Basic Information | |
---|---|
Family ID | F058006 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 135 |
Average Sequence Length | 45 residues |
Representative Sequence | DEARFIPIWELGFLCASGPRAAVSGLSLIPLFAYSGPYEDVQLKS |
Number of Associated Samples | 106 |
Number of Associated Scaffolds | 135 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 5.19 % |
% of genes near scaffold ends (potentially truncated) | 93.33 % |
% of genes from short scaffolds (< 2000 bps) | 94.07 % |
Associated GOLD sequencing projects | 104 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.17 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (77.037 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (17.037 % of family members) |
Environment Ontology (ENVO) | Unclassified (25.926 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (38.519 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 5.48% β-sheet: 0.00% Coil/Unstructured: 94.52% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.17 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 135 Family Scaffolds |
---|---|---|
PF00496 | SBP_bac_5 | 22.96 |
PF01804 | Penicil_amidase | 3.70 |
PF13436 | Gly-zipper_OmpA | 3.70 |
PF00528 | BPD_transp_1 | 2.96 |
PF03972 | MmgE_PrpD | 2.22 |
PF00884 | Sulfatase | 2.22 |
PF13191 | AAA_16 | 1.48 |
PF00903 | Glyoxalase | 1.48 |
PF01738 | DLH | 1.48 |
PF02954 | HTH_8 | 1.48 |
PF12399 | BCA_ABC_TP_C | 0.74 |
PF02775 | TPP_enzyme_C | 0.74 |
PF01042 | Ribonuc_L-PSP | 0.74 |
PF01209 | Ubie_methyltran | 0.74 |
PF07978 | NIPSNAP | 0.74 |
PF05199 | GMC_oxred_C | 0.74 |
PF07715 | Plug | 0.74 |
PF14106 | DUF4279 | 0.74 |
PF00239 | Resolvase | 0.74 |
PF13416 | SBP_bac_8 | 0.74 |
PF04909 | Amidohydro_2 | 0.74 |
PF13424 | TPR_12 | 0.74 |
PF01610 | DDE_Tnp_ISL3 | 0.74 |
PF11969 | DcpS_C | 0.74 |
PF13649 | Methyltransf_25 | 0.74 |
PF08814 | XisH | 0.74 |
PF00069 | Pkinase | 0.74 |
PF02335 | Cytochrom_C552 | 0.74 |
PF03400 | DDE_Tnp_IS1 | 0.74 |
PF03928 | HbpS-like | 0.74 |
PF16864 | Dimerisation2 | 0.74 |
PF05685 | Uma2 | 0.74 |
COG ID | Name | Functional Category | % Frequency in 135 Family Scaffolds |
---|---|---|---|
COG2366 | Acyl-homoserine lactone (AHL) acylase PvdQ | Secondary metabolites biosynthesis, transport and catabolism [Q] | 3.70 |
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 2.96 |
COG2079 | 2-methylcitrate dehydratase PrpD | Carbohydrate transport and metabolism [G] | 2.22 |
COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.74 |
COG1662 | Transposase and inactivated derivatives, IS1 family | Mobilome: prophages, transposons [X] | 0.74 |
COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.74 |
COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.74 |
COG2227 | 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase | Coenzyme transport and metabolism [H] | 0.74 |
COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 0.74 |
COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.74 |
COG3303 | Formate-dependent nitrite reductase, periplasmic cytochrome c552 subunit | Inorganic ion transport and metabolism [P] | 0.74 |
COG3464 | Transposase | Mobilome: prophages, transposons [X] | 0.74 |
COG4636 | Endonuclease, Uma2 family (restriction endonuclease fold) | General function prediction only [R] | 0.74 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 77.04 % |
Unclassified | root | N/A | 22.96 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000955|JGI1027J12803_100862381 | Not Available | 686 | Open in IMG/M |
3300003319|soilL2_10110258 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Merismopediaceae → Synechocystis → unclassified Synechocystis → Synechocystis sp. | 1279 | Open in IMG/M |
3300003911|JGI25405J52794_10007579 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2004 | Open in IMG/M |
3300004268|Ga0066398_10230306 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 500 | Open in IMG/M |
3300004798|Ga0058859_11753068 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 1353 | Open in IMG/M |
3300005093|Ga0062594_102495501 | Not Available | 567 | Open in IMG/M |
3300005174|Ga0066680_10431011 | Not Available | 835 | Open in IMG/M |
3300005332|Ga0066388_103129885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 845 | Open in IMG/M |
3300005445|Ga0070708_101354879 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
