


| Basic Information | |
|---|---|
| Family ID | F057946 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 135 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MLRRTGQWQGNRTPDNQAANKLVDAGGIWFEDVGSTPTASINI |
| Number of Associated Samples | 73 |
| Number of Associated Scaffolds | 135 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 28.15 % |
| % of genes near scaffold ends (potentially truncated) | 87.41 % |
| % of genes from short scaffolds (< 2000 bps) | 69.63 % |
| Associated GOLD sequencing projects | 63 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (70.370 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (30.370 % of family members) |
| Environment Ontology (ENVO) | Unclassified (84.444 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (96.296 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 18.60% β-sheet: 4.65% Coil/Unstructured: 76.74% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 135 Family Scaffolds |
|---|---|---|
| PF04255 | DUF433 | 8.89 |
| PF01177 | Asp_Glu_race | 5.19 |
| PF10509 | GalKase_gal_bdg | 3.70 |
| PF07642 | BBP2 | 2.96 |
| PF05336 | rhaM | 2.96 |
| PF04505 | CD225 | 2.96 |
| PF08544 | GHMP_kinases_C | 2.22 |
| PF01070 | FMN_dh | 2.22 |
| PF09835 | DUF2062 | 1.48 |
| PF00155 | Aminotran_1_2 | 1.48 |
| PF13377 | Peripla_BP_3 | 1.48 |
| PF06134 | RhaA | 1.48 |
| PF02952 | Fucose_iso_C | 0.74 |
| PF03320 | FBPase_glpX | 0.74 |
| PF00092 | VWA | 0.74 |
| PF13020 | NOV_C | 0.74 |
| PF13768 | VWA_3 | 0.74 |
| PF09976 | TPR_21 | 0.74 |
| PF00830 | Ribosomal_L28 | 0.74 |
| PF05656 | DUF805 | 0.74 |
| PF14315 | DUF4380 | 0.74 |
| PF02784 | Orn_Arg_deC_N | 0.74 |
| PF00691 | OmpA | 0.74 |
| PF02569 | Pantoate_ligase | 0.74 |
| PF16403 | DUF5011 | 0.74 |
| PF07963 | N_methyl | 0.74 |
| PF02577 | BFN_dom | 0.74 |
| PF01791 | DeoC | 0.74 |
| COG ID | Name | Functional Category | % Frequency in 135 Family Scaffolds |
|---|---|---|---|
| COG2442 | Predicted antitoxin component of a toxin-antitoxin system, DUF433 family | Defense mechanisms [V] | 8.89 |
| COG3254 | L-rhamnose mutarotase | Cell wall/membrane/envelope biogenesis [M] | 2.96 |
| COG0069 | Glutamate synthase domain 2 | Amino acid transport and metabolism [E] | 2.22 |
| COG1304 | FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomerase | Energy production and conversion [C] | 2.22 |
| COG4806 | L-rhamnose isomerase | Carbohydrate transport and metabolism [G] | 1.48 |
| COG0019 | Diaminopimelate decarboxylase | Amino acid transport and metabolism [E] | 0.74 |
| COG0227 | Ribosomal protein L28 | Translation, ribosomal structure and biogenesis [J] | 0.74 |
| COG0414 | Panthothenate synthetase | Coenzyme transport and metabolism [H] | 0.74 |
| COG1166 | Arginine decarboxylase (spermidine biosynthesis) | Amino acid transport and metabolism [E] | 0.74 |
| COG1259 | Bifunctional DNase/RNase | General function prediction only [R] | 0.74 |
| COG1494 | Fructose-1,6-bisphosphatase/sedoheptulose 1,7-bisphosphatase or related protein | Carbohydrate transport and metabolism [G] | 0.74 |
| COG2407 | L-fucose isomerase or related protein | Carbohydrate transport and metabolism [G] | 0.74 |
| COG3152 | Uncharacterized membrane protein YhaH, DUF805 family | Function unknown [S] | 0.74 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 70.37 % |
| Unclassified | root | N/A | 29.63 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000736|JGI12547J11936_1032195 | All Organisms → cellular organisms → Bacteria | 1162 | Open in IMG/M |
| 3300000736|JGI12547J11936_1045070 | Not Available | 916 | Open in IMG/M |
| 3300000736|JGI12547J11936_1045806 | Not Available | 906 | Open in IMG/M |
| 3300000736|JGI12547J11936_1050977 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 6 | 840 | Open in IMG/M |
| 3300002835|B570J40625_100208178 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales | 2106 | Open in IMG/M |
| 3300003395|JGI25917J50250_1002674 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 4911 | Open in IMG/M |
