NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F058251

Metagenome Family F058251

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F058251
Family Type Metagenome
Number of Sequences 135
Average Sequence Length 49 residues
Representative Sequence APLEQNVQAALSFTPISESGKQKLQEKVAPSRAAWENFLRTHEDSVTV
Number of Associated Samples 125
Number of Associated Scaffolds 135

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.48 %
% of genes near scaffold ends (potentially truncated) 91.11 %
% of genes from short scaffolds (< 2000 bps) 91.85 %
Associated GOLD sequencing projects 121
AlphaFold2 3D model prediction Yes
3D model pTM-score0.44

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (88.889 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(8.889 % of family members)
Environment Ontology (ENVO) Unclassified
(37.778 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(34.074 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 44.74%    β-sheet: 0.00%    Coil/Unstructured: 55.26%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.44
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 135 Family Scaffolds
PF09084NMT1 10.37
PF13483Lactamase_B_3 9.63
PF00117GATase 4.44
PF07690MFS_1 4.44
PF13379NMT1_2 3.70
PF01192RNA_pol_Rpb6 3.70
PF01844HNH 2.96
PF08867FRG 2.22
PF01402RHH_1 1.48
PF00596Aldolase_II 1.48
PF09722Xre_MbcA_ParS_C 1.48
PF00248Aldo_ket_red 1.48
PF04909Amidohydro_2 1.48
PF00398RrnaAD 0.74
PF02604PhdYeFM_antitox 0.74
PF00501AMP-binding 0.74
PF05016ParE_toxin 0.74
PF08281Sigma70_r4_2 0.74
PF11860Muramidase 0.74
PF01118Semialdhyde_dh 0.74
PF06831H2TH 0.74
PF00271Helicase_C 0.74
PF01717Meth_synt_2 0.74
PF02743dCache_1 0.74
PF03235DUF262 0.74
PF01850PIN 0.74
PF02436PYC_OADA 0.74
PF03330DPBB_1 0.74
PF00857Isochorismatase 0.74
PF04014MazE_antitoxin 0.74

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 135 Family Scaffolds
COG0715ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic componentInorganic ion transport and metabolism [P] 10.37
COG4521ABC-type taurine transport system, periplasmic componentInorganic ion transport and metabolism [P] 10.37
COG1758DNA-directed RNA polymerase, subunit K/omegaTranscription [K] 3.70
COG003016S rRNA A1518 and A1519 N6-dimethyltransferase RsmA/KsgA/DIM1 (may also have DNA glycosylase/AP lyase activity)Translation, ribosomal structure and biogenesis [J] 0.74
COG0266Formamidopyrimidine-DNA glycosylaseReplication, recombination and repair [L] 0.74
COG0620Methionine synthase II (cobalamin-independent)Amino acid transport and metabolism [E] 0.74
COG1335Nicotinamidase-related amidaseCoenzyme transport and metabolism [H] 0.74
COG1479DNAse/DNA nickase specific for phosphorothioated or glycosylated phage DNA, GmrSD/DndB/SspE family, contains DUF262 and HNH nuclease domainsDefense mechanisms [V] 0.74
COG1535Isochorismate hydrolaseSecondary metabolites biosynthesis, transport and catabolism [Q] 0.74
COG2161Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM familyDefense mechanisms [V] 0.74
COG2972Sensor histidine kinase YesMSignal transduction mechanisms [T] 0.74
COG4118Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressorDefense mechanisms [V] 0.74


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms88.89 %
UnclassifiedrootN/A11.11 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000363|ICChiseqgaiiFebDRAFT_13177608All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium514Open in IMG/M
3300000597|AF_2010_repII_A1DRAFT_10084020All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium795Open in IMG/M
3300000655|AF_2010_repII_A100DRAFT_1007810All Organisms → cellular organisms → Bacteria2048Open in IMG/M
3300000787|JGI11643J11755_11543937All Organisms → cellular organisms → Bacteria837Open in IMG/M
3300000881|JGI10215J12807_1358378All Organisms → cellular organisms → Bacteria638Open in IMG/M
3300000893|AP72_2010_repI_A001DRAFT_1061700All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300000955|JGI1027J12803_100495979All Organisms → cellular organisms → Bacteria781Open in IMG/M
3300000955|JGI1027J12803_106938457All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium556Open in IMG/M
3300001139|JGI10220J13317_12329003All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas cavernicola992Open in IMG/M
3300002155|JGI24033J26618_1055908All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium574Open in IMG/M
3300002243|C687J29039_10257858All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium606Open in IMG/M
3300004808|Ga0062381_10425226Not Available514Open in IMG/M
3300005294|Ga0065705_10335945All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium978Open in IMG/M
3300005295|Ga0065707_10808704All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300005334|Ga0068869_100244444All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1431Open in IMG/M