3300005446|Ga0066686_10983031 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
3300005552|Ga0066701_10082278 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 1848 | Open in IMG/M |
3300005553|Ga0066695_10271432 | All Organisms → cellular organisms → Bacteria | 1071 | Open in IMG/M |
3300005559|Ga0066700_11118688 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
3300005575|Ga0066702_10858356 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 541 | Open in IMG/M |
3300005764|Ga0066903_100149697 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3349 | Open in IMG/M |
3300005764|Ga0066903_100696316 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 1790 | Open in IMG/M |
3300005764|Ga0066903_101483497 | All Organisms → cellular organisms → Bacteria | 1279 | Open in IMG/M |
3300005764|Ga0066903_102341136 | All Organisms → cellular organisms → Bacteria | 1032 | Open in IMG/M |
3300005764|Ga0066903_106604394 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 604 | Open in IMG/M |
3300005836|Ga0074470_11677658 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 580 | Open in IMG/M |
3300005842|Ga0068858_102408627 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
3300006797|Ga0066659_11536229 | Not Available | 558 | Open in IMG/M |
3300006806|Ga0079220_10204194 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1144 | Open in IMG/M |
3300006845|Ga0075421_100312419 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 1908 | Open in IMG/M |
3300006845|Ga0075421_100377678 | All Organisms → cellular organisms → Bacteria | 1707 | Open in IMG/M |
3300006845|Ga0075421_100851234 | All Organisms → cellular organisms → Bacteria | 1045 | Open in IMG/M |
3300006845|Ga0075421_102543544 | Not Available | 532 | Open in IMG/M |
3300006846|Ga0075430_100729489 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 817 | Open in IMG/M |
3300006852|Ga0075433_10132984 | All Organisms → cellular organisms → Bacteria | 2210 | Open in IMG/M |
3300006853|Ga0075420_100961472 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 735 | Open in IMG/M |
3300006880|Ga0075429_100907171 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
3300006880|Ga0075429_101128979 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
3300006969|Ga0075419_11459162 | Not Available | 512 | Open in IMG/M |
3300007255|Ga0099791_10644258 | Not Available | 520 | Open in IMG/M |
3300009081|Ga0105098_10686722 | Not Available | 542 | Open in IMG/M |
3300009090|Ga0099827_10432011 | All Organisms → cellular organisms → Bacteria | 1128 | Open in IMG/M |
3300009090|Ga0099827_10657673 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 905 | Open in IMG/M |
3300009094|Ga0111539_13157218 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
3300009100|Ga0075418_11196029 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
3300009100|Ga0075418_11898960 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
3300009100|Ga0075418_12323437 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
3300009137|Ga0066709_101445931 | All Organisms → cellular organisms → Bacteria | 996 | Open in IMG/M |
3300009137|Ga0066709_104546797 | Not Available | 507 | Open in IMG/M |
3300009146|Ga0105091_10274212 | Not Available | 818 | Open in IMG/M |
3300009147|Ga0114129_10156456 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3116 | Open in IMG/M |
3300009147|Ga0114129_12643314 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
3300009162|Ga0075423_10354636 | All Organisms → cellular organisms → Bacteria | 1538 | Open in IMG/M |
3300009162|Ga0075423_10900997 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
3300009162|Ga0075423_13077246 | Not Available | 511 | Open in IMG/M |
3300009168|Ga0105104_10349940 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 817 | Open in IMG/M |
3300009168|Ga0105104_10621556 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
3300009815|Ga0105070_1050469 | Not Available | 770 | Open in IMG/M |
3300009822|Ga0105066_1138467 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
3300010041|Ga0126312_10149540 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1620 | Open in IMG/M |
3300010043|Ga0126380_11497337 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 597 | Open in IMG/M |
3300010046|Ga0126384_10683590 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