| 3300003490|JGI25926J51410_1017890 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 6 | 1409 | Open in IMG/M |
| 3300003491|JGI25924J51412_1007563 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 6 | 2079 | Open in IMG/M |
| 3300005517|Ga0070374_10062448 | All Organisms → cellular organisms → Bacteria | 1940 | Open in IMG/M |
| 3300005517|Ga0070374_10678337 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 6 | 509 | Open in IMG/M |
| 3300006862|Ga0079299_1009646 | All Organisms → cellular organisms → Bacteria | 2222 | Open in IMG/M |
| 3300007162|Ga0079300_10022078 | All Organisms → cellular organisms → Bacteria | 2256 | Open in IMG/M |
| 3300008055|Ga0108970_11180153 | Not Available | 809 | Open in IMG/M |
| 3300008108|Ga0114341_10004070 | All Organisms → cellular organisms → Bacteria | 19405 | Open in IMG/M |
| 3300008117|Ga0114351_1349825 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 6 | 664 | Open in IMG/M |
| 3300009068|Ga0114973_10113457 | Not Available | 1530 | Open in IMG/M |
| 3300009068|Ga0114973_10226498 | All Organisms → cellular organisms → Bacteria | 1014 | Open in IMG/M |
| 3300009151|Ga0114962_10009283 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 7333 | Open in IMG/M |
| 3300009154|Ga0114963_10641000 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300009155|Ga0114968_10011553 | All Organisms → cellular organisms → Bacteria | 6322 | Open in IMG/M |
| 3300009155|Ga0114968_10038145 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 6 | 3167 | Open in IMG/M |
| 3300009155|Ga0114968_10464413 | Not Available | 683 | Open in IMG/M |
| 3300009158|Ga0114977_10011518 | All Organisms → cellular organisms → Bacteria | 5607 | Open in IMG/M |
| 3300009161|Ga0114966_10312569 | Not Available | 946 | Open in IMG/M |
| 3300009161|Ga0114966_10312854 | Not Available | 946 | Open in IMG/M |
| 3300009180|Ga0114979_10219388 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 1147 | Open in IMG/M |
| 3300009180|Ga0114979_10833028 | Not Available | 516 | Open in IMG/M |
| 3300009184|Ga0114976_10156398 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 6 | 1274 | Open in IMG/M |
| 3300009184|Ga0114976_10184349 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 1156 | Open in IMG/M |
| 3300009185|Ga0114971_10061915 | All Organisms → cellular organisms → Bacteria | 2332 | Open in IMG/M |
| 3300009185|Ga0114971_10339460 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 6 | 862 | Open in IMG/M |
| 3300009185|Ga0114971_10388719 | Not Available | 793 | Open in IMG/M |
| 3300009185|Ga0114971_10783796 | Not Available | 517 | Open in IMG/M |
| 3300009187|Ga0114972_10408413 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales | 781 | Open in IMG/M |
| 3300009187|Ga0114972_10441943 | Not Available | 744 | Open in IMG/M |
| 3300010157|Ga0114964_10334197 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 6 | 717 | Open in IMG/M |
| 3300010160|Ga0114967_10237584 | Not Available | 961 | Open in IMG/M |
| 3300010160|Ga0114967_10244698 | All Organisms → cellular organisms → Bacteria | 943 | Open in IMG/M |
| 3300010160|Ga0114967_10498278 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 6 | 595 | Open in IMG/M |
| 3300010334|Ga0136644_10279534 | Not Available | 972 | Open in IMG/M |
| 3300010334|Ga0136644_10707534 | Not Available | 547 | Open in IMG/M |
| 3300010885|Ga0133913_11989597 | Not Available | 1444 | Open in IMG/M |
| 3300010885|Ga0133913_12286533 | Not Available | 1328 | Open in IMG/M |
| 3300010885|Ga0133913_12894499 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1151 | Open in IMG/M |
| 3300010885|Ga0133913_13148368 | Not Available | 1093 | Open in IMG/M |
| 3300010885|Ga0133913_13368867 | Not Available | 1048 | Open in IMG/M |
| 3300011115|Ga0151514_10753 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales | 13519 | Open in IMG/M |
