10022419All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1370Open in IMG/M
3300031199|Ga0307495_10213540All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium537Open in IMG/M
3300031226|Ga0307497_10212767All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium844Open in IMG/M
3300031538|Ga0310888_10475243All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium744Open in IMG/M
3300031538|Ga0310888_10490647All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium733Open in IMG/M
3300031548|Ga0307408_100268165All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1416Open in IMG/M
3300031562|Ga0310886_10721180All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium622Open in IMG/M
3300031720|Ga0307469_10303396All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1317Open in IMG/M
3300031740|Ga0307468_100132189All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1562Open in IMG/M
3300031740|Ga0307468_100203591All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1342Open in IMG/M
3300031740|Ga0307468_100805645All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium802Open in IMG/M
3300031847|Ga0310907_10135934All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1111Open in IMG/M
3300031858|Ga0310892_10493979All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium814Open in IMG/M
3300031892|Ga0310893_10235056All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium753Open in IMG/M
3300031908|Ga0310900_11913401All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium506Open in IMG/M
3300031913|Ga0310891_10395139All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium503Open in IMG/M
3300031944|Ga0310884_10364636All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium822Open in IMG/M
3300032005|Ga0307411_10876052All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium796Open in IMG/M
3300032012|Ga0310902_10036353All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium2311Open in IMG/M
3300032013|Ga0310906_10102567All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1572Open in IMG/M
3300032174|Ga0307470_11669522All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium535Open in IMG/M
3300032179|Ga0310889_10410759All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium673Open in IMG/M
3300032180|Ga0307471_100768451All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1130Open in IMG/M
3300032180|Ga0307471_101036863All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium987Open in IMG/M
3300032205|Ga0307472_100609821All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium965Open in IMG/M
3300032211|Ga0310896_10136312All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1146Open in IMG/M
3300032211|Ga0310896_10816265All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium535Open in IMG/M
3300032782|Ga0335082_10583129All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium980Open in IMG/M
3300032828|Ga0335080_11611192All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium639Open in IMG/M
3300033004|Ga0335084_10871640All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium912Open in IMG/M
3300033004|Ga0335084_11994969All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium565Open in IMG/M
3300033158|Ga0335077_10453651All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1366Open in IMG/M
3300033407|Ga0214472_10564379Not Available1049Open in IMG/M
3300033417|Ga0214471_10100742All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium2376Open in IMG/M