3300005338|Ga0068868_101369073All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium659Open in IMG/M
3300005356|Ga0070674_100219753All Organisms → cellular organisms → Bacteria1477Open in IMG/M
3300005365|Ga0070688_101011746All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium661Open in IMG/M
3300005434|Ga0070709_11090675All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium638Open in IMG/M
3300005440|Ga0070705_101721271All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068530Open in IMG/M
3300005445|Ga0070708_100574346All Organisms → cellular organisms → Bacteria1063Open in IMG/M
3300005518|Ga0070699_100216672All Organisms → cellular organisms → Bacteria1705Open in IMG/M
3300005563|Ga0068855_100187326All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2336Open in IMG/M
3300005713|Ga0066905_100064533All Organisms → cellular organisms → Bacteria2322Open in IMG/M
3300005713|Ga0066905_100507246All Organisms → cellular organisms → Bacteria1004Open in IMG/M
3300005764|Ga0066903_106492940All Organisms → cellular organisms → Bacteria609Open in IMG/M
3300005841|Ga0068863_101894002All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium606Open in IMG/M
3300006224|Ga0079037_101309651All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RIFCSPLOWO2_12_FULL_60_19721Open in IMG/M
3300006755|Ga0079222_10045898All Organisms → cellular organisms → Bacteria1994Open in IMG/M
3300006794|Ga0066658_10550932All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium627Open in IMG/M
3300006806|Ga0079220_10603010All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium781Open in IMG/M
3300006806|Ga0079220_11539851All Organisms → cellular organisms → Bacteria573Open in IMG/M
3300006852|Ga0075433_10261703All Organisms → cellular organisms → Bacteria1533Open in IMG/M
3300006854|Ga0075425_100825523All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → Methylotenera1062Open in IMG/M
3300006871|Ga0075434_100298817All Organisms → cellular organisms → Bacteria1630Open in IMG/M
3300006871|Ga0075434_101055074All Organisms → cellular organisms → Bacteria826Open in IMG/M
3300006871|Ga0075434_101757548All Organisms → cellular organisms → Bacteria627Open in IMG/M
3300006904|Ga0075424_102306817All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium565Open in IMG/M
3300007076|Ga0075435_100693087All Organisms → cellular organisms → Bacteria885Open in IMG/M
3300009053|Ga0105095_10827647All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium519Open in IMG/M
3300009100|Ga0075418_11876549All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium652Open in IMG/M
3300009137|Ga0066709_102423812All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium712Open in IMG/M
3300009148|Ga0105243_10444441All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1215Open in IMG/M
3300009148|Ga0105243_12836378All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium525Open in IMG/M
3300009792|Ga0126374_10689424All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium767Open in IMG/M
3300010029|Ga0105074_1054224All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium712Open in IMG/M
3300010047|Ga0126382_11358731All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium646Open in IMG/M
3300010326|Ga0134065_10028544All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1623Open in IMG/M
3300010362|Ga0126377_10181437All Organisms → cellular organisms → Bacteria2003Open in IMG/M
3300010366|Ga0126379_10435249All Organisms → cellular organisms → Bacteria1369Open in IMG/M
3300010375|Ga0105239_10182112All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2351Open in IMG/M
3300010399|Ga0134127_12762828All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium571Open in IMG/M
3300010403|Ga0134123_12912253All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium547Open in IMG/M
3300011427|Ga0137448_1010833All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1934Open in IMG/M
3300011432|Ga0137428_1150484All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium684Open in IMG/M
3300011438|Ga0137451_1053513All Organisms → cellular organisms → Bacteria1187Open in IMG/M
3300012040|Ga0137461_1130349All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium732Open in IMG/M
3300012167|Ga0137319_1118857Not Available529Open in IMG/M
3300012200|Ga0137382_10644515All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium758Open in IMG/M
3300012210|Ga0137378_10317310All Organisms → cellular organisms → Bacteria1449Open in IMG/M
3300012211|Ga0137377_10229438All Organisms → cellular organisms → Bacteria1783Open in IMG/M
3300012228|Ga0137459_1062183All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1067Open in IMG/M