| 3300012000|Ga0119951_1026481 | All Organisms → cellular organisms → Bacteria | 1965 | Open in IMG/M |
| 3300013006|Ga0164294_10110384 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae | 2028 | Open in IMG/M |
| 3300013006|Ga0164294_10119638 | Not Available | 1933 | Open in IMG/M |
| 3300013006|Ga0164294_10390894 | Not Available | 954 | Open in IMG/M |
| 3300013006|Ga0164294_10605920 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 6 | 742 | Open in IMG/M |
| 3300013006|Ga0164294_10606812 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 742 | Open in IMG/M |
| 3300013006|Ga0164294_10631040 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 6 → Verrucomicrobia subdivision 6 bacterium | 725 | Open in IMG/M |
| 3300013006|Ga0164294_10678565 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 6 | 696 | Open in IMG/M |
| 3300013006|Ga0164294_10814306 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales | 629 | Open in IMG/M |
| 3300013006|Ga0164294_11143482 | Not Available | 522 | Open in IMG/M |
| 3300013014|Ga0164295_10039575 | Not Available | 3566 | Open in IMG/M |
| 3300013014|Ga0164295_10109891 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae | 2046 | Open in IMG/M |
| 3300013014|Ga0164295_10773599 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 742 | Open in IMG/M |
| 3300013014|Ga0164295_11134796 | Not Available | 607 | Open in IMG/M |
| 3300014050|Ga0119952_1000613 | All Organisms → cellular organisms → Bacteria | 22983 | Open in IMG/M |
| 3300018790|Ga0187842_1022584 | All Organisms → cellular organisms → Bacteria | 2078 | Open in IMG/M |
| 3300018790|Ga0187842_1090960 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
| 3300018790|Ga0187842_1116541 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 804 | Open in IMG/M |
| 3300018790|Ga0187842_1226586 | Not Available | 543 | Open in IMG/M |
| 3300018868|Ga0187844_10061547 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1752 | Open in IMG/M |
| 3300018868|Ga0187844_10106313 | Not Available | 1262 | Open in IMG/M |
| 3300018868|Ga0187844_10175532 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae | 930 | Open in IMG/M |
| 3300019093|Ga0187843_10079003 | Not Available | 1512 | Open in IMG/M |
| 3300019093|Ga0187843_10330425 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300020084|Ga0194110_10435300 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
| 3300020161|Ga0211726_10518043 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 6 | 561 | Open in IMG/M |
| 3300020179|Ga0194134_10038456 | All Organisms → cellular organisms → Bacteria | 2792 | Open in IMG/M |
| 3300020183|Ga0194115_10027923 | All Organisms → cellular organisms → Bacteria | 4095 | Open in IMG/M |
| 3300020190|Ga0194118_10016553 | All Organisms → cellular organisms → Bacteria | 5868 | Open in IMG/M |
| 3300020196|Ga0194124_10201659 | All Organisms → cellular organisms → Bacteria | 1024 | Open in IMG/M |
| 3300020578|Ga0194129_10074874 | All Organisms → cellular organisms → Bacteria | 2414 | Open in IMG/M |
| 3300021424|Ga0194117_10179272 | All Organisms → cellular organisms → Bacteria | 1060 | Open in IMG/M |
| 3300021519|Ga0194048_10090939 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 6 | 1183 | Open in IMG/M |
| 3300022748|Ga0228702_1089742 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 6 | 740 | Open in IMG/M |
| 3300022752|Ga0214917_10002121 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 24679 | Open in IMG/M |
| 3300022752|Ga0214917_10018425 | All Organisms → cellular organisms → Bacteria | 5864 | Open in IMG/M |
| 3300022752|Ga0214917_10141190 | Not Available | 1294 | Open in IMG/M |
| 3300023174|Ga0214921_10017362 | All Organisms → cellular organisms → Bacteria | 7994 | Open in IMG/M |
| 3300023174|Ga0214921_10033812 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales | 4921 | Open in IMG/M |
| 3300023174|Ga0214921_10098674 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 6 | 2205 | Open in IMG/M |