3300034819|Ga0373958_0028649All Organisms → cellular organisms → Bacteria1079Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil11.11%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment9.63%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere9.63%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil8.89%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere7.41%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil5.93%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.44%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil4.44%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil3.70%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.70%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere3.70%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil2.22%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.22%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment2.96%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere1.48%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil1.48%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.48%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.48%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.48%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.48%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.48%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.48%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.74%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.74%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.74%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.74%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.74%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.74%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil0.74%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.74%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil0.74%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.74%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.74%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000550Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemlyEnvironmentalOpen in IMG/M
3300000559Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemlyEnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006196Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1Host-AssociatedOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011419Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT357_2EnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300017997Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coexEnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018031Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1EnvironmentalOpen in IMG/M
3300018052Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2EnvironmentalOpen in IMG/M
3300018053Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1EnvironmentalOpen in IMG/M
3300018054Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1EnvironmentalOpen in IMG/M
3300018056Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1EnvironmentalOpen in IMG/M
3300018059Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coexEnvironmentalOpen in IMG/M
3300018063Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2EnvironmentalOpen in IMG/M
3300018075Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1EnvironmentalOpen in IMG/M
3300018078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coexEnvironmentalOpen in IMG/M
3300018082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300020004Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2EnvironmentalOpen in IMG/M
3300021073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redoEnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300021081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redoEnvironmentalOpen in IMG/M
3300021090Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redoEnvironmentalOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300022534Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1EnvironmentalOpen in IMG/M
3300025318Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 1EnvironmentalOpen in IMG/M
3300025324Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027880Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)Host-AssociatedOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028587Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300030606Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125EnvironmentalOpen in IMG/M
3300030620Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111EnvironmentalOpen in IMG/M
3300031184Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_SEnvironmentalOpen in IMG/M