3300012355|Ga0137369_10292333All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1212Open in IMG/M
3300012582|Ga0137358_11061399All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300012912|Ga0157306_10129480All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium771Open in IMG/M
3300012971|Ga0126369_11125585Not Available874Open in IMG/M
3300012976|Ga0134076_10471472All Organisms → cellular organisms → Bacteria569Open in IMG/M
3300012985|Ga0164308_10376706All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1153Open in IMG/M
3300012987|Ga0164307_10729963All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium780Open in IMG/M
3300013308|Ga0157375_10513609All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1362Open in IMG/M
3300014296|Ga0075344_1033723Not Available859Open in IMG/M
3300014315|Ga0075350_1084664Not Available731Open in IMG/M
3300014745|Ga0157377_11067319All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium616Open in IMG/M
3300014870|Ga0180080_1101366Not Available512Open in IMG/M
3300014883|Ga0180086_1015691All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RIFCSPLOWO2_12_FULL_60_191653Open in IMG/M
3300014968|Ga0157379_11070665All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium771Open in IMG/M
3300015052|Ga0137411_1039077Not Available1149Open in IMG/M
3300015052|Ga0137411_1206436Not Available1152Open in IMG/M
3300015372|Ga0132256_100137371All Organisms → cellular organisms → Bacteria2435Open in IMG/M
3300015374|Ga0132255_100281441All Organisms → cellular organisms → Bacteria2388Open in IMG/M
3300015374|Ga0132255_102948420All Organisms → cellular organisms → Bacteria727Open in IMG/M
3300016319|Ga0182033_10225056All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1509Open in IMG/M
3300016387|Ga0182040_10302354All Organisms → cellular organisms → Bacteria1224Open in IMG/M
3300017944|Ga0187786_10059096All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1181Open in IMG/M
3300017966|Ga0187776_10982882Not Available619Open in IMG/M
3300017997|Ga0184610_1064984All Organisms → cellular organisms → Bacteria1104Open in IMG/M
3300018028|Ga0184608_10326679All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium674Open in IMG/M
3300018063|Ga0184637_10418571All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria794Open in IMG/M
3300018063|Ga0184637_10583687All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium636Open in IMG/M
3300018064|Ga0187773_10069862All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1664Open in IMG/M
3300018074|Ga0184640_10051828All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1699Open in IMG/M
3300018079|Ga0184627_10423658All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria692Open in IMG/M
3300018081|Ga0184625_10134764All Organisms → cellular organisms → Bacteria → Acidobacteria1287Open in IMG/M
3300018082|Ga0184639_10110688All Organisms → cellular organisms → Bacteria1453Open in IMG/M
3300018429|Ga0190272_10248789All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1332Open in IMG/M
3300018431|Ga0066655_10146819All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1394Open in IMG/M
3300018432|Ga0190275_10161786Not Available2076Open in IMG/M
3300018468|Ga0066662_12395432All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium555Open in IMG/M
3300018469|Ga0190270_10943458Not Available884Open in IMG/M
3300018482|Ga0066669_10417684All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1142Open in IMG/M
3300019377|Ga0190264_10083233All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1435Open in IMG/M
3300019889|Ga0193743_1128063All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium905Open in IMG/M
3300020004|Ga0193755_1064271All Organisms → cellular organisms → Bacteria1190Open in IMG/M
3300020034|Ga0193753_10201306All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium913Open in IMG/M
3300020060|Ga0193717_1015387All Organisms → cellular organisms → Bacteria3455Open in IMG/M
3300021073|Ga0210378_10064255All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1442Open in IMG/M
3300022756|Ga0222622_10407144All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium959Open in IMG/M
3300025157|Ga0209399_10277136Not Available662Open in IMG/M
3300025174|Ga0209324_10225947All Organisms → cellular organisms → Bacteria1238Open in IMG/M
3300025313|Ga0209431_10118516All Organisms → cellular organisms → Bacteria2088Open in IMG/M
3300025909|Ga0207705_11001032All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium646Open in IMG/M
3300025931|Ga0207644_11603855All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300025958|Ga0210069_1059215All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300025972|Ga0207668_10425477All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1128Open in IMG/M