| 3300023174|Ga0214921_10260138 | Not Available | 1007 | Open in IMG/M |
| 3300023174|Ga0214921_10359842 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 6 | 768 | Open in IMG/M |
| 3300023174|Ga0214921_10464607 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 6 | 617 | Open in IMG/M |
| 3300023179|Ga0214923_10000166 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 101047 | Open in IMG/M |
| 3300023179|Ga0214923_10104982 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 6 | 1892 | Open in IMG/M |
| 3300023179|Ga0214923_10157736 | Not Available | 1406 | Open in IMG/M |
| 3300023179|Ga0214923_10178376 | All Organisms → cellular organisms → Bacteria | 1283 | Open in IMG/M |
| 3300023184|Ga0214919_10007239 | All Organisms → cellular organisms → Bacteria | 15018 | Open in IMG/M |
| 3300023184|Ga0214919_10051874 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 6 | 3912 | Open in IMG/M |
| 3300023184|Ga0214919_10353572 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 6 | 978 | Open in IMG/M |
| 3300024861|Ga0256312_1034868 | All Organisms → cellular organisms → Bacteria | 1065 | Open in IMG/M |
| 3300027563|Ga0209552_1006760 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 6 | 3639 | Open in IMG/M |
| 3300027581|Ga0209651_1010926 | All Organisms → cellular organisms → Bacteria | 2966 | Open in IMG/M |
| 3300027581|Ga0209651_1067314 | All Organisms → cellular organisms → Bacteria | 1041 | Open in IMG/M |
| 3300027586|Ga0208966_1144248 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 6 | 633 | Open in IMG/M |
| 3300027621|Ga0208951_1036581 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 6 | 1478 | Open in IMG/M |
| 3300027621|Ga0208951_1075340 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 6 | 948 | Open in IMG/M |
| 3300027642|Ga0209135_1043964 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 6 | 1581 | Open in IMG/M |
| 3300027642|Ga0209135_1129782 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 6 | 825 | Open in IMG/M |
| 3300027642|Ga0209135_1165097 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 6 → Verrucomicrobia subdivision 6 bacterium | 703 | Open in IMG/M |
| 3300027644|Ga0209356_1017256 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 6 | 2470 | Open in IMG/M |
| 3300027644|Ga0209356_1047778 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales | 1346 | Open in IMG/M |
| 3300027644|Ga0209356_1211171 | Not Available | 520 | Open in IMG/M |
| 3300027656|Ga0209357_1014234 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2882 | Open in IMG/M |
| 3300027697|Ga0209033_1211254 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 6 | 576 | Open in IMG/M |
| 3300027707|Ga0209443_1222656 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 6 | 654 | Open in IMG/M |
| 3300027720|Ga0209617_10054783 | All Organisms → cellular organisms → Bacteria | 1668 | Open in IMG/M |
| 3300027720|Ga0209617_10057868 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 6 | 1617 | Open in IMG/M |
| 3300027720|Ga0209617_10143431 | Not Available | 943 | Open in IMG/M |
| 3300027720|Ga0209617_10378178 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 6 | 519 | Open in IMG/M |
| (restricted) 3300027730|Ga0247833_1019569 | Not Available | 5106 | Open in IMG/M |
| 3300027733|Ga0209297_1010428 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 4550 | Open in IMG/M |
| 3300027746|Ga0209597_1215296 | Not Available | 778 | Open in IMG/M |
| 3300027756|Ga0209444_10005302 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 6838 | Open in IMG/M |
| 3300027759|Ga0209296_1145664 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 6 | 1071 | Open in IMG/M |
| 3300027760|Ga0209598_10089158 | Not Available | 1476 | Open in IMG/M |
| 3300027760|Ga0209598_10233367 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales | 756 | Open in IMG/M |
| 3300027770|Ga0209086_10056110 | Not Available | 2183 | Open in IMG/M |