3300031199Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_SEnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031538Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1EnvironmentalOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031562Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031847Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4EnvironmentalOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300031892Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031913Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4EnvironmentalOpen in IMG/M
3300031944Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1EnvironmentalOpen in IMG/M
3300032005Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1Host-AssociatedOpen in IMG/M
3300032012Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3EnvironmentalOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032179Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032211Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033407Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175EnvironmentalOpen in IMG/M
3300033417Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155EnvironmentalOpen in IMG/M
3300034819Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
F24TB_1081139623300000550SoilLCYLPNMLVRVLVRGMFAFVLAAVLFLAGLSLSADPALAQNGFRVTYDVDRTRPDRARVTGRVVNERAEDVFEVNMTAEALDAKGKVLARGIAYVDSRIARGDGRSFSMSVPTVAGTSDFRVVVSGFKLSAGPGPQGP*
F24TB_1084165113300000550SoilMRARPVFVFTLVAVLAVLVVSVAAQEGFKITYDVDRSRPERARLSGRVVNERPEDVFEVSLTAEALDSRGKVLARGITYIDSRIARGDGRPFSMSVPTVAGTTNFR
F14TC_10423914813300000559SoilMLVRVLARGTFAFVLAAALLVAGVFLSVGPALAQNGFRVTFDVDRTRPDRARVTGRVVNERAEDVFEVNMTAEALDAKGKVLARGIAYVDSRIARGDGRSFSMSVPTVAGTSDFRVVVSGFKLSAGP
Ga0062593_10002306833300004114SoilMLAAGLVIVSADATRAQDGFRITYEVDRTRPDRARLTGKVVNERSDDVFEVNITAEALDAKGKVLARGISYVDSRIARGDGRPFSMSVPTVAGTTGFRVIVSSYRAGFSTQGP*
Ga0062590_10009094113300004157SoilMGLDGLLELPARPRRLRGRRRPLCYLRSMVVRVLARGTSVIALALLVLTAGLGLSVEPARAQNGFRVTYDVDRTRPDRARVTGRVVNERSEDVFEVNMTAEALDAKGKVLSKGIAYVDSKISRGDGRAFSMSVPTLAGTTDFRVVVSSFRVGMAPQGP*
Ga0062590_10250264613300004157SoilRRAMRAHSALRQFLLVLATGLVIAHADVARAQDGFRITYEVDRSRPDRARLTGKVVNERSDDVFEVHITAEALDSKGKVLARGISYVDSRITRGDGRPFSMSVPTVAGTTNFRVVVSSYRAGFSNQGP*
Ga0062591_10159918623300004643SoilMGLDGLLELPARPRRLRGRRRPLCYLRSMVVRVLARGTSVIALALLVLTAGLGLSVEPARAQNGFRVTYDVDRTRPDRARVTGRVVNERSEDVFEVNMTAEALDAKGKVLSKGIAYVDSKISRGDGRAFSMSVPTLAGTTDFRV
Ga0062594_10221414913300005093SoilMRAHSALRQFLLVLATGLVIAHADVARAQDGFRITYEVDRSRPDRARLTGKVVNERSDDVFEVHITAEALDSKGKVLARGISYVDSRITRGDGRSFSMSVPTVAGTTNFRVVVSSYRAGLSNQGP*
Ga0070672_10001453243300005543Miscanthus RhizosphereMVVRVLVRGTFASALALVIVAAGLVLSVEPARAQNGFRVTYDVDRTRPDRARVTGRVVNERSEDVFEVNMTAEALDAKGKVLAKGIAYVDARIARGDSRTFSMSVPTVAGTSDFRVVVSSFRVGMAPQGP*
Ga0070696_10006105353300005546Corn, Switchgrass And Miscanthus RhizosphereMGLDGLLELPARPRRLRGRRRPLCYLRSMVVRVLARGTSVIALALLVLTAGLGLSVEPARAQNGFRVTYDVDRTRPDRARVTGRVVNERSEDVFEVNMTAEALDAKGKVLSKGIAYVDSKIGRGDGRSFSMSVPTLAGTTDFRVVVSSFRVGMAPQGP*
Ga0068859_10033999923300005617Switchgrass RhizosphereMRSRSAIRRFVFILAAGLVIVSADATRAQDGFRITYEVDRTRPDRARLTGKVVNERSDDVFEVNITAEALDAKGKVLARGISYVDSRIARGDGRPFSMSVPTVAGTTGFRVIVSSYRAGFSTQGP*
Ga0068859_10162823513300005617Switchgrass RhizosphereMVVRVLARGTFASALAVLIVVAGLALSVEPARAQNGFRVTYDVDRTRPDRARVTGRVVNERNEDVFEVNMTAEALDAKGKVLAKGIAYVDARIARGDSRTFSMSVPTVAGTS
Ga0068866_1050450213300005718Miscanthus RhizosphereDGLLELPARPRRLRGWRRPLCYLRSMFVRVLARGTFVVALALLVLTAGLGLSVEPARAQNGFRVTYDVDRTRPDRARVTGRVVNERSEDVFEVNMTAEALDAKGKVLAKGIAYVDARIARGDGRTFSMSVPTVAGTSDFRVVVSSFRVGMAPQGP*
Ga0068863_10037697413300005841Switchgrass RhizosphereRVLVRGTFASALALVIVAAGLVLSVEPARAQNGFRVTYDVDRTRPDRARVTGRVVNERSEDVFEVNMTAEALDAKGKVLAKGIAYVDARIARGDSRTFSMSVPTVAGTSDFRVVVSSFRVGMAPQGP*
Ga0068860_10005801973300005843Switchgrass RhizosphereMVVRVLARGTFASALAVLIVVAGLALSVEPARAQNGFRVTYDVDRTRPDRARVTGRVVNERNEDVFEVNMTAEALDAKGKVLAKGIAYVDARIARGDSRTFSMSVPTVAGTSDFRVVVSSFRVGMAPQGP*
Ga0068860_10186895913300005843Switchgrass RhizosphereQGECRRGARAAVRSRGIGVIPSKTMRSRSAIRRFVFMLAAGLVIVSADATRAQDGFRITYEVDRTRPDRARLTGKVVNERSDDVFEVNITAEALDAKGKVLARGISYVDSRIARGDGRPFSMSVPTVAGTTGFRVIVSSYRAGFSTQGP*