3300010046|Ga0126384_10725139 | Not Available | 883 | Open in IMG/M |
3300010046|Ga0126384_10748537 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
3300010047|Ga0126382_10529810 | All Organisms → cellular organisms → Bacteria | 954 | Open in IMG/M |
3300010047|Ga0126382_11386584 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
3300010047|Ga0126382_12392211 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
3300010047|Ga0126382_12514631 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
3300010361|Ga0126378_13343352 | Not Available | 509 | Open in IMG/M |
3300010362|Ga0126377_11375786 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
3300010376|Ga0126381_103964862 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
3300010391|Ga0136847_11167244 | All Organisms → cellular organisms → Bacteria | 2232 | Open in IMG/M |
3300010398|Ga0126383_11566212 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 748 | Open in IMG/M |
3300011333|Ga0127502_10929703 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 562 | Open in IMG/M |
3300012022|Ga0120191_10082638 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
3300012199|Ga0137383_10849573 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
3300012199|Ga0137383_10899214 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 646 | Open in IMG/M |
3300012201|Ga0137365_10292654 | All Organisms → cellular organisms → Bacteria | 1207 | Open in IMG/M |
3300012201|Ga0137365_11345930 | Not Available | 505 | Open in IMG/M |
3300012202|Ga0137363_10684535 | Not Available | 868 | Open in IMG/M |
3300012206|Ga0137380_11493286 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Stappiaceae → Stappia → unclassified Stappia → Stappia sp. ES.058 | 560 | Open in IMG/M |
3300012208|Ga0137376_11646227 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
3300012353|Ga0137367_10274159 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1210 | Open in IMG/M |
3300012357|Ga0137384_10948282 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
3300012362|Ga0137361_10268130 | All Organisms → cellular organisms → Bacteria | 1558 | Open in IMG/M |
3300012362|Ga0137361_11177926 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 688 | Open in IMG/M |
3300012469|Ga0150984_101869869 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
3300012532|Ga0137373_10619854 | Not Available | 814 | Open in IMG/M |
3300012902|Ga0157291_10129793 | Not Available | 725 | Open in IMG/M |
3300012923|Ga0137359_10154482 | All Organisms → cellular organisms → Bacteria | 2046 | Open in IMG/M |
3300012925|Ga0137419_11319059 | Not Available | 607 | Open in IMG/M |
3300012927|Ga0137416_10140089 | All Organisms → cellular organisms → Bacteria | 1879 | Open in IMG/M |
3300012929|Ga0137404_10342888 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 1306 | Open in IMG/M |
3300012971|Ga0126369_10449293 | All Organisms → cellular organisms → Bacteria | 1338 | Open in IMG/M |
3300012971|Ga0126369_11026590 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 913 | Open in IMG/M |
3300012971|Ga0126369_11198819 | Not Available | 849 | Open in IMG/M |
3300012971|Ga0126369_11917363 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
3300013308|Ga0157375_10330092 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1690 | Open in IMG/M |
3300014154|Ga0134075_10288059 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 714 | Open in IMG/M |
3300017792|Ga0163161_11816244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 542 | Open in IMG/M |
3300018078|Ga0184612_10469151 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
3300018082|Ga0184639_10284562 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 870 | Open in IMG/M |
3300019229|Ga0180116_1320388 | Not Available | 508 | Open in IMG/M |
3300019233|Ga0184645_1146461 | Not Available | 935 | Open in IMG/M |
3300019238|Ga0180112_1357751 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 914 | Open in IMG/M |
3300019254|Ga0184641_1296764 | Not Available | 540 | Open in IMG/M |
3300019257|Ga0180115_1206174 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
3300019259|Ga0184646_1024763 | All Organisms → cellular organisms → Bacteria | 1087 | Open in IMG/M |
3300019279|Ga0184642_1559956 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
3300019360|Ga0187894_10302371 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