3300026058|Ga0208421_1014483All Organisms → cellular organisms → Bacteria697Open in IMG/M
3300026088|Ga0207641_11668478All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium639Open in IMG/M
3300027577|Ga0209874_1009947All Organisms → cellular organisms → Bacteria2808Open in IMG/M
3300027639|Ga0209387_1030167All Organisms → cellular organisms → Bacteria1104Open in IMG/M
3300027654|Ga0209799_1092468All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium685Open in IMG/M
3300027722|Ga0209819_10124955All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium899Open in IMG/M
3300027765|Ga0209073_10074003All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1163Open in IMG/M
3300027775|Ga0209177_10086368All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium969Open in IMG/M
3300027787|Ga0209074_10394494All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium578Open in IMG/M
3300027815|Ga0209726_10095460All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1818Open in IMG/M
3300028379|Ga0268266_12324884All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium507Open in IMG/M
3300031912|Ga0306921_11310911All Organisms → cellular organisms → Bacteria800Open in IMG/M
3300031949|Ga0214473_10680922All Organisms → cellular organisms → Bacteria1124Open in IMG/M
3300032122|Ga0310895_10704526All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium525Open in IMG/M
3300032180|Ga0307471_101625381All Organisms → cellular organisms → Bacteria802Open in IMG/M
3300032180|Ga0307471_103425417All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium562Open in IMG/M
3300032421|Ga0310812_10243671All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium789Open in IMG/M
3300033406|Ga0316604_10500569Not Available668Open in IMG/M
3300033408|Ga0316605_11395985Not Available679Open in IMG/M
3300033480|Ga0316620_10680209Not Available976Open in IMG/M
3300034151|Ga0364935_0034775All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1427Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil8.89%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil5.93%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment5.93%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere5.93%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.19%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil5.19%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.19%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.70%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil2.22%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.22%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.22%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands2.22%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.22%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.22%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.96%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.96%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.96%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment1.48%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.48%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.48%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere1.48%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.48%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil1.48%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand1.48%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.48%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.48%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.48%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.48%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.48%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.74%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment0.74%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.74%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater0.74%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.74%
Thermal SpringsEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs0.74%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.74%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.74%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.74%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.74%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.74%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.74%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.74%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.74%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.74%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.74%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.74%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.74%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.74%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000363Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000597Forest soil microbial communities from Amazon forest - 2010 replicate II A1EnvironmentalOpen in IMG/M