Ga0068862_10054442633300005844Switchgrass RhizosphereVRVLARGTFASALAVLIVVAGLALSVEPARAQNGFRVTYDVDRTRPDRARVTGRVVNERNEDVFEVNMTAEALDAKGKVLAKGIAYVDARIARGDSRTFSMSVPTVAGTSDFRVVVSSFRVGMAPQGP*
Ga0075417_1045079523300006049Populus RhizosphereMQARPVFVFTPVAVLAVLVVSVEAQEGFKITYDVDRSRPERARLTGRVVNERPEDVFEVSLTAEALDSRGKVLARGITYIDSRIARGDGRPFSMSVPTVAGTTNFRVVVSSFRAGFANQGP*
Ga0075422_1003004923300006196Populus RhizosphereLCYLSYMLVRVLARGTSAFLLAAVLLVAGVFLSVGPALAQNGFRVTYDVDRTRPDRARVTGRVVNERAEDVFEVNMTAEALDAKGKVLARGIAYVDARIARGDSRSFSVSVPTVAGTSDFRVVVSSFKLSVGPGPQGP*
Ga0075428_10000057633300006844Populus RhizosphereMRARLALALLCFLGILLAVSAAPAQDGFKITYDVDRSRPERARLTGRVVNERAEDVFEVSLTAEALDARGKVLARGITYVDSRITRGDGRPFAMSVPTVAGTASFRVVVSSFRAGVANQGP*
Ga0075421_10055587623300006845Populus RhizosphereMRARLALALLCFLGILLAVSTAPAQDGFKITYDVDRSRPERARLTGRVVNERAEDVFEVSLTAEALDARGKVLARGITYVDSRITRGDGRPFAMSVPTVAGTASFRVVVSSFRAGVANQGP*
Ga0075421_10137649033300006845Populus RhizosphereAQEGFKITYDVDRSRPERARLTGRVVNERPEDVFEVSLTAEALDSRGKVLARGITYIDSRIARGDGRPFSMSVPTVAGTTNFRVVVSSFRAGFANQGP*
Ga0075431_10180519513300006847Populus RhizosphereMRARPVFVFTLVAVLAVLVVSVEAQEGFKITYDVDRSRPERARLTGRVVNERPEDVFEVSLTAEALDSRGKVLARGITYIDSRIARGDGRPFSMSVPTVAGTTNFRVVVSSFRAGFANQGP*
Ga0075433_1056793523300006852Populus RhizosphereMRARPVFVFTLVAVLAVLVVSVAAQEGFKITYDVDRSRPERARLTGRVVNERPEDVFEVSLTAEALDSRGKVLARGITYIDSRIARGDGRPFSMSVPTVAGTTNFRVVVSSFRAGFANQGP*
Ga0068865_10215135813300006881Miscanthus RhizosphereVCYLRYMVVRVLVRGTFASALALVIVAAGLVLSVEPARAQNGFRVTYDVDRTRPDRARVTGRVVNERSEDVFEVNMTAEALDAKGKVLAKGIAYVDARIARGDSRTFSMSVPTVAGTSDFRVVVSSFRVGMAPQGP*
Ga0111539_1003492043300009094Populus RhizosphereMLVRVLARGTSAFLLAAVLLVAGVFLSVGPALAQNGFRVTYDVDRTRPDRARVTGRVVNERAEDVFEVNMTAEALDAKGKVLARGIAYVDARIARGDSRSFSVSVPTVAGTSDFRVVVSGFKLSVGPGPQGP*
Ga0105245_1186793023300009098Miscanthus RhizosphereMVVRVLVRGTFASALALVIVAAGLVLSVEPARAQNGFRVTYDVDRTRPDRARVTGRVVNERSEDVFEVNMTAEALDAKGKVLAKGIAYVDARIARGDSRTFSMSVPTVAGTSDF
Ga0075418_1000776153300009100Populus RhizosphereMLVRVLARGTSAFLLAAVLLVAGVFLSVGPALAQNGFRVTYDVDRTRPDRARVTGRVVNERAEDVFEVNMTAEALDAKGKVLARGIAYVDARIARGDSRSFSVSVPTVAGTSDFRVVVSSFKLSVGPGPQGP*
Ga0105243_1022473643300009148Miscanthus RhizosphereYMVVRVLVRGTFASALALVIVAAGLVLSVEPARAQNGFRVTYDVDRTRPDRARVTGRVVNERSEDVFEVNMTAEALDAKGKVLAKGIAYVDARIARGDSRTFSMSVPTVAGTSDFRVVVSSFRVGMAPQGP*
Ga0075423_1009785353300009162Populus RhizosphereMRACPVFVFTLVAVLAVLVVSVAAQEGFKITYDVDRSRPERARLTGRVVNERPEDVFEVSLTAEALDSRGKVLARGITYIDSRIARGDGRPFSMSVPTVAGTTNFRVVVSSFRAGFANQGP*
Ga0105241_1143738923300009174Corn RhizosphereMVVRVLARGTSVIALALLVLTAGLGLSVEPARAQNGFRVTYDVDRTRPDRARVTGRVVNERSEDVFEVNMTAEALDAKGKVLSKGIAYVDSKISRGDGRAFSMSVPTLAGTTDFRVVVSSFRVGMAPQGP*
Ga0105248_1172805913300009177Switchgrass RhizospherePARAQNGFRVTYDVDRTRPDRARVTGRVVNERNEDVFEVNMTAEALDAKGKVLAKGIAYVDARIARGDSRTFSMSVPTVAGTSDFRVVVSSFRVGMAPQGP*
Ga0105237_1225402013300009545Corn RhizosphereIVSADATRAQDGFRITYEVDRTRPDRARLTGKVVNERSDDVFEVNITAEALDAKGKVLARGISYVDSRIARGDGRPFSMSVPTVAGTTGFRVIVSSYRAGFSTQGP*
Ga0105249_1055708613300009553Switchgrass RhizosphereLAAGLVIVSADATRAQDGFRITYEVDRTRPDRARLTGKVVNERSDDVFEVNITAEALDAKGKVLARGISYVDSRIARGDGRPFSMSVPTVAGTTGFRVIVSSYRAGFSTQGP*
Ga0134124_10001135163300010397Terrestrial SoilMRSRSAIRRFVFMLAAGLVIVSADATRAQDGFRITYEVDRTRPDRARLTGKVVNERSDDVFEVNITAEALDAKGKVLARGISYVDSRIARGDGRPFSMSVPTVAGTTGFRVIVSSYRAGFSTQGP*
Ga0134124_1217774623300010397Terrestrial SoilMRAHSALRQFLLVLATGLVIAHADVASAQDGFRITYEVDRSRPDRARLTGKVVNERSDDVFEVHITAEALDSKGKVLARGISYVDSRITRGDGRPFSMSVPTVAGTTNFRVVVSSYRAGFSNQGP*
Ga0134127_1134238323300010399Terrestrial SoilVRVLARGTSVVALALLVLTAGLGLSVEPARAQNGFRVTYDVDRTRPDRARVTGRVVNERSEDVFEVNMTAEALDAKGKVLSKGIAYVDSKIGRGDGRSFSMSVPTLAGTTDFRVVVSSFRVGMAPQGP*
Ga0134122_1003441393300010400Terrestrial SoilMVVRVLARGTSVIALALLVLTAGLGLSVEPARAQNGFRVTYDVDRTRPDRARVTGRVVNERSEDVFEVNMTAEALDAKGKVLSKGIAYVDSKISRGDGRAFSMSVPTLAGTTDFRVVVSSFRAGMAPQGP*
Ga0134122_1062100533300010400Terrestrial SoilARAQNGFRVTYDVDRTRPDRARVTGRVVNERSEDVFEVNMTAEALDAKGKVLAKGIAYVDARIARGDGRTFSMSVPTVAGTSDFRVVVSSFRVGMAPQGP*
Ga0134123_1191559823300010403Terrestrial SoilMRAHSALRQFLLVLAAGLVIAHADVARAQDGFRITYEVDRSRPDRARLTGKVVNERSDDVFEVHITAEALDSKGKVLARGISYVDSRITRGDGRPFSMSVPTVAGTANFRVIVSSVRAGFSNQGP*