3300019789|Ga0137408_1051632 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
3300019789|Ga0137408_1196832 | Not Available | 511 | Open in IMG/M |
3300021307|Ga0179585_1062219 | All Organisms → cellular organisms → Bacteria | 1007 | Open in IMG/M |
3300025149|Ga0209827_11395891 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
3300025961|Ga0207712_10435777 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 1109 | Open in IMG/M |
3300027511|Ga0209843_1023876 | All Organisms → cellular organisms → Bacteria | 1165 | Open in IMG/M |
3300027675|Ga0209077_1243666 | Not Available | 500 | Open in IMG/M |
3300027846|Ga0209180_10333686 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
3300027873|Ga0209814_10300087 | Not Available | 699 | Open in IMG/M |
3300027909|Ga0209382_10249147 | All Organisms → cellular organisms → Bacteria | 2017 | Open in IMG/M |
3300028792|Ga0307504_10405930 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
3300028889|Ga0247827_10915438 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
3300030006|Ga0299907_11176017 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
3300030569|Ga0247628_1221325 | Not Available | 552 | Open in IMG/M |
3300030608|Ga0247651_10131632 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
3300030905|Ga0308200_1082314 | Not Available | 658 | Open in IMG/M |
3300030993|Ga0308190_1134224 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
3300031092|Ga0308204_10157423 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 679 | Open in IMG/M |
3300031096|Ga0308193_1018869 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
3300031421|Ga0308194_10014918 | All Organisms → cellular organisms → Bacteria | 1592 | Open in IMG/M |
3300031880|Ga0318544_10331988 | Not Available | 591 | Open in IMG/M |
3300031901|Ga0307406_11569599 | Not Available | 581 | Open in IMG/M |
3300031903|Ga0307407_11509101 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
3300031946|Ga0310910_11424234 | Not Available | 533 | Open in IMG/M |
3300032005|Ga0307411_11809147 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
3300034663|Ga0314784_002346 | All Organisms → cellular organisms → Bacteria | 2111 | Open in IMG/M |
3300034663|Ga0314784_029126 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
3300034665|Ga0314787_018896 | All Organisms → cellular organisms → Bacteria | 968 | Open in IMG/M |
3300034667|Ga0314792_009295 | All Organisms → cellular organisms → Bacteria | 1610 | Open in IMG/M |
3300034676|Ga0314801_015210 | All Organisms → cellular organisms → Bacteria | 1244 | Open in IMG/M |
3300034681|Ga0370546_074858 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 560 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 17.04% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 15.56% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 11.85% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.67% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.93% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 5.19% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.19% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.44% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 3.70% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 2.22% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.22% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.96% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.48% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.48% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.74% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.74% |
Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 0.74% |
Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.74% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.74% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.74% |
Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.74% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.74% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.74% |
Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.74% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.74% |
Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 0.74% |
Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.74% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.74% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.74% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.74% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.74% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.74% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.74% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300003319 | Sugarcane bulk soil Sample L2 | Environmental | Open in IMG/M |
3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009146 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
3300009815 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10 | Environmental | Open in IMG/M |
3300009822 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 | Environmental | Open in IMG/M |
3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300011333 | Cornfield soil microbial communities from Stanford, California, USA - CI-CA-CRN metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012022 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C6 | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
3300012902 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S169-409C-1 | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
3300019229 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT660_1_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019233 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019238 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT466_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019254 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019257 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT660_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019259 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019279 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019360 | White microbial mat communities from a lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - GBC170108-1 metaG | Environmental | Open in IMG/M |
3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300021307 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_06_16RNAfungal (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025149 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP2 (SPAdes) | Environmental | Open in IMG/M |
3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300027511 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 (SPAdes) | Environmental | Open in IMG/M |
3300027675 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
3300030569 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bnb5 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030608 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Dnb4 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030905 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_204 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030993 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_185 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031092 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031096 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_194 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
3300034663 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034665 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034667 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034676 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034681 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_121 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI1027J12803_1008623812 | 3300000955 | Soil | IWELGALHASGPRVAVSGLGLIPLFAWSGPYEDVQLKS* |
soilL2_101102583 | 3300003319 | Sugarcane Root And Bulk Soil | EARFMPIWENAFLCASGPRVAVSGLHRDSFAYSAPYEDVRLKSS* |
JGI25405J52794_100075793 | 3300003911 | Tabebuia Heterophylla Rhizosphere | LYDEALFMPIWELGFLCASGPRAAVSGLSLIPLFAYSGPYEDVQLKS* |
Ga0066398_102303061 | 3300004268 | Tropical Forest Soil | ERDQHVRRAVLYKIQQKLYDEVRFIPIWELGVLHASGPRVAVSGVGLIPLLLFSGPLEDVQLKS* |
Ga0058859_117530681 | 3300004798 | Host-Associated | KIQQNLYDEALFVPIWELGFLCASGPRAAVSGLSLIPLFAYSGPYEDVQLKS* |
Ga0062594_1024955012 | 3300005093 | Soil | IQQKAYDEVRFMPMWEPILPSASGPRVAVSGLNVKSFVYSAPYEDVQLSM* |
Ga0066680_104310113 | 3300005174 | Soil | RFIPIWELGGLHASGPRVAVSGVGLIPLFAWSGPYEDVQLKS* |
Ga0066388_1031298852 | 3300005332 | Tropical Forest Soil | QKRQALLYKIQQKAYDEALFMPIWENAFLCASGPRVAVSGLRSGLLVYSAPYEDVRLKSS |