| 3300027770|Ga0209086_10190423 | Not Available | 953 | Open in IMG/M |
| 3300027797|Ga0209107_10045223 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 6 | 2494 | Open in IMG/M |
| 3300027892|Ga0209550_10045849 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 3579 | Open in IMG/M |
| 3300027963|Ga0209400_1032768 | Not Available | 2870 | Open in IMG/M |
| 3300027963|Ga0209400_1242182 | Not Available | 720 | Open in IMG/M |
| 3300028394|Ga0304730_1199658 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| (restricted) 3300028553|Ga0247839_1151373 | Not Available | 1009 | Open in IMG/M |
| (restricted) 3300028557|Ga0247832_1064324 | Not Available | 1781 | Open in IMG/M |
| 3300031951|Ga0315904_10080399 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 3492 | Open in IMG/M |
| 3300034272|Ga0335049_0874166 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 30.37% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 24.44% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 14.07% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 9.63% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment | 5.93% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 5.19% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 2.22% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 1.48% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 1.48% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.74% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.74% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.74% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.74% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.74% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.74% |
| Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.74% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000736 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003395 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN | Environmental | Open in IMG/M |
| 3300003490 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN | Environmental | Open in IMG/M |
| 3300003491 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
| 3300006862 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series LW 2014_7_11 | Environmental | Open in IMG/M |
| 3300007162 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series HT 2014_7_11 | Environmental | Open in IMG/M |
| 3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
| 3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
| 3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300009185 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG | Environmental | Open in IMG/M |
| 3300009187 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG | Environmental | Open in IMG/M |
| 3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
| 3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
| 3300010334 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011115 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2016May | Environmental | Open in IMG/M |
| 3300012000 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007A | Environmental | Open in IMG/M |
| 3300013006 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG | Environmental | Open in IMG/M |
| 3300013014 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES006 metaG | Environmental | Open in IMG/M |
| 3300014050 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007B | Environmental | Open in IMG/M |
| 3300018790 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_41 | Environmental | Open in IMG/M |
| 3300018868 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_50 | Environmental | Open in IMG/M |
| 3300019093 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_43 | Environmental | Open in IMG/M |
| 3300020084 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015032 Kigoma Deep Cast 1200m | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020179 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015056 Kigoma Offshore 0m | Environmental | Open in IMG/M |