3300000655Forest soil microbial communities from Amazon forest - 2010 replicate II A100EnvironmentalOpen in IMG/M
3300000787Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000881Soil microbial communities from Great Prairies - Wisconsin Restored Prairie soilEnvironmentalOpen in IMG/M
3300000893Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A001EnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001139Soil microbial communities from Great Prairies - Wisconsin, Switchgrass soilEnvironmentalOpen in IMG/M
3300002155Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7Host-AssociatedOpen in IMG/M
3300002243Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_2EnvironmentalOpen in IMG/M
3300004808Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1FreshEnvironmentalOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005295Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3EnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300006224Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaGEnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009053Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010029Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_10_20EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011427Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT418_2EnvironmentalOpen in IMG/M
3300011432Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT718_2EnvironmentalOpen in IMG/M
3300011438Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT500_2EnvironmentalOpen in IMG/M
3300012040Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT746_2EnvironmentalOpen in IMG/M
3300012167Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT333_2EnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012228Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT700_2EnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012912Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012976Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014296Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D1EnvironmentalOpen in IMG/M
3300014315Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleC_D1EnvironmentalOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300014870Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT560_16_10DEnvironmentalOpen in IMG/M
3300014883Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT760_16_10DEnvironmentalOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015052Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300017944Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MGEnvironmentalOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300017997Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coexEnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018063Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2EnvironmentalOpen in IMG/M
3300018064Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018074Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2EnvironmentalOpen in IMG/M
3300018079Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1EnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300018082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2EnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018432Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 TEnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019377Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 TEnvironmentalOpen in IMG/M
3300019889Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2c2EnvironmentalOpen in IMG/M
3300020004Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2EnvironmentalOpen in IMG/M
3300020034Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c2EnvironmentalOpen in IMG/M
3300020060Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c2EnvironmentalOpen in IMG/M
3300021073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redoEnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300025157Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3 (SPAdes)EnvironmentalOpen in IMG/M
3300025174Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 3EnvironmentalOpen in IMG/M
3300025313Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes)EnvironmentalOpen in IMG/M
3300025909Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025958Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026058Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027577Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 (SPAdes)EnvironmentalOpen in IMG/M