Ga0070708_1013548791 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | YDEVRFIPIWELGGLHASGPRVAVSGVGLIPLFAFSGPYEDVQLKS* |
Ga0066686_109830311 | 3300005446 | Soil | LYDEVRFLPIWDLGGLHASGPRVAVSGVGLIPMYAFSGPYEDVQLKA* |
Ga0066701_100822782 | 3300005552 | Soil | MQQKLYDEALFINIWELGFLCASGPRAAVSGLGMIPLFAYSGPYEDVQLKT* |
Ga0066695_102714321 | 3300005553 | Soil | GFLCASGPRAAVSGLSMIPLFAYSGPYEDVQLKS* |
Ga0066700_111186881 | 3300005559 | Soil | PIWDLGGLSASGPRVAVSGLGLIPLYAFSGPYEDVQLKS* |
Ga0066702_108583561 | 3300005575 | Soil | WQLGFLCVTGPRVAVSGLGLIPDYIYSAPYEEVRLKA* |
Ga0066903_1001496971 | 3300005764 | Tropical Forest Soil | RLYDEARFIPIWEQGVLHASGPRVAVSGLGLVPLLLFSGPLEDVQLKP* |
Ga0066903_1006963161 | 3300005764 | Tropical Forest Soil | LFVPLWELGFLCASGPRAAVSGLSLIPLFAYSGPYEDVQLKS* |
Ga0066903_1014834971 | 3300005764 | Tropical Forest Soil | AFLCASGPRVAVSGLHRDSFAYSAPYEDVQLKSA* |
Ga0066903_1023411361 | 3300005764 | Tropical Forest Soil | KIQQKLYDEARFMTIWDHGFLCASGPRAAVSGLSLIPLFSYSGPYEDVQLKS* |
Ga0066903_1066043941 | 3300005764 | Tropical Forest Soil | WQLGFLCVTGPRVAVSGLGLIPDYIYSAPYEDVRLQA* |
Ga0074470_116776582 | 3300005836 | Sediment (Intertidal) | VLSKIQQKLHDEALLIPMWELGFLCASGPRAAISGLSRIPLFAYSGPYEEVQLKS* |
Ga0068858_1024086271 | 3300005842 | Switchgrass Rhizosphere | DEVRVLPIWEQGVLNASGPRVAVSGVGLIPLFLFSGPYEDVQVKS* |
Ga0066659_115362291 | 3300006797 | Soil | LYEEVRFLTIWEFTTLCASGPRVAVSGLGLIPLCSYSSPYEDVQLKS* |
Ga0079220_102041942 | 3300006806 | Agricultural Soil | ELGVLHASGPRVAVSGLGLIPLLLFSGPLEDVQLRS* |
Ga0075421_1003124191 | 3300006845 | Populus Rhizosphere | WQLGFLCVTGPRVAVSGLGLIPDYIYSAPYEDVQVKA* |
Ga0075421_1003776783 | 3300006845 | Populus Rhizosphere | IQQKVYDEAYVAPFWELGFLCASGPRAAVSGLGLIPLFAYSAPLEEVRLKS* |
Ga0075421_1008512342 | 3300006845 | Populus Rhizosphere | QKRLATLQNIQQKLYEEARLMPIWELGFLCASGPRVAISGLGQIPLFAYSGPYEDVQVKS |
Ga0075421_1025435441 | 3300006845 | Populus Rhizosphere | QQKLYDEVRFLPIWELGALHASGPRVGVSGLGLIPLFAWSGPYEDVQLKS* |
Ga0075430_1007294891 | 3300006846 | Populus Rhizosphere | MEVRFILIWDLGALHASGPRVAVSGVGLIPLFAWSGPYEDVQLKS* |
Ga0075433_101329841 | 3300006852 | Populus Rhizosphere | GFLCVTGPRVAVSGLGLIPDYIYSAPYEDVQVKA* |
Ga0075420_1009614722 | 3300006853 | Populus Rhizosphere | HTHRRALLYQIQQKLYDEARFLPIWEGGVLHASGPRVAVSGLGLIPMFHFSGPLEAVQVKS* |
Ga0075429_1009071712 | 3300006880 | Populus Rhizosphere | KLYEEARFMPIWELGFLCASGPRVAISGLGQIPLFAYSGPYEDVQVKS* |
Ga0075429_1011289791 | 3300006880 | Populus Rhizosphere | PIWEQGVLNASGPRVAVSGVGLIPLFLFSGPYEDVQVKL* |
Ga0075419_114591621 | 3300006969 | Populus Rhizosphere | KAYDEALFMPIWENAFLCASGPRVAVSGLQGDSFAYSAPYEDVRLTSS* |
Ga0099791_106442581 | 3300007255 | Vadose Zone Soil | PILNASGPRVAVSGLGLIPLHGFSAPYEDVQLKP* |
Ga0105098_106867221 | 3300009081 | Freshwater Sediment | QKVYDEARLMPIWENAFLCVSGPRVAVSGLHADSFAYSAPYEDVRLKSS* |
Ga0099827_104320112 | 3300009090 | Vadose Zone Soil | MPVWENAFLCASGPRVAVSGLRSGLLVYSAPYEDVRLKSS* |
Ga0099827_106576731 | 3300009090 | Vadose Zone Soil | EARFMPIWEHCFLCASGPRAAVSGLSLIPLFAYSGPYEDVQVKS* |
Ga0111539_131572182 | 3300009094 | Populus Rhizosphere | ITIWQLGFLCASGPRAAVSGLGLIPLFAYSGPYEDLQLKA* |
Ga0075418_111960292 | 3300009100 | Populus Rhizosphere | YDEALFMPIWENAFLCASGPRVAVSGLRSGLLVYSAPYEDVQLKSS* |
Ga0075418_118989602 | 3300009100 | Populus Rhizosphere | WELGFLCASGPRAAVSGLSLIPLFAYSGPYEDVQVKS* |
Ga0075418_123234372 | 3300009100 | Populus Rhizosphere | QQKLYDEVRFLPIWELGALHASGPRVAVSGLGLIPLFAWSGPYEDVQLKS* |
Ga0066709_1014459312 | 3300009137 | Grasslands Soil | GFLCVTGPRVAVSGLGLIPDYIYSAPYEDVRLKA* |
Ga0066709_1045467972 | 3300009137 | Grasslands Soil | KGLLQKSHQIAYDDARFLPIWCNGFLCSSGPRVAVSGLHRDSFAYSGPYEGVQLKSA* |
Ga0105091_102742121 | 3300009146 | Freshwater Sediment | KVYDEARLMPIWENAFLCVSGPRVAVSGLHADSFAYSAPYEDVRLKSS* |
Ga0114129_101564562 | 3300009147 | Populus Rhizosphere | MPIWENAFLCASGPRVAVSGLRSGLLVYSAPYEDVQLKTS* |
Ga0114129_126433142 | 3300009147 | Populus Rhizosphere | AMFLSMWELGFLCASGPRAAVSGLSLIPLFAYSGPYEDVQLKS* |
Ga0075423_103546362 | 3300009162 | Populus Rhizosphere | QLGFLCVTGPRVAVSGLGLIPDYIYSAPYEDVRLKA* |
Ga0075423_109009972 | 3300009162 | Populus Rhizosphere | DEARFIPMWELGFLSASGPRVAVSGIGLIRLHLYSAPFEDVQLKS* |
Ga0075423_130772462 | 3300009162 | Populus Rhizosphere | KLYDEVRFLPIWELGALHASGPRVGVSGLGLIPLFAWSGPYEDVQLKS* |
Ga0105104_103499401 | 3300009168 | Freshwater Sediment | GGVLHASGPRVVVSGLGLIPMFHFSGPLEAVQVKS* |