Ga0137446_114818413300011419SoilCDTFKNMPALAIARPLGIVLAVLLVLAAEARGQDGFRITYEVDRTRAERARLTGRIVNERSEDVFEVSVTGEALDAKGKVLARGIAYVDSKIARGDGRPFSMSVPTVAGTTNYRVVVSSFRAGFATQGP*
Ga0137369_1012247343300012355Vadose Zone SoilVPLNLPALWLRSFDLPHQCDTFKNMLSVRRLLIMLAVLLLLIAAEARAQDGFRITFEVDRTRAERARLTGRIVNERPEDVFEVSVTGEALDAKGKVLARGIAYVDSKIGRGDGRPFSMSVPTVSGTANYRVVVSSFRAGFATQGP*
Ga0137375_1014308533300012360Vadose Zone SoilVPLNLPALWLRSFDLPHQCDTFKNMLSVRRLLIMLAVLLLLIAAEARAQDGFRITFEVDRTRAERARLTGRIVNERPEDVFEVSVTGEALDAKGKVLARGIAYVDSKIGRGDGRPFSMSVPTVAGTANYRVVVSSFRAGFATQGP*
Ga0137394_1005218643300012922Vadose Zone SoilMVVRVLVRGTFASALAVLVVAAGLVLSVEPARAQNGFRVTYDVDRTRPDRARVTGRVVNERSEDVFEVNMTAEALDAKGKVLAKGIAYVDARIARGDGRTFSMSVPTVAGTSDFRVVVSSFRLGMAPQGP*
Ga0137394_1101446713300012922Vadose Zone SoilMLVVVIVRRLVLVLAVLLLLTPEVRGQDGFRITYEVDRTRAERARLTGRIVNERTEDVFEVSVTGEALDAKGKVLARGIAYVDSKIGRGDGRSFSMSVPTVTGTANYRVVVSSFRSGPGTQGP
Ga0137359_1103321423300012923Vadose Zone SoilAEVRAQDGFRIAYDVDRSRPDRARLTGRVINDRPEDVYEVSLTAEALDARGKVLARGIAYVDSKIGRGDSRPFSMSVPTVAGVANFRVVVSSYRAGFGNQGQGP*
Ga0137404_1001456993300012929Vadose Zone SoilMLARTVLRRCVLPFTIILVLAAEVRAQDGFRIAYDVDRSRPDRARLTGRVINDRPEDVYEVSLTAEALDARGKVLARGIAYIDSKIGRGDGRPFSMSVPTVAGVANFRVVVSSYRAGFGNQGQGP*
Ga0157373_1060008013300013100Corn RhizosphereMVVRVLVRGTFASALALVIVAAGLVLSVEPARAQNGFRVTYDVDRTRPDRARVTGRVVNERSEDVFEVNMTAEALDAKGKVLAKGIAYVAARIARGDSRTLSMSVPTVAGTSDFRVVVSSFRVGMAPQGP*
Ga0157373_1089429213300013100Corn RhizosphereGLGLAALVLTAGLGLSVEPARAQNGFRVTYDVDRTRPDRARVTGRVVNERSEDVFEVNMTAEALDAKGKVLSKGIAYVDSKISRGDGRAFSMSVPTLAGTTDFRVVVSSFRVGMAPQGP*
Ga0132258_1075544833300015371Arabidopsis RhizosphereMLVRVLARGTSAFLLAAVLLVAGVFLSVGPALAQNGFRVTYDVDRTRPDRARVTGRVVNERAEDVFEVNMTAEALDAKGKVLARGIAYVDARIARGDSRPFSVSVPTVAGTSDFRVVVSGFKLSVGPGPQGP*
Ga0132256_10176824823300015372Arabidopsis RhizosphereMVVRVLVRGTFASALALVIVAAGLVLSVEPARAQNGFRVTYDVDRTRPDRARVTGRVVNERSEDVFEVNMTAEALDAKGKVLAKGIAYVDARIARGDSRTFSMSVPTVAGT
Ga0132257_10229930323300015373Arabidopsis RhizosphereMLVRVLAQGTSAFLLAAVLLVAGVFLSVGPALAQNGFRVTYDVDRTRPDRARVTGRVVNERAEDVFEVNMTAEALDAKGKVLARGIAYVDARIARGDSRSFSVSVPTVAGTSDFRVVVSGFKLSVGPGPQGP*
Ga0163161_1009574443300017792Switchgrass RhizosphereMVVRVLVRGTFASALAVLVVAAGLVLSVEPARAQNGFRVTYDVDRTRPDRARVTGRVVNERSEDVFEVNMTAEALDAKGKVLAKGIAYVDARIARGDGRTFSMSVPTVAGTSDFRVVVSSFRVGMAPQGP
Ga0184610_104022833300017997Groundwater SedimentMAFAIVRPFVIVLAVLLLLTAEARGQDGFRITYEVDRTRAERARLTGRIVNERSEDVFEVSVTGEALDAKGKVLARGIAYVDSKIARGDGRPFSMSVPTVAGTANYRVVVSSFRAGLGSQAPGSQGP
Ga0184608_1000926673300018028Groundwater SedimentMAFAIVRPFVIVLAVLLLLTAEAPAQDGFRITYEVDRTRAERARLTGRIVNERPEDVFEVSVTGEALDAKGKVLARGIAYVDSKIGRGDGRPFSMSVPTVAGTANYRVVVSSFRAGIGSQAPSNQGP
Ga0184634_1004074633300018031Groundwater SedimentMLALAIVRRLVIVLAVLLLITVEASGQDGFRITYEVDRTRAERARLTGRIVNERAEDVFEVSVTGEALDARGKVLARGIAYVDSKIGRGDGRPFSLSVPTVAGTANYRVVVSSFRAGFSSQAPGNQGP
Ga0184638_101694963300018052Groundwater SedimentMAFAIVRPFVIVLAVLLLLTAEARGQDGFRITYEVDRTRAERARLTGRIVNERPEDVFEVSVTGEALDATGKVLARGIAYVDSKIARGDGRPFSMSVPTVAGTANYRVVVSSFRAGLGSHTPSNQGP
Ga0184626_1012633423300018053Groundwater SedimentMAFAIVCRLVIVLAVLLLLTAEAPAQDGFRITYEVDRTRAERARLTGRIVNERSEDVFEVSVTGEALDAKGKVLARGIAYVDSKIARGDGRPFSMSVPTVAGTANYRVVVSSFRAGLGSQAPRDQGP
Ga0184621_1008405323300018054Groundwater SedimentMTFAIVRPFVIVLAVLLLLTAEAPAQDGFRITYEIDRTRAERARLTGRIVNERPEDVFEVSVTGEALDAKGKVLARGIAYVDSKIARGDGRPFSMSVPTVAGTANYRVVVSSFRAGIGSQAPSNQGP
Ga0184623_1002654313300018056Groundwater SedimentGQDGFRITYEVDRTRAERARLTGRIVNERSEDVFEVSVTGEALDAKGKVLARGIAYVDSKIARGDGRPFSMSVPTVAGTANYRVVVSSFRAGLGSQAPGSQGP
Ga0184615_1006445423300018059Groundwater SedimentMPALAIVRPLVIVLAVLLLLAAEARGQDGFRITYEVDRTRAERARLTGRIVNERSEDVFEVSVTGEALDAKGKVLARGIAYVDSKIGRGDGRPFSLSVPTVAGTTNYRVVVSSFRAGFATQGP
Ga0184615_1029863423300018059Groundwater SedimentMLALAIARPLGIVLAVLLVLAAEARGQNGFRITYEVDRTRAERARLTGRIVNERAEDVFEVSVTGEALDAKGKVLARGIAYVDSKIGRGDGRAFSLSVPTVAGTESYRVVVSSFRAGFATQGP
Ga0184637_1009654123300018063Groundwater SedimentMLAFAIVRQLVIVLAVVLLLTAEARGQDGFRITYEVDRTRAERARLTGRIVNERPEDVFEVSVTGEALDAKGKVLARGIAYVDSKIARGDGRPFSMSVPTVAGTANYRVVVSSFRAGLGSQAPGSQGP