| 3300020183 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surface | Environmental | Open in IMG/M |
| 3300020190 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015013 Mahale N5 surface | Environmental | Open in IMG/M |
| 3300020196 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015031 Kigoma Deep Cast 0m | Environmental | Open in IMG/M |
| 3300020578 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015038 Kigoma Deep Cast 35m | Environmental | Open in IMG/M |
| 3300021424 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015009 Mahale N1 surface | Environmental | Open in IMG/M |
| 3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
| 3300022748 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17_Aug_MG | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300024861 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027563 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027581 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027586 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027621 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027642 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027644 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027656 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027697 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027707 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD (SPAdes) | Environmental | Open in IMG/M |
| 3300027720 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027730 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_8m | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027746 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027756 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027760 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028394 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300028553 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_16m | Environmental | Open in IMG/M |
| 3300028557 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_4m | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300034272 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12547J11936_10321954 | 3300000736 | Freshwater And Sediment | GNRTPDNQAANKLVDAGGIWFEDVGSTPTASINT* |
| JGI12547J11936_10450701 | 3300000736 | Freshwater And Sediment | DNQAANKLVDAGGIWFEDVGSTPTASILIYMYLH* |
| JGI12547J11936_10458062 | 3300000736 | Freshwater And Sediment | QGNRTPDNQAANKLVDAGGIWFEDVGSTPTASMLIYRYL* |
| JGI12547J11936_10509771 | 3300000736 | Freshwater And Sediment | QGNRTPDNQAANKLVDAGGIWFEDVGSTPTASIFSVR* |
| B570J40625_1002081781 | 3300002835 | Freshwater | TGQWQGNRTPDNQAANKLVDAGGIWFEDVGSTPTASMFPISG* |
| JGI25917J50250_10026742 | 3300003395 | Freshwater Lake | MLRGTGQWQGNRTPDNQAANKLVDAGGIWFEDVGSTPTASIFNRTVKMVI* |
| JGI25926J51410_10178902 | 3300003490 | Freshwater Lake | MLRGTGQWQGNRTPDNQAANKLVDAGGXWFEDVGSTPTASIFNRTVKMVI* |
| JGI25924J51412_10075634 | 3300003491 | Freshwater Lake | MLRGTGQWQGNRTPDNQAANKLVDAGGIWFEDVGSTPTASXFNRTVKMVI* |
| Ga0070374_100624483 | 3300005517 | Freshwater Lake | RGTGQWQGNRTPDNQAANKLVDAGGIWFEDVGSTPTASILIYKAYIKFIA* |
| Ga0070374_106783371 | 3300005517 | Freshwater Lake | RGTGQWQGNRTPDNQAANKLVDAGGIWFEDVGSTPTASISSVR* |
| Ga0079299_10096461 | 3300006862 | Deep Subsurface | MLRSTGQWQGNRTPDNQAANKLVDAGGIWFEDVGSTPTASILIYMYLH* |
| Ga0079300_100220783 | 3300007162 | Deep Subsurface | TGQWQGNRTPDNQAANKLVDAGGIWFEDVGSTPTASILIYMYLH* |
| Ga0108970_111801532 | 3300008055 | Estuary | MLRRTGQWQGNRTPDNQAANKLVDAGGIWFEDVGSTPTASIF* |
| Ga0114341_1000407015 | 3300008108 | Freshwater, Plankton | MLRRTGQWQGNRTPDNQAANKLVDAGGIWFEDVGSTPTASINI* |
| Ga0114351_13498251 | 3300008117 | Freshwater, Plankton | MLRRTGQWQGNRTPDNQAANKLVDAGGIWFEDVGST |
| Ga0114973_101134571 | 3300009068 | Freshwater Lake | TWMLRGTGQWQGNRTPDNQAANKLVDAGGIWFEDVGSTPTASILIYMHLH* |