3300027639Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control (SPAdes)EnvironmentalOpen in IMG/M
3300027654Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027722Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027765Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300027787Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)EnvironmentalOpen in IMG/M
3300027815Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes)EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031949Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197EnvironmentalOpen in IMG/M
3300032122Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032421Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3EnvironmentalOpen in IMG/M
3300033406Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_CTEnvironmentalOpen in IMG/M
3300033408Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCTEnvironmentalOpen in IMG/M
3300033480Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_BEnvironmentalOpen in IMG/M
3300034151Sediment microbial communities from East River floodplain, Colorado, United States - 2_s17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
ICChiseqgaiiFebDRAFT_1317760823300000363SoilPVASVIIGCELMAPLEQNVQAALNFTPISESGKQKLQEKLAPSRSAWEDFLRDHEDTIAV
AF_2010_repII_A1DRAFT_1008402023300000597Forest SoilIGCEQIARLEENVQAALHFTPMSESGKQKLQERVAPSRSAWENFLRSHVDSVTV*
AF_2010_repII_A100DRAFT_100781033300000655Forest SoilCEQVVPLEQNVQAALAFTPMNESGRQRLQEKVAPSRSAWQQFLQSHDDSLPV*
JGI11643J11755_1154393723300000787SoilASVVIGCEQIAPLEQNVQAAMIFRPISESDKQRLQEKVAPSRSTWENFLRTHEDSVAV*
JGI10215J12807_135837823300000881SoilTPISESSKQKLQDKVAPSRSAWQNFLRTHEDSVTV*
AP72_2010_repI_A001DRAFT_106170013300000893Forest SoilVPLEQNVQAALAFTPMNESGRQRLQEKVAPSRSAWQQFLQSHDDSLPV*
JGI1027J12803_10049597913300000955SoilEQMAPLEQNVQAALAFTPMNESGKQKLQEKVAPSRSAWQQFLKSHDDSLPV*
JGI1027J12803_10693845713300000955SoilCVVIGCEQMAPLEQNVQAALNFTPMSESGKQKLQEKVAPSRSAWQRFLQSHDDSV
JGI10220J13317_1232900323300001139SoilALNFTPISESSKQKLQDKVARSRSAWQNFLRTHEDSVTV*
JGI24033J26618_105590823300002155Corn, Switchgrass And Miscanthus RhizosphereAALSYTPASESDTQRLREKIASSRSAWENFLRTHENGTVV*
C687J29039_1025785813300002243SoilCEQLATLEQNIQAALNFTPISESDKQKLREKVAPSRSAWQGFLQHHDDSAAV*
Ga0062381_1042522623300004808Wetland SedimentQAAINFTPIGADGKQKLQEKVAPSRSAWEQFLRTHEDTIVV*
Ga0065705_1033594523300005294Switchgrass RhizosphereAASFTPMSENGKQRVKEKVAPSRAAWENFLRTHDDSAVV*
Ga0065707_1080870423300005295Switchgrass RhizosphereAALTFTPISESGKEKLQEKVAPSRSAWENFLRTHEDSVAV*
Ga0068869_10024444413300005334Miscanthus RhizosphereASVIIGCEQMALLGQSIQAALSFTPASDSDKQRLREKIASSRSAWENFLRTHENGTVV*
Ga0068868_10136907313300005338Miscanthus RhizospherePVASVIIGCEEMAPLEENVLAAASFTPMSENGKQRVKEKVAPSRAAWENFLRTHEDSAVV
Ga0070674_10021975323300005356Miscanthus RhizosphereVASVIIGCAQMALLGQNIQAALSFTPARESDKQRLREKIAPSRSAWENFLRTHEDGTVV*
Ga0070688_10101174623300005365Switchgrass RhizosphereAALSFTPARESDKQRLREKIAPSRSAWENFLRTHEDGTVV*
Ga0070709_1109067523300005434Corn, Switchgrass And Miscanthus RhizosphereIQVAQSFTPVSESGKQRLREKLAPSRSAWENFLRAHEDGPIA*
Ga0070705_10172127113300005440Corn, Switchgrass And Miscanthus RhizospherePVASVIIGCEQLAPLEQNVQAAMNFTPISESGKQKLQEQVAPSRAAWENFLRSHEDSAAV
Ga0070708_10057434623300005445Corn, Switchgrass And Miscanthus RhizosphereQAALAFTPMNESGKQKLQEKVAPSRSAWQGFLRSHDDSLPV*
Ga0070699_10021667213300005518Corn, Switchgrass And Miscanthus RhizosphereAPLEQNVQAALAFTPMNESGRQRLQEKVAPSRSAWQGFLRSHDDSMPV*
Ga0068855_10018732613300005563Corn RhizosphereNIQAALSFTPARESDKQRLREKIAPSRSAWENFLRTHEDGTVV*
Ga0066905_10006453313300005713Tropical Forest SoilVASVVIGCEQIARLEENVQAALHFTPMSESGKQKLQERVVPSRSAWQNFLRSHEDSVTV*
Ga0066905_10050724613300005713Tropical Forest SoilVIGCEQVVPLEQNVQTALAFTPMNESGRQRLQEKVAPSRSAWQQLLQSHDDSLPV*
Ga0066903_10649294023300005764Tropical Forest SoilVASVVIGCEQIARLEENVQAAMHFTPMSESGKQKLQERVAPSRSAWENFLRSHVDSLTA*
Ga0068863_10189400213300005841Switchgrass RhizosphereCEEMAPLEENVLAAASFTPMSENGKQRVKEKVAPSRAAWENFLRTHEDSAVV*
Ga0079037_10130965113300006224Freshwater WetlandsGVEQMALLEENVQTARAFTPMTDSHRQRLQEKVAPSRAAWQRFLQSHGDSLPA*
Ga0079222_1004589833300006755Agricultural SoilASVIIGCEQIAPLEQNIQAALNFTPASDSRKQQLREKLAPARSAWENFLRTHEDGTVA*
Ga0066658_1055093223300006794SoilEQMARLEQNIQAARSFVAMNDGEKQKLRDAVAPSRSAWHRFLESHDDSLPV*
Ga0079220_1060301023300006806Agricultural SoilMSFTPARESDKQRLREKIAPSRSAWENFLRTHEDGTVV*
Ga0079220_1153985123300006806Agricultural SoilLTQPVASVIIGCEEMAPLEENVLAAASFTPMSENGKQRVKEKVAPSRAAWENFLRTHEDSAVV*
Ga0075433_1026170313300006852Populus RhizosphereVVIGCEQMARLEENVQAALNFTPISESGKQKLQQKVAPSRSAWQNFLRDHDDSAVV*
Ga0075425_10082552313300006854Populus RhizospherePMNESGKQKLQEKVAPSRSAWQGFLRSHDDSMPV*