Ga0184632_1000542893300018075Groundwater SedimentMAFAIVRPFVIVLAVLLLLTAEAPAQDGFRITYEIDRTRAERARLTGRIVNERPEDVFEVSVTGEALDAKGKVLARGIAYVDSKIARGDGRPFSMSVPTVAGTANYRVVVSSFRAGLGSQ
Ga0184612_1035216013300018078Groundwater SedimentMAFAIVCRLVIVLAVLLLLTAEAPAQDGFRITYEVDRTRAERARLTGRIVNERSEDVFEVSVTGEALDAKGKVVARGIAYVDSKIARGDGRPFSMSVPTVAGTANYRVVVSSFRAGLGSQAPRDQGP
Ga0184639_1023293623300018082Groundwater SedimentMAFAIVRRLVIVLAVLLLITVEASGQDGFRITYEVDRTRAERARLTGRIVNERSEDVFEVSVTGEALDARGKVLARGIAYVDSKIARGDGRPFSMSVPTVAGTANYRVVVSSFRAGFGSQAPGSQGP
Ga0190265_1040590733300018422SoilVLVAALVILGPDETRAQDGFRITYEVDRSRPERARLTGRVVNERSDDVFEVSITAEAVDARGKVLARGISYVDSRIGRGDARPFSMSVPTVAGTANFRVVVSSYRAGLSSQGP
Ga0193755_106755223300020004SoilMLARTVLRRCVLPFAIILVLAAEVRAQDGFRIAYDVDRSRPDRARLTGRVINDRPEDVYEVSLTAEALDARGKVLARGIAYVDSKIGRGDGRPFSMSVPTVAGVANFRVVVSSYRAGFGNQGQGP
Ga0210378_1020597013300021073Groundwater SedimentAPDGCRPSGAPHRCDTFKNMAFAIVRPFVIVLAVLLLLTAEARGQDGFRITYEVDRTRAERARLTGRIVNERAEDVFEVSVTGEALDAKGKVLARGIAYVDSKIARGDGRPFSMSVPTVAGTANYRVVVSSFRAGLGSQAPRDQGP
Ga0210382_1031150613300021080Groundwater SedimentVRPFVIVLAVLLLLTAEAPAQDGFRITYEIDRTRAERARLTGRIVNERPEDVFEVSVTGEALDAKGKVLARGIAYVDSKIGRGDGRPFSMSVPTVAGTANYRVVVSSFRAGFSTQAPGTQGP
Ga0210379_1017099423300021081Groundwater SedimentMLAFAIVRRLVIGLAVLLLLTAEARGQDGFRITYEVDRTRAERARLTGRIVNERPEDVFEVSVTGEALDAKGKVVARGIAYVDSKIARGDGRPFSMSVPTVAGTANYRVVVSSFRAGLGSQAPSNQGP
Ga0210377_1018779243300021090Groundwater SedimentMLALAIARPLGIVLAVLLVLAAEARGQDGFRITYEVDRTRAERARLTGRIVNERSEDVFEVSVTGEALDAKGKVLARGIAYVDSKIGRGDGRPFSLSVPTVAGTTNYRVVVSSFRAGFATQGP
Ga0193719_1031179413300021344SoilMLARTVLRRCVLPFAIILLLAAEVRAQDGFRIAYDVDRSRPDRARLTGRVINDRPEDVYEVSLTAEALDARGKVLARGIAYIDSKIGRGDGRPFSMSVPTVAGVANFRVVVSSYRAGFGNQGQGP
Ga0224452_110838923300022534Groundwater SedimentMAFAIVRPFVIVLAVLLLLTAEAPAQDGFRITYEIDRTRAERARLTGRIVNERPEDVFEVSVTGEALDAKGKVLARGIAYVDSKIARGDGRPFSMSVPTVAGTANYRVVVSSFRAGIGSQAPSNQGP
Ga0209519_1068563613300025318SoilMPASFPRIVALVLVAALGSLISGEACAQDGFRISYEVDRSRVDRARLTGRVVNERAEDVFEVSITAEALDARGKVLARGITYVDSRIARTDARPFSMSVPTVPGVAGFRVAVSSYRLGVSSQGP
Ga0209640_1062143523300025324SoilVLAGFPRIVALVLVAALGPLISGEARAQDGFRISYEVDRSRVDRARLTGRVVNERAEDVFEVSITAEALDARGKVLARGITYVDARIGRGDGRPFSMSVPTVAGTTNFRVAVSSYRAGFSSQGP
Ga0207642_1069033113300025899Miscanthus RhizosphereDGLLELPARPRRLRGWRRPLCYLRSMFVRVLARGTFVVALALLVLTAGLGLSVEPARAQNGFRVTYDVDRTRPDRARVTGRVVNERSEDVFEVNMTAEALDAKGKVLAKGIAYVDARIARGDGRTFSMSVPTVAGTSDFRVVVSSFRVGMAPQGP
Ga0207654_1014804023300025911Corn RhizosphereMVVRVLVRGTFASALALVIVAAGLVLSVEPARAQNGFRVTYDVDRTRPDRARVTGRVVNERSEDVFEVNMTAEALDAKGKVLAKGIAYVDARIARGDSRTFSMSVPTVAGTSDFRVVVSSFRVGMAPQGP
Ga0207707_1016255633300025912Corn RhizosphereMLAAGLVIVSADATRAQDGFRITYEVDRTRPDRARLTGKVVNERSDDVFEVNITAEALDAKGKVLARGISYVDSRIARGDGRPFSMSVPTVAGTTGFRVIVSSYRAGFSTQGP
Ga0207701_1062722223300025930Corn, Switchgrass And Miscanthus RhizosphereLVIVSADATRAQDGFRITYEVDRTRPDRARLTGKVVNERSDDVFEVNITAEALDAKGKVLARGISYVDSRIARGDGRPFSMSVPTVAGTTGFRVIVSSYRAGFSTQGP
Ga0207701_1147082123300025930Corn, Switchgrass And Miscanthus RhizosphereMVVRVLVRGTFASALALVIVAAGLVLSVEPARAQNGFRVTYDVDRTRPDRARVTGRVVNERSEDVFEVNMTAEALDAQGKVLAKGIAYVDARIARGDGRAFSMSVPT
Ga0207706_1011076923300025933Corn RhizosphereMVVRVLVRGTFASALAVLVVAAGLVLSVEPARAQNGFRVTYDVDRTRPDRARVTGRVVNERSEDVFEVNMTAEALDAKGKVLAKGIAYVDARIARGDSRTFSMSVPTVAGTSDFRVVVSSFRVGMAPQGP
Ga0207670_1047317623300025936Switchgrass RhizosphereMRAHSALRQFLLVLATGLVIAHADVARAQDGFRITYEVDRSRPDRARLTGKVVNERSDDVFEVHITAEALDSKGKVLARGISYVDSRITRGDGRPFSMSVPTVAGTANFRVIVSSYRAGFSTQGP
Ga0207669_1168297323300025937Miscanthus RhizosphereFVRVLARGTSVVALALLVLTAGLGLSVEPARAQNGFRVTYDVDRTRPDRARVTGRVVNERSEDVFEVNMTAEALDAKGKVLAKGIAYVDARIARGDSRTFSMSVPTVAGTSDFRVVVSSFRVGMAPQGP
Ga0207704_1174864513300025938Miscanthus RhizosphereFMHVRLLLVTRREQGECRRGARAAVRSRGIGVIPSKTMRSRSAIRRFVFMLAAGLVIVSADATRAQDGFRITYEVDRTRPDRARLTGKVVNERSDDVFEVNITAEALDAKGKVLARGISYVDSRIARGDGRPFSMSVPTVAGTTGFRVIVSSYRAGFSTQGP
Ga0207648_1014886733300026089Miscanthus RhizosphereMGLDGLLELPARPRRLRGRRRPLCYLRSMVVRVLARGTSVIALALLVLTAGLGLSVEPARAQNGFRVTYDVDRTRPDRARVTGRVVNERSEDVFEVNMTAEALDAKGKVLAKGIAYVDARIARGDSRTFSMSVPTVAGTSDFRVVVSSFRVGMAPQGP