| Ga0114973_102264981 | 3300009068 | Freshwater Lake | RWQGNRTPDNQPANKLVDAGGSWFEDVGSTPTASINT* |
| Ga0114962_100092831 | 3300009151 | Freshwater Lake | MLRRAGQWQGNRSPDNQTANKLVDAGGSWFEDVGSTPTAS |
| Ga0114963_106410002 | 3300009154 | Freshwater Lake | FQESTWMLRRTGQWQGNRPPDNQAANKLVDAGGSWFEDVGSTPTASINAY* |
| Ga0114968_100115537 | 3300009155 | Freshwater Lake | MLRRTGQWQGNRPPDNQAANKLVDAGGSWFEDVGSTPTASILIYRHLNQYYCLVGI* |
| Ga0114968_100381454 | 3300009155 | Freshwater Lake | MLRSTGRWQGNRTPDNQPANKLVDAGGSWFEDVGSTPTAS |
| Ga0114968_104644132 | 3300009155 | Freshwater Lake | MLRSTGQWQGNRTPDNQAANKLVDAGGSWFEDVGSTPTASNLLSQD* |
| Ga0114977_100115181 | 3300009158 | Freshwater Lake | MLRSTGQWQGNRTPDNQAANKLVDAGGIWFEDVGSTPTASINT* |
| Ga0114966_103125692 | 3300009161 | Freshwater Lake | STGQWQGNRTPDNQAANKLVDAGGIWFEDVGSTPTASILIYMYLH* |
| Ga0114966_103128542 | 3300009161 | Freshwater Lake | STGQWQGNRTPDNQAANKLVDAGGIWFEDVGSTPTASILIYMHLH* |
| Ga0114979_102193881 | 3300009180 | Freshwater Lake | RTGQWQGNRTPDNQAANKLVDAGGSWFEDVGSTPTASIF* |
| Ga0114979_108330281 | 3300009180 | Freshwater Lake | GNRTPDNQAANKLVDAGGIWFEDVGSTPTASIFPIYG* |
| Ga0114976_101563981 | 3300009184 | Freshwater Lake | TGQWQGNRTPDNQAANKLVDAGGSWFEDVGSTPTASIFNRTVKMVI* |
| Ga0114976_101843491 | 3300009184 | Freshwater Lake | MLRRTGQWQGNRTPDNQAANKLVDAGGSWFEDVGSTPTASIF* |
| Ga0114971_100619151 | 3300009185 | Freshwater Lake | MLRRAGQWQGNRSPDNQTANKLVDAGGSWFEDVGSTPTASINTY* |
| Ga0114971_103394603 | 3300009185 | Freshwater Lake | TGQWQGNRTPDNQAANKLVDAGGIWFEDVGSTPTASIFSVR* |
| Ga0114971_103887192 | 3300009185 | Freshwater Lake | LRGTGQWQGNRTPDNQAANKLVDAGGIWFEDVGSTPTASILIYMHLH* |
| Ga0114971_107837961 | 3300009185 | Freshwater Lake | GNRTPDNQAANKLVDAGGIWFEDVGSTPTASILIYMHLH* |
| Ga0114972_104084132 | 3300009187 | Freshwater Lake | MLRSTGQWQGNRTPDNQAANKLVDAGGIWFEDVGSTPTASIIPIFG* |
| Ga0114972_104419431 | 3300009187 | Freshwater Lake | PDNQAANKLVDAGGIWFEDVGSTPTASMLIYSYLH* |
| Ga0114964_103341971 | 3300010157 | Freshwater Lake | MLRRAGQWQGNRSPDNQTANKLVDAGGSWFEDVGSTPTASILI |
| Ga0114967_102375842 | 3300010160 | Freshwater Lake | PDNQAANKLVDAGGIWFEDVGSTPTASILIYMHLH* |
| Ga0114967_102446982 | 3300010160 | Freshwater Lake | TGQWQGNRTPDNQAANKLVDAGGIWFEDVGSTPTASILIYKYLQ* |
| Ga0114967_104982782 | 3300010160 | Freshwater Lake | RTPDNQAANKLVDAGGIWFEDVGSTPTASIFSVR* |
| Ga0136644_102795341 | 3300010334 | Freshwater Lake | QGNRTPDNQAANKLVDAGGSWFEDVGSTPTASMLIYSYLH* |
| Ga0136644_107075341 | 3300010334 | Freshwater Lake | QWQGNRTPDNQAANKLVDAGGIWFEDVGSTPTASIMIKRCLY* |
| Ga0133913_119895971 | 3300010885 | Freshwater Lake | RAGQWQGNRSPDNQTANKLVDAGGSWFEDVGSTPTASMLIYRCL* |
| Ga0133913_122865332 | 3300010885 | Freshwater Lake | LRRTGQWQGNRPPDNQAANKLVDAGGSWFEDVGSTPTASILIYRHLNQYYCLVGI* |
| Ga0133913_128944991 | 3300010885 | Freshwater Lake | RAGQWQGNRSPDNQTANKLVDAGGSWFEDVGSTPTASIFF* |
| Ga0133913_131483682 | 3300010885 | Freshwater Lake | MLRRTGQWQGNRTPDNQAANKLVDAGGSWFEDVGSTPTASTS* |
| Ga0133913_133688672 | 3300010885 | Freshwater Lake | LRGTGQWQGNRTPDNQAANKLVDAGGSWFEDVGSTPTASMLIYSYLH* |
| Ga0151514_1075317 | 3300011115 | Freshwater | MLRGTGQWQGNRTPDNQAANKLVDAGGIWFEDVGSTPTASIFSVR* |
| Ga0119951_10264811 | 3300012000 | Freshwater | RSTGQWQGNRTPDNQAANKLVDAGGIWFEDVGSTPTASINT* |
| Ga0164294_101103841 | 3300013006 | Freshwater | GNRTPDNQAANKLVDAGGIWFEDVGSTPTASILISWQ* |
| Ga0164294_101196381 | 3300013006 | Freshwater | MLRGTGQWQGNRTPDNQAANKLVDAGGIWFEDVGSTPTASMLIYRYLH* |
| Ga0164294_103908941 | 3300013006 | Freshwater | LRGTGQWQGNRTPDNQAANKLVDAGGIWFEDVGSTPTASILIYRYLH* |
| Ga0164294_106059201 | 3300013006 | Freshwater | MLRRAGQWQGNRSPDNQTANKLVDAGGSWFEDVGSTPTASIFS |
| Ga0164294_106068121 | 3300013006 | Freshwater | GTGQWQGNRTPDNQAANKLVDAGGIWFEDVGSTPTASINT* |
| Ga0164294_106310402 | 3300013006 | Freshwater | MLRGTGQWQGNRTPDNQTANKLVDAGGSWFEDVGSTPTASILIYKAYIKFIA* |
| Ga0164294_106785651 | 3300013006 | Freshwater | QWQGNRTPDNQAANKLVDAGGIWFEDVGSTPTASIFSVR* |
| Ga0164294_108143061 | 3300013006 | Freshwater | STGQWQGNRTPDNQAANKLVDAGGIWFEDVGSTPTASMFPIYG* |