Ga0075434_10029881713300006871Populus RhizosphereNLSQPVASVIIGCAQMALLGQNIQAALSFTPARESDKQRLREKIAPSRSAWENFLRTHEDGTVV*
Ga0075434_10105507413300006871Populus RhizosphereVASVVIGCEQMAPLEQNVQAALAFTPLNESGKQRLQEKVAPSRSAWQRFLNSHDDSLPA*
Ga0075434_10175754823300006871Populus RhizosphereAALAFTPMNESGKQKLQEKVAPSRSAWQGFLRSHDDSLPV*
Ga0075424_10230681723300006904Populus RhizosphereCEQMAPLEQNVQAALNFTPMTESGKQKLQEKVAPSRSAWQNFLRTHEDSVAV*
Ga0075435_10069308713300007076Populus RhizosphereQNVQAALAFTPMNESGKQKLQEKIAPSRSAWQQFLKSHDDSLPV*
Ga0105095_1082764713300009053Freshwater SedimentNFTPISESGKQKLQEKVAPSRSAWENFLRSHEDSVAV*
Ga0075418_1187654913300009100Populus RhizosphereVASVIIGCEEMAPLEENVLAAASFTPMSENGKQRVKEKVAPSRAAWENFLRTHEDSAVV*
Ga0066709_10242381223300009137Grasslands SoilMEKKGPLEENVQVARSFTPMNESGKQKLREKVAPSRSAWQRFLRSHDDSLPV*
Ga0105243_1044444123300009148Miscanthus RhizosphereFTPASESDKQRLREKIASSCSAWENFLRTHEDGTVV*
Ga0105243_1283637823300009148Miscanthus RhizosphereLEQNVQAALNFTPLSEGSKQKLQEKVAPSRSAWENFLRSHEDSVTV*
Ga0126374_1068942413300009792Tropical Forest SoilLEENVQAAMHFTPMSESGKQKLQERVAPSRSAWENFLRSHVDSVTV*
Ga0105074_105422423300010029Groundwater SandCVVIGCEQMARLEENVQAALDFTPISESGKQRLQEKVAPSRSAWEISCGHMRIQ*
Ga0126382_1135873113300010047Tropical Forest SoilLEENVQAAMHFTPMSESGKQKLQERVAPSRSAWENFLRSHVDSLTV*
Ga0134065_1002854433300010326Grasslands SoilVIGVEQMARLEQNIQAARSFVAMNDGEKQKLRDAVAPSRSAWHRFLESHDDSLPV*
Ga0126377_1018143733300010362Tropical Forest SoilPMSEDEKQKLQEKVAPSRSAWQRFLQSHDDLLPA*
Ga0126379_1043524913300010366Tropical Forest SoilNVRAALAFTPMSETNRQRLQEKVAPSRSAWQQFLQSHDDSCPV*
Ga0105239_1018211213300010375Corn RhizosphereQMPLLGQNIQAVLSYTPASESDKQRLREKIAPSRSAWENFLRTHEDGTVV*
Ga0134127_1276282813300010399Terrestrial SoilSVIIGCEQLAPLEQNVQAALNFTPMSEGGKQKLQEKVAPSRSAWENFLRSHEDSVTV*
Ga0134123_1291225323300010403Terrestrial SoilALNFTPITENEKERVKEKVAPSRSAWENFLRTHEDSAVV*
Ga0137448_101083313300011427SoilMAPLEQNVHAVLNFTPISEHGKQTLQEKVAPSQSAWDNFLGIHADSVMV*
Ga0137428_115048413300011432SoilMVRLEENVQAALNFTPISESGKQKLQEKVAPSRSAWQNFLRNHDDSVTV*
Ga0137451_105351323300011438SoilPLEHNVQAALNFTPISESNKQKLQEKVAPSRSAWQNYLRRHEDTAV*
Ga0137461_113034923300012040SoilVIGCEQMARLEENVQAALNFTPISESAKQRLQDKVAPSRAAWQNFLRSHNDTIAV*
Ga0137319_111885723300012167SoilQVAMNFTPIEETGKHKLQEKVAPSRSAWEQFLRTYEDSVTV*
Ga0137382_1064451523300012200Vadose Zone SoilNFTPISESVKQKLQEKVAPSRSAWEKFLESHEDSVTV*
Ga0137378_1031731013300012210Vadose Zone SoilAALNFTPISESGRQRLQEKVAPSRSAWENFLRTHEDSLPV*
Ga0137377_1022943813300012211Vadose Zone SoilQNVQAAMNFTPISESDKQKLQEKVAPSRSAWENFLRTHEDSVTV*
Ga0137459_106218323300012228SoilLAPLEQNVQVAMNFTPIEETGKHKLQEKVAPSRSAWEQFLRTYEDSVTV*
Ga0137369_1029233323300012355Vadose Zone SoilMAPLEQNVQAALNFTPISESGKQKLQEKVTPSRSAWQNFPRTHEDSVTV*
Ga0137358_1106139913300012582Vadose Zone SoilEQNVQAAMNFTPISESGRQRLQEKVAPSRSTWENYLRTHEDSVTV*
Ga0157306_1012948023300012912SoilALLGQNIQAALSFTPARESDKQRLREKIAPSRSAWENFLRTHEDGTVV*
Ga0126369_1112558513300012971Tropical Forest SoilPLEQNVQAAIRFTPISESGKQRLRERVAPSRSAWENFLRNHDDSIAMKA*
Ga0134076_1047147213300012976Grasslands SoilQAALNFTPISESGKQRLQEKVAPSRSAWENFLRTHEDSLPV*
Ga0164308_1037670613300012985SoilTPMSENGKQRVKEKVAPSRAAWENFLRTHEDSAVV*
Ga0164307_1072996313300012987SoilNLTQPVASVIIGCEEMAPLEENVLAAASFTPMSENGKQRVKEKVAPSRAAWENFLRTHEDSAVV*
Ga0157375_1051360913300013308Miscanthus RhizosphereIQAALSFTPARESDKQRLREKIAPSRSAWENFLRTHEDGTVV*
Ga0075344_103372313300014296Natural And Restored WetlandsVIIGCEHLSPLEENIQAAINFSPISDDAKQRLQEKVAPSRSAWENFLRHHEDSATV*
Ga0075350_108466423300014315Natural And Restored WetlandsLSPLEENIQAAINFSPISDDAKQRLQEKVAPSRSAWENFLRHHEDSATV*
Ga0157377_1106731913300014745Miscanthus RhizosphereVLAAASFTPMSENGKQRVKEKVAPSRAAWENFLRTHEDSAVV*
Ga0180080_110136623300014870SoilEQNVQVAMNFTPIEETGKHKLQEKVAPSRSAWEQFLRTHEDSVTV*
Ga0180086_101569113300014883SoilTAHLEQNVQAALNFTPISESGKQKLQEKVAPSRSAWQGFLKSHDASLAV*
Ga0157379_1107066523300014968Switchgrass RhizosphereMALLGQNIQAALSFTPARESDKQRLREKIAPSRSAWENFLRTHEDGTVV*
Ga0137411_103907733300015052Vadose Zone SoilAMNFTPISESVKQKLQEKVAPSRSAWEKFLESHEDSVTV*
Ga0137411_120643613300015052Vadose Zone SoilAAMNFTPISESVKQKLQEKVAPSRSAWEKFLESHEDSVTV*
Ga0132256_10013737143300015372Arabidopsis RhizosphereEEMAPLEENVLAAASFTPMSENGKQRVKEKVAPSRAAWENFLRTHEDSAVV*
Ga0132255_10028144113300015374Arabidopsis RhizosphereAPLEQNIHAALNFTPMSESGKQKLQEKVAPSRWAWQRFLESHDDSAAV*
Ga0132255_10294842023300015374Arabidopsis RhizosphereGCEQLAPLEQNVQAALNFTPMSEGGKQKLQEKVAPSRSAWENFLRSHEDSVTV*
Ga0182033_1022505613300016319SoilLEQNIQAALNFTPMSESGKERVREKVAPSRSAWENFLRNHDDRSQ
Ga0182040_1030235423300016387SoilCEQMTPLEQNIQAALNFTPMSESGKERVREKVAPSRSAWENFLRNHDDRSQ
Ga0187786_1005909623300017944Tropical PeatlandFTPISESGKQKLQEKVAPSRAAWENFLRTHEDSVTV
Ga0187776_1098288223300017966Tropical PeatlandTPISESGKQKLQEKVAPSRAAWENFLRTHEDSVTV
Ga0184610_106498413300017997Groundwater SedimentSVVIGCEQMARLEENVQAALNFTPISESGKQKLQEKVAPSRSAWENFLRSHEDSVTV