Ga0207675_10006479613300026118Switchgrass RhizosphereMVVRVLVRGTFASALALVIVAAGLVLSVEPARAQNGFRVTYDVDRTRPDRARVTGRVVNERSEDVFEVNMTAEALDAKGKVLAKGIAYVDARIARGDGRTFSMSVPTVA
Ga0209814_1006477333300027873Populus RhizosphereMRARPVFVFTLVAVLAVLVVSVAAQEGFKITYDVDRSRPERARLTGRVVNERPEDVFEVSLTAEALDSRGKVLARGITYIDSRIARGDGRPFSMSVPTVAGTTNFRVVVSSFRAGFANQG
Ga0209481_1002123843300027880Populus RhizosphereMRARLALALLCFLGILLAVSTAPAQDGFKITYDVDRSRPERARLTGRVVNERAEDVFEVSLTAEALDARGKVLARGITYVDSRITRGDGRPFAMSVPTVAGTASFRVVVSSFRAGVANQG
Ga0207428_1002829883300027907Populus RhizosphereMLVRVLARGTSAFLLAAVLLVAGVFLSVGPALAQNGFRVTYDVDRTRPDRARVTGRVVNERAEDVFEVNMTAEALDAKGKVLARGIAYVDARIARGDSRSFSVSVPTVAGTSDFRVVVSSFKLSVGPGPQGP
Ga0268265_1038843543300028380Switchgrass RhizosphereRAQDGFRITYEVDRTRPDRARLTGKVVNERSDDVFEVNITAEALDAKGKVLARGISYVDSRIARGDGRPFSMSVPTVAGTTGFRVIVSSYRAGFSTQGP
Ga0268265_1047091723300028380Switchgrass RhizosphereMFVRVLARGTFASALAVLIVVAGLALSVEPARAQNGFRVTYDVDRTRPDRARVTGRVVNERNEDVFEVNMTAEALDAKGKVLAKGIAYVDARIARGDSRTFSMSVPTVAGTSDFRVVVSSFRVGMAPQGP
Ga0268264_1012182523300028381Switchgrass RhizosphereMVVRVLARGTFASALAVLIVVAGLALSVEPARAQNGFRVTYDVDRTRPDRARVTGRVVNERNEDVFEVNMTAEALDAKGKVLAKGIAYVDARIARGDSRTFSMSVPTVAGTSDFRVVVSSFRVGMAPQGP
Ga0247828_1003777053300028587SoilLCYLSYMLVRVLARGTSAFLLAAVLLVAGVFLSVGPALAQNGFRVTYDVDRTRPDRARVTGRVVNERAEDVFEVNMTAEALDAKGKVLARGIAYVDARIARGDSRSFSVSVPTVAGTSDFRVVVSSFKLSVGPGPQGP
Ga0307305_1034480423300028807SoilMLALAIVRHVIVLAVLLLLASQASGQDGFRITYEVDHTRAERARVTGRIVNERAEDVFEVSVTGEALDAKGKVLARGIAYVDSKIGRGDGRPFSMSVPTVAGTANYRVVVSSFRAGFTPQAPGTQGP
Ga0307302_1006207933300028814SoilMLALATVRRLVIVLAVLPLLAAEARGQDGFRITYEVDNTRAERARLTGRIVNERAEDVFEVSVTGEALDAKGKVLARGIAYVDSKIGRGDGRPFSMSVPTVAGTANYRVVVSSFRAGFSTQAPGTQGP
Ga0307278_1003670413300028878SoilPHQCDTFKNMAFAIVRPFVIVLAVLLLLTAEAPAQDGFRITYEIDRTRAERARLTGRIVNERPEDVFEVTVTGEALDAKGKVLARGIAYVDSKIGRGDGRPFSMSVPTVAGTANYRVVVSSFRAGFATQGP
Ga0307278_1031971223300028878SoilTSLVDARRVPSNLMALRSGPSGAPHRCDTFKNMLALATVRRLVIVLAVLPLLAAEARGQDGFRITYEVDNTRAERARLTGRIVNERAEDVFEVSVTGEALDAKGKVLARGIAYVDSKIGRGDGRPFSMSVPTVAGTANYRVVVSSFRAGFSTQAPGTQGP
Ga0299906_1094679513300030606SoilLISGEARAQDGFRISYEVDRSRVDRARLTGRVVNERAEDVFEVSITAEALDARGKVLARGITYVDSRIARTDARPFSMSVPTVPGVAGFRVVVSSYRLGFTTQGP
Ga0302046_10002213203300030620SoilMPASFPRIVALVLVAALGSLISGEACAQDGFRISYEVDRSRVDRARLTGRVVNERAEDVFEVSITAEALDARGKVLARGITYVDSRIARTDARPFSMSVPTVPGVAGFRVVVSSYRLGFTTQGP
Ga0307499_1002241923300031184SoilMFVRVLARGTFVVALALLVLTAALGLSVEPARAQNGFRVTYDVDRTRPDRARVTGRVVNERSEDVFEVNMTAEALDAKGKVLSKGIAYVDSKIGRGDGRSFSMSVPTLAGTTDFRVVVSSFRVGMAPQGP
Ga0307495_1021354023300031199SoilLLLTPEVRGQDGFRITYEVDRTRVERARLTGRIVNERSEDVFEVSVTGEALDAKGKVLARGIAYVDSKIGRGDGRSFSMSVPTVTGTANYRVVVSSFRSGPGTQGPSNQGP
Ga0307497_1021276723300031226SoilPARAQNGFRVTYDVDRTRPDRARVTGRVVNERNEDVFEVNMTAEALDAKGKVLAKGIAYVDARIARGDSRTFSMSVPTVAGTSDFRVVVSSFRVGMAPQGP
Ga0310888_1047524323300031538SoilGMIPSKTMRSRSAIRRFVFMLAAGLVIVSADATRAQDGFRITYEVDRTRPDRARLTGKVVNERSDDVFEVNITAEALDAKGKVLARGISYVDSRIARGDGRPFSMSVPTVAGTTGFRVIVSSYRAGFSTQGP
Ga0310888_1049064723300031538SoilMLVRVLARGTSAFLLAAVLLVAGVFLSVGPALARNGFRVTYDVDRTRPDRARVTGRVVNERAEDVFEVNMTAEALDAKGKVLARGIAYVDARIARGDSRSFSVSVPTVAGTSDFRVVVSSFKLSVGPGPQGP
Ga0307408_10026816523300031548RhizosphereVRAILRGLVLGLTTILVVLGAEETRAQDGFRITYDVDRSRADRARLTGRVVNERADDVFEVSITAEALDARGKVLARGISYVDSRINRGDGRPFSMSVPTVAGTASFRVAVSSFRAGFATQGP
Ga0310886_1072118023300031562SoilARGTSAFLLAAVLLVAGVFLSVGPALAQNGFRVTYDVDRTRPDRARVTGRVVNERAEDVFEVNMTAEALDAKGKVLARGIAYVDARIARGDSRSFSVSVPTVAGTSDFRVVVSSFKLSVGPGPQGP
Ga0307469_1030339633300031720Hardwood Forest SoilMVVRVLVRGTFASALAVLVVAAGLVLSVEPARAQNGFRVTYDVDRTRPDRARVTGRVVNERSEDVFEVNMTAEALDAKGKVLAKGIAYVDARIARGDGRPFSMSVPTVAGTSDFRVVVSSFRVGMATQGP
Ga0307468_10013218923300031740Hardwood Forest SoilMLVRVLAQGTSAFLLAAVLLVAGVFLSVGPALAQNGFRVTYDVDRTRPDRARVTGRVVNERAEDVFEVNMTAEALDAKGKVLARGIAYVDARIARGDSRSFSVSVPTVAGTSDFRVVVSGFKLSAGPGPQGP
Ga0307468_10020359123300031740Hardwood Forest SoilMVVRVLIRGTFASALAVLVVAAGLVLSVEPARAQNGFRVTYDVDRTRPDRARVTGRVVNERSEDVFEVNMTAEALDAKGKVLAKGIAYVDARIARGDGRAFSMSVPTVAGTSDFRVVVSSFRVGMAPQGP