Ga0105104_106215561 | 3300009168 | Freshwater Sediment | KLYDEARFIPIWELGFLCASGPRAAVSGMGVIPTFAYSGPYEDVQLKS* |
Ga0105070_10504692 | 3300009815 | Groundwater Sand | FTVLHASGPRVAVSGLGLIPLFAFSGPYEDVQLKS* |
Ga0105066_11384671 | 3300009822 | Groundwater Sand | RQDLLYKIQQKLYDEARFMPIWEHCFLCASGPRAAVSGLSLIPLFAYSGPYEDVQVKS* |
Ga0126312_101495401 | 3300010041 | Serpentine Soil | KIQQKVYDEALFIPIFELGFLCASGPRMAVSGLGLIPAYIYSGPFEEVRLKG* |
Ga0126380_114973371 | 3300010043 | Tropical Forest Soil | LHKIQRKVYDESLFIPIFELGFLCATGPRVAVSGLGLIPAYIYSGPFEEVRLKG* |
Ga0126384_106835901 | 3300010046 | Tropical Forest Soil | ELGFLCASGPRATVSGLSLIPLFAYSGPYEDVQLKS* |
Ga0126384_107251391 | 3300010046 | Tropical Forest Soil | EVRFIPIWELGGLHASGPRVAVSGVGLIPLFAFSGPYEDVQLKS* |
Ga0126384_107485371 | 3300010046 | Tropical Forest Soil | RDHRVRQAVLYQIQQKLYDEVRFIPIWELGVLHASGPRVAVSGLGLIPQLLFSGPLEDVQLKS* |
Ga0126382_105298101 | 3300010047 | Tropical Forest Soil | QALLYKIQQKAYDEALFMPIWENAFLCASGPRVAVSGLRSGLLVYSAPYEDAQLKTS* |
Ga0126382_113865841 | 3300010047 | Tropical Forest Soil | IWELGFLCASGPRAAVSGLGMIPLFAYSGPYEDVQLKS* |
Ga0126382_123922111 | 3300010047 | Tropical Forest Soil | LEAPILTASGPRVAVSGLGLIPSMAFPAPYEDVQLKP* |
Ga0126382_125146311 | 3300010047 | Tropical Forest Soil | KIQQKVYDEAYFIPLWELGFLCASGPRVAVSGLGIIPLHVYSGPYEEIQLKS* |
Ga0126378_133433521 | 3300010361 | Tropical Forest Soil | SFLCASGPRVAVSGLSLIPLFAYSGPYEEVRLKS* |
Ga0126377_113757862 | 3300010362 | Tropical Forest Soil | RKKREELLYKIQQKVYDEAYFMPLWELGFLCASGPRVAVSGLGLIPLFAYSGPYEDVQLK |
Ga0126381_1039648621 | 3300010376 | Tropical Forest Soil | KAYDDARFMPIWESAFLCASGPRVAVSGLHRDSFAYSAPYEDVQLKSS* |
Ga0136847_111672445 | 3300010391 | Freshwater Sediment | WEHCFLCASGPRAAVSGLSLIPLFAYSGPYEDVQVKS* |
Ga0126383_115662121 | 3300010398 | Tropical Forest Soil | LYDEGRFLPLLETTNLNASGPRVAVSGLGMIPSLFFSAPYEDVQLKP* |
Ga0127502_109297032 | 3300011333 | Soil | GFLCASGPRAAVSGLGLIPLFAYSAPLEEVRLKS* |
Ga0120191_100826382 | 3300012022 | Terrestrial | LYDEVRFIPIWDLGGLHASGPRVAVSGIGLIPLFAFSGPYEDVQLKS* |
Ga0137383_108495732 | 3300012199 | Vadose Zone Soil | LYDEVCFIPIWDLGGLSASGPRVAVSGLGLIPLYAFSGPYEDVQLKS* |
Ga0137383_108992142 | 3300012199 | Vadose Zone Soil | MQQKLYDEALFINIWELGFLCASGPRAAVSGLGLIPLFAYSGPYEDVQLKT* |
Ga0137365_102926541 | 3300012201 | Vadose Zone Soil | LGGLHASGPRVAVSGVGLIPLFAWSGPYEDVQLKS* |
Ga0137365_113459302 | 3300012201 | Vadose Zone Soil | QQKLYDEARFIPIWELSFLCASGPRVAVSGLSLIPLFAYSGPYEEVRLKS* |
Ga0137363_106845352 | 3300012202 | Vadose Zone Soil | AFLCATGPRVAVSGLGLIPGYIYSAPYEEVRLRS* |
Ga0137380_114932861 | 3300012206 | Vadose Zone Soil | KIQQKLYDEARFMPIWEHCFLCASGPRAVVSGLSLIPLFAYSGPYEDVQVKS* |
Ga0137376_116462271 | 3300012208 | Vadose Zone Soil | AFICASGPRVAVSGLGMIPQFAYSGPYEDLRLKNP* |
Ga0137367_102741591 | 3300012353 | Vadose Zone Soil | IQQKAYDEARFMPIWESAFLCASGPRVAVSGLHRDSFAYSAPYEDVQLKSS* |
Ga0137384_109482821 | 3300012357 | Vadose Zone Soil | AVLYKIQQRLYDEARFIPIWELGVLHASGPRVAVSGLGLIPLLLFSGPLEDVQLKS* |
Ga0137361_102681302 | 3300012362 | Vadose Zone Soil | PIWELGFLCASGPRAAVSGLSLIPLFAYSGPYEDVQLKS* |
Ga0137361_111779261 | 3300012362 | Vadose Zone Soil | IQQKLYDEALFINIWELGFLCASGPRAAVSGLGMIPLFAYSGPYEDVQLKT* |
Ga0150984_1018698692 | 3300012469 | Avena Fatua Rhizosphere | WELGFLCASGPRAAVSGLSLIPLFAYSGPYEEVQLKS* |
Ga0137373_106198543 | 3300012532 | Vadose Zone Soil | IWELSFLCASGPRVAVSGLSLIPLFAYSGPYEEVRLKS* |
Ga0157291_101297931 | 3300012902 | Soil | FIPIWENAFLCASGPRVAVSGLHGDSFAYSAPYEDVQLKSS* |
Ga0137359_101544823 | 3300012923 | Vadose Zone Soil | FMPIWELGFLCASGPRVAVSGVGLIKLHSYSAPFEDVQLKS* |
Ga0137419_113190591 | 3300012925 | Vadose Zone Soil | ELGALHASGPRVAVSGLGLIPMLLFSGPLEDVRLKS* |
Ga0137416_101400891 | 3300012927 | Vadose Zone Soil | VLYKIQQKLYDEARFIPIWELGALHASGPSVAVSGLGLIPMLLFSGPLEDVRLKS* |
Ga0137404_103428881 | 3300012929 | Vadose Zone Soil | LGALHASGPRVAVSGVGLIPLFAFSGPYEDVQLKA* |
Ga0126369_104492931 | 3300012971 | Tropical Forest Soil | IWELGFLSASGPRVAVSGIGLIRLHLYSAPFEDVQLKS* |
Ga0126369_110265902 | 3300012971 | Tropical Forest Soil | IWELGGLHASGPRVAVSGVGLIPLYAFSGPYEDVQLKS* |
Ga0126369_111988191 | 3300012971 | Tropical Forest Soil | KAYDDARFLPIWESAFLCASGPRVAVSGLHKDSFAYSAPYEDVQLQSS* |
Ga0126369_119173632 | 3300012971 | Tropical Forest Soil | QKLYDEAMFMSIWELGFLCASGPRAAVSGLGMIPLFAYSGPYEDVQLKS* |