Ga0184608_1032667923300018028Groundwater SedimentLEENVQAAMHFTPMSESNKQKLQERVAPSRSAWENFLRSHVDSVAV
Ga0184637_1041857113300018063Groundwater SedimentNVQAALNFTPISEGGKQKLQEKVAPSRAAWQNFLRSHDDTIAV
Ga0184637_1058368713300018063Groundwater SedimentQLAPLEQNVQAAMNFIPISESGKQKLQEKVAPSRSAWENFLRTHEDSVAV
Ga0187773_1006986213300018064Tropical PeatlandAPLEQNVQAALSFTPISESGKQKLQEKVAPSRAAWENFLRTHEDSVTV
Ga0184640_1005182813300018074Groundwater SedimentVIGCEQLAPLEQNVQAALNFTPISESGKQKLQEKVAPSRAAWQNFLRTHEDTATV
Ga0184627_1042365813300018079Groundwater SedimentNVQAAINFTPMSESGKEKLQEKVAPSRSAWENFLRTHEDSVTV
Ga0184625_1013476413300018081Groundwater SedimentQPVASVVIGCEQMARLEENVQAALNFTPISENGKQKLQEKVAPSRAAWQNFLRSHDDSVA
Ga0184639_1011068853300018082Groundwater SedimentVVIGCEQLAPLEQNVQAALNFTPISESGKQKLQEKVAPSRAAWQNFLRSHDDTIAV
Ga0190272_1024878923300018429SoilFTPMDESGKQKLQEKVAPSRSAWENFLRTHEDTIPV
Ga0066655_1014681913300018431Grasslands SoilRLEQNIQAARSFVAMNDGEKQKLRDAVAPSRSAWHRFLESHDDSLPV
Ga0190275_1016178633300018432SoilTPMGESAKQRLQEKVAPSRSAWENFLRTHEDAATV
Ga0066662_1239543223300018468Grasslands SoilPLEQNVQAALNFTPMSENGKQKLQEKVAPSRSAWQRFLQSHDDSVAV
Ga0190270_1094345813300018469SoilVASVIIGCEQLAPLEQNVQAAMNFTPMGETGRHKLQEEVAPSRSAWENFLRTHEDTIPV
Ga0066669_1041768433300018482Grasslands SoilAPLEQNVQAALNFTPISETGKQKLQEKVAPSRSAWENFLRAHEDSVAV
Ga0190264_1008323313300019377SoilSQPVASVVIGCEQLAPLEQNVQAAMNFTPIGESAKQRLQEKVAPSRSAWENFLRTHEDAATV
Ga0193743_112806323300019889SoilSFTPISESGKQKLQEKVAPSRSAWENFLRTHEDSIVV
Ga0193755_106427123300020004SoilLEQNVQATLNFTPMSEGGKQKLQEKVAPSRSAWENFLRSHEDSVTV
Ga0193753_1020130623300020034SoilVQAALSFTPISESGKQKLQEKVAPSRSAWENFLRTHEDSIVV
Ga0193717_101538743300020060SoilNFTPISESGKQKLQEKIAPSRSAWENFLRGHEDSITV
Ga0210378_1006425513300021073Groundwater SedimentAAMNFIPISENGKQKLQEKVAPSRSAWQKFLEMHDDSATV
Ga0222622_1040714423300022756Groundwater SedimentSQPVASVIIGCEQLAPLEQNVQATLNFTPMSEGGKQKLKEKVAPSRSAWENFLRSHEDSVTV
Ga0209399_1027713623300025157Thermal SpringsRAALHFTPITEGAKHKLQEKVAPSRSAWQHFLQSHNDSPPV
Ga0209324_1022594733300025174SoilEQMAPLEQNVQAALNFTPISESGKQELQEKVAPSRSAWQRFLQSHDDSVAA
Ga0209431_1011851613300025313SoilHLEQNVQATLNFTPISESGKQKLQEKVAPSRSAWQRFLQSHGDSLPA
Ga0207705_1100103223300025909Corn RhizosphereMFCLSSVIIGCAQMALLGQNIQAALSFTPARESDKQRLREKIAPSRSAWENFLRTHEDGTVV
Ga0207644_1160385523300025931Switchgrass RhizosphereVIIGCEEMAPLEENVLAAASFTPMSENGKQRVKEKVAPSRAAWENFLRTHEDSAVV
Ga0210069_105921513300025958Natural And Restored WetlandsIGCEQFSPLEENIQAALNFKPISDGAKQRLQEKVAQSRSAWENFLRHHEDSATV
Ga0207668_1042547713300025972Switchgrass RhizosphereDGAARAKHQAALSYTPASESDTQRLREKIASSRSAWENFLRTHEDGTVV
Ga0208421_101448313300026058Natural And Restored WetlandsQPVASVVIGCEQLAPLEQNVQAAMNFRPISESGKQRLQEKVAPSRSAWENFLRTHEDSVA
Ga0207641_1166847823300026088Switchgrass RhizosphereIGCEEMAPLEENVLAAASFTPMSENGKQRVKEKVAPSRAAWENFLRTHEDSAVV
Ga0209874_100994733300027577Groundwater SandVACVVIGCEQMAPLEQNIQAALNFTPMSESEKPKLQEKVAPSRSAWQRFLQSHDDSIAV
Ga0209387_103016723300027639Agricultural SoilEQNVQAAANFTPISESGKQKLQEKVAPSRSAWQKFL
Ga0209799_109246813300027654Tropical Forest SoilARLEENVQAAMHFTPMSESGKQKLQERVAPSRSAWENFLRSHVDSLTV
Ga0209819_1012495523300027722Freshwater SedimentPVACVVIGCEQMVRLEENVQAALNFTPINESGKQKLQEKVAPSRSAWQRFLQSHDDSVAI
Ga0209073_1007400313300027765Agricultural SoilLGQNIQAVLSYTPASESDKQRLREKIAPSRSAWENFLRTHEDGTVV
Ga0209177_1008636823300027775Agricultural SoilNLSQPVASVIIGCEQITPLEQNIQAALNFTPASDSRKQQLREKLAPARSAWENFLRTHEDGTVV
Ga0209074_1039449413300027787Agricultural SoilPVASVIIGCEQMAALEQNIQAALNSTPMSESAKQQVREKVAPSRSAWENFLRTHEDSALV
Ga0209726_1009546033300027815GroundwaterMDPLEQNVQAALDFRPMSESGKQKLQEKVAPSWAAWENFLRTHEDSVAV
Ga0268266_1232488423300028379Switchgrass RhizosphereNLSQPVASVIIGCAQMALLGQNIQAALSFTPARESDKQRLREKIAPSRSAWENFLRTHEDGTVV
Ga0306921_1131091123300031912SoilALSFAPMSEPDKQKLQEKVAPSRSAWQRFLESHDDFVAV
Ga0214473_1068092213300031949SoilASVVIGCEQMARLEENVLAALNFTPISEIGKQKLQEKVAPSRSAWQNFLRNHDDSVAV
Ga0310895_1070452623300032122SoilEQLAPLEQNVQAALNFTPISESSKQKLQEKVAPSRSAWENFLRSHEDSVTV
Ga0307471_10162538113300032180Hardwood Forest SoilVASVIIGCEQLAPLEQNVQAALNFTPISESSKQKLQEKVAPSRSAWENFLRSHEDSVTV
Ga0307471_10342541713300032180Hardwood Forest SoilPVACVVIGCEQMAPLEQNVQAAQSFVPMNENDKQKLQEKVAPSRSAWQQFLQSHDDSVAV
Ga0310812_1024367113300032421SoilPVASVIIGCEQIAPLEQNIQAALNFTPASDSRKQRLREKLAPSRSAWENFLRTHEDGTVV
Ga0316604_1050056913300033406SoilEQNVQAALNFTPLGETGKQKLQEQVAPSRSAWEKFLRAHEDSITV
Ga0316605_1139598513300033408SoilLSQPVASVIIGCEQLSPLEENIRAALNFKPISDDAKQRLQEKVAPSRSAWEKFLRQHEDSITV
Ga0316620_1068020923300033480SoilVACVVIGCEQMAPLEQNLQAAIKFTPLGENEKRKLQEKVVPSRSGWQQFLRSHADS
Ga0364935_0034775_1142_12913300034151SedimentMVRLEENVQAALNFTPISESGKQKLQEKVAPSRSAWQNFLRNHDDSVTV


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.