Ga0307468_10080564523300031740Hardwood Forest SoilMFARVLVRGTFAAALALLVVTAGLGLSVEPARAQNGFRITYDIDRTRPDRARVTGRVVNERSEDVFEVNMTAEALDAKGKVLSKGIAYVDAKIGRGDGRAFSMSVPIVAGTTDFRVVVSSFRVGMAPQGP
Ga0310907_1013593413300031847SoilLAQNGFRVTYDVDRTRPDRARVTGRVVNERAEDVFEVNMTAEALDAKGKVLARGIAYVDARIARGDSRSFSVSVPTVAGTSDFRVVVSGFKLSVGPGPQGP
Ga0310892_1049397923300031858SoilMGLDGLLELPARPRRLRGRRRPLCYLRSMVVRVLARGTSVIALALLVLTAGLGLSVEPARAQNGFRVTYDVDRTRPDRARVTGRVVNERSEDVFEVNMTAEALDAKGKVLARGIAYVDARIARGDSRSFSVSVPTVAGTSDFRVVVSSFKLSVGPGPQGP
Ga0310893_1023505623300031892SoilMLAAGLIIVSADATRAQDGFRITYEVDRTRPDRARLTGKVVNERSDDVFEVNITAEALDAKGKVLARGISYVDSRIARGDGRPFSMSVPTVAGTTGFRVIVSSYRAGFSTQGP
Ga0310900_1191340113300031908SoilLCYLSYMLVRVLARGTSAFLLAAVLLVAGVFLSVGPALAQNGFRVTYDVDRTRPDRARVTGRVVNERAEDVFEVNMTAEALDAKGKVLARGIAYVDARIARGDSRSFSVSVPTVAGTSDFRVVVSGFKLSVGPGPQGP
Ga0310891_1039513913300031913SoilRGRPLCYLSYMLVRVLARGTSAFLLAAVLLVAGVFLSVGPALAQNGFRVTYDVDRTRPDRARVTGRVVNERAEDVFEVNMTAEALDAKGKVLARGIAYVDARIARGDSRSFSVSVPTVAGTSDFRVVVSSFKLSVGPGPQGP
Ga0310884_1036463613300031944SoilVAGVFLSVGPALAQNGFRVTYDVDRTRPDRARVTGRVVNERAEDVFEVNMTAEALDAKGKVLARGIAYVDARIARGDSRSFSVSVPTVAGTSDFRVVVSSFKLSVGPGPQGP
Ga0307411_1087605223300032005RhizosphereMRVRAILRGLVLGLTTILVVLGAEETRAQDGFRITYDVDRSRADRARLTGRVVNERADDVFEVSITAEALDARGKVLARGISYVDSRINRGDGRPFSMSVPTVAGTASFRVAVSSFRAGFATQGP
Ga0310902_1003635343300032012SoilGVIPSKTMRSRSAIRRFVFMLAAGLVIVSADATRAQDGFRITYEVDRTRPDRARLTGKVVNERSDDVFEVNITAEALDAKGKVLARGISYVDSRIARGDGRPFSMSVPTVAGTTGFRVIVSSYRAGFSTQGP
Ga0310906_1010256713300032013SoilLQPRGIGMIPSKTMRSRSAIRRFVFMLAAGLIIVSADATRAQDGFRITYEVDRTRPDRARLTGKVVNERSDDVFEVNITAEALDAKGKVLARGISYVDSRIARGDGRPFSMSVPTVAGTTGFRVIVSSYRAGFSTQGP
Ga0307470_1166952213300032174Hardwood Forest SoilAFLLAAVLLVAGVFLSVGPALAQNGFRVTYDVDRTRPDRARVTGRVVNERAEDVFEVNMTAEALDAKGKVLARGIAYVDARIARGDSRSFSVSVPTVAGTSDFRVVVSGFKLSAGPGPQG
Ga0310889_1041075923300032179SoilTMRSRSAIRRFVFMLAAGLVIVSADATRAQDGFRITYEVDRTRPDRARLTGKVVNERSDDVFEVNITAEALDAKGKVLARGISYVDSRIARGDGRPFSMSVPTVAGTTGFRVIVSSYRAGFSTQGP
Ga0307471_10076845123300032180Hardwood Forest SoilMFARVLVRGTFAAALALLVVTAGLGLSVEPARAQNGFRITYDIDRTRPDRARVTGRVVNERSEDVFEVNLTAEALDAKGKVLAKGIAYVDARIARGDGRAFSMSVPTVAGTSDFRV
Ga0307471_10103686323300032180Hardwood Forest SoilMFVRVLVRGTFVVALALLVVAAGLTVSVVPARAQNGFRITYEVDRTRPDRARVTGRVVNERNEDVFEVNLTAEALDAKGKVLAKGIAYVDARIARGDGRAFSMSVPTVAGTSDFRVVVSSFRAGMSTQGP
Ga0307472_10060982123300032205Hardwood Forest SoilMFAFVLAAVLLLAGLSLSADPALAQNGFRVTFDVDRTRPDRARVTGRVVNERAEDVFEVNMTAEALDAKGKVLARGIAYVDSRIARGDGRSFSMSVPTVAGTSDFRVVVSGFKLSAGPGPQGP
Ga0310896_1013631213300032211SoilQDGFRITYEVDRTRPDRARLTGKVVNERSDDVFEVNITAEALDAKGKVLARGISYVDSRIARGDGRPFSMSVPTVAGTTGFRVIVSSYRAGFSTQGP
Ga0310896_1081626523300032211SoilLCYLSYMLVRVLARGTSAFLLAAVLLVAGVFLSVGPALAQNGFRVTYDVDRTRPDRARVTGRVVNERAEDVFEVNMTAEALDAKGKVLARGIAYVDARIARGDSRSFSVSVPTVAGTSDFRVVVSGFKLSVG
Ga0335082_1058312913300032782SoilVLALLVLVAGLLLAADPAPAQTGFRITYDIDRTRPDRARITGRVVNERAEDVYEVNMTAEALDAKGKVLSRGIAYVDSRIARGDGRSFSMSVPTVAGTSDFRVSVSSFRLSGPPQGP
Ga0335080_1161119213300032828SoilMHARVLVRGTSAVVLVLLGLAGLLLSAAPAVAQNGFKITYDIDRTRPDRARITGRLVNERAEDVYEVNLTAEALDAKGKVLSRGIAYVDSRISRGDGRSFSMSVPTVPGTADFRVSVSSFRLSGPPQGP
Ga0335084_1087164023300033004SoilMLARVLVRGTSAVVLALLVLVAGLLLAADPAPAQTGFRITYDIDRTRPDRARITGRLVNERSEDVYEVNLTAEALDARGKVLSRGIAYVDSRIARGDGRSFSMSVPTVAGTSDFRVSVSSFRLSGSPQGP
Ga0335084_1199496913300033004SoilLCYLPYMVARVLVRGTSVSVLAALLIAAGLTLSADPARAQSGFRITYDVDRARPDRARVTGRVVNERTEDVFEVNMTAEALDTKGKVLARGIAYVDSRITRGDSRAFSMSVPTPPGTTDFRVVVSGFRLGVPPQGP
Ga0335077_1045365123300033158SoilMHARVLVRGTSAVVLVLLGLAGLLLSAAPAVAQNGFKITYDIDRTRPDRARITGRLVNERAEDVYEVNLTAEALDAKGKVLSRGIAYVDARISRGDGRSFSMSVPTVPGTSDFRVSVSSFRLSGPPQGP
Ga0214472_1056437913300033407SoilVLAGFPRIVALVLVAALGPLISGEARAQDGFRISYEVDRSRVDRARLTGRVVNERAEDVFEVSITAEALDARGKVLARGITYVDSRIARADGRPFSMNVPTVPGVAGFRVAVSSYRLGVSSQGP
Ga0214471_1010074223300033417SoilVLAGFPRIVALVLVAALGPLISGEARAQDGFRISYEVDRSRVDRARLTGRVVNERAEDVFEVSITAEALDARGKVLARGITYVDSRIARADGRPFSMSVPTVPGVAGFRVAVSSYRLGFSSQGP
Ga0373958_0028649_495_8723300034819Rhizosphere SoilMRSRSAIRRFVFMLAAGLVIVSADATRAQDGFRITYEVDRTRPDRARLTGKVVNERSDDVFEVNITAEALDAKGKVLARGISYVDSRIARGDGRPFSMSVPTVAGTTGFRVIVSSYRAGFSTQGP


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.