Ga0157375_103300921 | 3300013308 | Miscanthus Rhizosphere | QELLSKIQQKAYDEVRFMPMWEPILPSASGPRVAVSGLNVKSFVYSAPYEDVQLSM* |
Ga0134075_102880592 | 3300014154 | Grasslands Soil | LPIWDLGGLHASGPRVAVSGVGLIPLFAFSGPYEDVQLKA* |
Ga0163161_118162441 | 3300017792 | Switchgrass Rhizosphere | KLYDEAMFIPIWELGFLCASGPRAAVSGLSLIPSFAYSGPYEDVQLKS |
Ga0184612_104691511 | 3300018078 | Groundwater Sediment | PLFDPAFICASGPRVASSGLGQIPQFAYSGPYEDLQLKKA |
Ga0184639_102845623 | 3300018082 | Groundwater Sediment | DDARFMPIWELSFLCASGPRAAVSGLSLIPLFAYSGPYEDVQLKS |
Ga0180116_13203881 | 3300019229 | Groundwater Sediment | DEARFIPIWELGFLSASGPRVAVSGIGLIRLHIYSAPFEDVQLKS |
Ga0184645_11464612 | 3300019233 | Groundwater Sediment | WEFTVLHASGPRVAVSGLGLIPLFAFSGPYEDVQLKS |
Ga0180112_13577511 | 3300019238 | Groundwater Sediment | KRQNLLYKIQQKLYDEARFMPIWEHCFLCASGPRATVSGLSLIPLFAYSGPYEDVQLKS |
Ga0184641_12967641 | 3300019254 | Groundwater Sediment | QQKAHDEALFMPIWENAFLCASGPRVAVSGLRSGLLVYSAPYEDVRLKSS |
Ga0180115_12061741 | 3300019257 | Groundwater Sediment | ELGFLSASGPRVAVSGIGLIRLHIYSAPFEDVQLKS |
Ga0184646_10247631 | 3300019259 | Groundwater Sediment | QKLYDEARFMPIWEHCFLCASGPRAAVSGLSLIPLFAYSGPYEDVQVKS |
Ga0184642_15599562 | 3300019279 | Groundwater Sediment | PSALILGNAVQKLYDDACFLLIWELGFLYASGPRVVVPGVGLVKVYSYSVPCEDVQLKS |
Ga0187894_103023711 | 3300019360 | Microbial Mat On Rocks | KLYDEARFMTIWEHCFLCASGPRAAVSGLNLIPLFAYSGPYEEVRLKS |
Ga0137408_10516322 | 3300019789 | Vadose Zone Soil | EARVIPIWELSFLCASGPRAAVSGLSMIPLFAYSGPYEDVQLRP |
Ga0137408_11968322 | 3300019789 | Vadose Zone Soil | QVLLHKMQQKLYDEARFLPIWELGFLSASGPRVAVSGIGLIRLHIYSAPFEDVQLKS |
Ga0179585_10622191 | 3300021307 | Vadose Zone Soil | DEARFIPIWELGFLCASGPRAAVSGLSLIPLFAYSGPYEDVQLKS |
Ga0209827_113958911 | 3300025149 | Thermal Springs | FMPIWDRGGLHASGPRVAVSGVGLIPLCAFSGPYEDVRLQS |
Ga0207712_104357772 | 3300025961 | Switchgrass Rhizosphere | HDEARFMPIWENAFLCASGPRVAVSGLHRDSFAYSAPYEDVRLKSS |
Ga0209843_10238761 | 3300027511 | Groundwater Sand | QKLYDEALFAPMWELGFLCASGPRAAVSGLSLIPLYAYSGPYEDVQLKI |
Ga0209077_12436661 | 3300027675 | Freshwater Sediment | KVYDEARLMPIWENAFLCVSGPRVAVSGLHADSFAYSAPYEDVRLKSS |
Ga0209180_103336862 | 3300027846 | Vadose Zone Soil | IWEHGVLHASGPRVAVSGLGLIPLFIFSGPLEDVQLKS |
Ga0209814_103000871 | 3300027873 | Populus Rhizosphere | MPIWENAFLCASGPRVAVSGLRSGLLVYSAPYEDVQLKTS |
Ga0209382_102491471 | 3300027909 | Populus Rhizosphere | SFQPFIPIWDLGGLHASGPRVAVSGLGLIPLFAFSGPLEDVRLKA |
Ga0307504_104059302 | 3300028792 | Soil | ELGFLCASGPRVAVSGLGMIPLHVYSAPYEDVQLKT |
Ga0247827_109154382 | 3300028889 | Soil | QQKLYDEVRFVPIWELGALHASGSRVAVSGVGLIPLFAFSGPYEDVQLKS |
Ga0299907_111760171 | 3300030006 | Soil | WELAFLCASGPRAAVSGMGMIPMFAYSGPYEDLQLKA |
Ga0247628_12213251 | 3300030569 | Soil | MQQQAYDEARSIPIWGLGFLCASGWCVAVSGLHCIKTFAYSAPYEDVQWQSA |
Ga0247651_101316322 | 3300030608 | Soil | MQQQAYDEARSIPIWVLGFLCASGWCVAVSGLHCIKTFAYSAPYEDVQWQSA |
Ga0308200_10823141 | 3300030905 | Soil | QKVYDEVRFMPIWENAFLCASGPRVAVSGLHRDSFAYSAPYEDVRLKSS |
Ga0308190_11342241 | 3300030993 | Soil | PLWELGFLCASGPRAAVSGLSLIPLFAYSGPYEDVQLKS |
Ga0308204_101574232 | 3300031092 | Soil | LFIPIFELGFLCASGPRVAVSGLGLIPAYIYSGPFEEVRLKA |
Ga0308193_10188691 | 3300031096 | Soil | RQKRQALLHKMQQKLYDEARFLPIWELGFLSASGPRVAVSGIGLIRLHIYSAPFEDVQLK |
Ga0308194_100149182 | 3300031421 | Soil | LILGNAVQKLYDDACFLLIWELGFLYASGPRVVVPGVGLVKVYSYSVPCEDVQLKS |
Ga0318544_103319882 | 3300031880 | Soil | IWESAFLCASGPRVAVSGLHKDSFAYSAPYEDVQLKSS |
Ga0307406_115695992 | 3300031901 | Rhizosphere | EAYFAPFWELGFLCASGPRAAVSGLGLIPLFAYSAPLEEVRLKS |
Ga0307407_115091012 | 3300031903 | Rhizosphere | MSENSVTEARFIPIWELGFLCASGPRAAVSGMGLIPTFAYSGPYEDVQLKS |
Ga0310910_114242341 | 3300031946 | Soil | SAFLCASGPRVAVSGLHKDSFAYSAPYEDVQLKSS |
Ga0307411_118091472 | 3300032005 | Rhizosphere | QGLLRKIQQKVYDQAYFIPIWELSFLCASGPRVAVSGLGLIPLFAYSGPYEDVQLKS |
Ga0314784_002346_1998_2111 | 3300034663 | Soil | WELGFLCASGPRAAVSGLSMIPLFAYSGPYEDVQLKS |
Ga0314784_029126_3_113 | 3300034663 | Soil | ELGFLCAAGPRAAVSGLSLIPLFAYSGPYEDVQLKS |
Ga0314787_018896_2_169 | 3300034665 | Soil | LLYKIQQKAYDEALFMPIWENAFLCASGPRVAVSGLRSGLLVYSAPYEDVQLKSS |
Ga0314792_009295_3_119 | 3300034667 | Soil | IWELGFLCASGPRAAVSGLSMIPLFAYSGPYEDVQLKS |
Ga0314801_015210_1104_1244 | 3300034676 | Soil | YDEARFIPIWELGFLCASGPRAAVSGLSMIPLFAYSGPYEDVQLKS |
Ga0370546_074858_1_153 | 3300034681 | Soil | QQKLYDEVRFLPIWEQGVLNASGPRVAVSGVGLIPLFLFSGPYEDVQVKA |
⦗Top⦘ |