| Ga0164294_111434822 | 3300013006 | Freshwater | PDNQAANKLVDAGGIWFEDVGSTPTASTLIYMHLH* |
| Ga0164295_100395754 | 3300013014 | Freshwater | TGQWQGNRTPDNQAANKLVDAGGIWFEDVGSTPTASILIYRYLH* |
| Ga0164295_101098913 | 3300013014 | Freshwater | STGQWQGNRTPDNQAANKLVDAGGIWFEDVGSTPTASILISWQ* |
| Ga0164295_107735991 | 3300013014 | Freshwater | MLRGTGQWQGNRTPDNQAANKLVDAGGIWFEDVGSTPTASINT* |
| Ga0164295_111347962 | 3300013014 | Freshwater | QWQGNRTPDNQAANKLVDAGGIWFEDVGSTPTASMLIYRYL* |
| Ga0119952_100061325 | 3300014050 | Freshwater | RTTGRWQGNRGPDNQPANKLVDAGGHRFEDVGSTPTASTLIAGTLK* |
| Ga0187842_10225841 | 3300018790 | Freshwater | RSTGQWQGNRTPDNQAANKLVDAGGIWFEDVGSTPTASILIPSVGFLAP |
| Ga0187842_10909602 | 3300018790 | Freshwater | MLRSTGQWQGNRTPDNQAANKLVDAGGIWFEDVGSTPTASINT |
| Ga0187842_11165412 | 3300018790 | Freshwater | GNRTPDNQAANKLVDAGGIWFEDVGSTPTASILISWQ |
| Ga0187842_12265862 | 3300018790 | Freshwater | AGQWQGNRSPDNQTANKLVDAGGSWFEDVGSTPTASIFFSGS |
| Ga0187844_100615473 | 3300018868 | Freshwater | STGQWQGNRTPDNQAANKLVDAGGIWFEDVGSTPTASILISWQ |
| Ga0187844_101063131 | 3300018868 | Freshwater | TGQWQGNRTPDNQAANKLVDAGGSWFEDVGSTPTASILIKRCLH |
| Ga0187844_101755321 | 3300018868 | Freshwater | LRSTGQWQGNRTPDNQAANKLVDAGGIWFEDVGSTPTASIFFVQD |
| Ga0187843_100790032 | 3300019093 | Freshwater | GQWQGNRTPDNQAANKLVDAGGSWFEDVGSTPTASILIKRCLH |
| Ga0187843_103304251 | 3300019093 | Freshwater | TGQWQGNRTPDNQAANKLVDAGGIWFEDVGSTPTASINT |
| Ga0194110_104353001 | 3300020084 | Freshwater Lake | LRTTGRWQGNRHPDNQPANKLVDAGGIWFEDVGSTPTASINICQTVN |
| Ga0211726_105180432 | 3300020161 | Freshwater | MLRGTGQWQGNRTPDNQAANKLVDAGGIWFEDVGSTPTASIFSPIFFSRCPFAR |
| Ga0194134_100384567 | 3300020179 | Freshwater Lake | RTTGRWQGNRHPDNQPANKLVDAGGIWFEDVGSTPTASMVRPNGCA |
| Ga0194115_100279231 | 3300020183 | Freshwater Lake | QGNRHPDNQPANKLVDAGGIWFEDVGSTPTASMVRPNGCA |
| Ga0194118_100165531 | 3300020190 | Freshwater Lake | WWLRTTGRWQGNRHPDNQPANKLVDAGGIWFEDVGSTPTASMVRPNGCA |
| Ga0194124_102016591 | 3300020196 | Freshwater Lake | QGNRHPDNQPANKLVDAGGIWFEDVGSTPTASINICQTVN |
| Ga0194129_100748746 | 3300020578 | Freshwater Lake | TGRWQGNRHPDNQPANKLVDAGGIWFEDVGSTPTASMVRPNGCA |
| Ga0194117_101792721 | 3300021424 | Freshwater Lake | KGNRHPDNQPANKLVDAGGIWFEDVGSTPTASINICQTVN |
| Ga0194048_100909391 | 3300021519 | Anoxic Zone Freshwater | MLRRAGQWQGNRSPDNQTANKLVDAGGSWFEDVGSTPTASILIYRYLH |
| Ga0228702_10897421 | 3300022748 | Freshwater | MLRRTGQWQGNRSPDNQAANKLVDAGGSWFEDVGSTPTASI |
| Ga0214917_1000212126 | 3300022752 | Freshwater | MLRRTGQWQGNRPPDNQAANKLVDAGGSWFEDVGSTPTAS |
| Ga0214917_100184251 | 3300022752 | Freshwater | WMLRRTGQWQGNRPPDNQAANKLVDAGGSWFEDVGSTPTASINT |
| Ga0214917_101411901 | 3300022752 | Freshwater | PDNQPANKLVDAGGSWFEDVGSTPTASTLIYIYLYQFY |
| Ga0214921_100173627 | 3300023174 | Freshwater | WMLRSTGQWQGNRTPDNQAANKLVDAGGIWFEDVGSTPTASMVPIYG |
| Ga0214921_100338128 | 3300023174 | Freshwater | TWMLRRTGQWQGNRTPDNQAANKLVDAGGIWFEDVGSTPTASIL |
| Ga0214921_100986741 | 3300023174 | Freshwater | WMLRSTGQWQGNRTPDNQAANKLVDAGGIWFEDVGSTPTASINA |
| Ga0214921_102601381 | 3300023174 | Freshwater | WMLRSTGQWQGNRTPDNQAANKLVDAGGIWFEDVGSTPTASILIYMHLH |
| Ga0214921_103598423 | 3300023174 | Freshwater | WMLRGTGQWQGNRTPDNQPANKLVEAGGSWFEDVGSTPTASIFNRTVKMVI |
| Ga0214921_104646071 | 3300023174 | Freshwater | WMLRGTGQWQGNRTPDNQAANKLVDAGGIWFEDVGSTPTASIFSVR |
| Ga0214923_100001664 | 3300023179 | Freshwater | MLRRTGQWQGNRTPDNQAANKLVDAGGIWFEDVGSTPTASILIINTLCDFYCLVVR |
| Ga0214923_101049823 | 3300023179 | Freshwater | MLRRTGQWQGNRTPDNQAANKLVDAGGSWFEDVGSTPTAS |
| Ga0214923_101577361 | 3300023179 | Freshwater | WMLRSTGRWQGNRTPDNQPANKLVDAGGSWFEDVGSTPTASTLIYIYLYQFY |
| Ga0214923_101783761 | 3300023179 | Freshwater | MLRSTGRWQGNRTPDNQPANKLVDAGGSWFEDVGSTPTASINTLYIII |
| Ga0214919_100072391 | 3300023184 | Freshwater | TWMLRSTGQWQGNRTPDNQAANKLVDAGGIWFEDVGSTPTASTLIYRYLHLFCCLVVI |
| Ga0214919_100518745 | 3300023184 | Freshwater | MLRSTGQWQSNRTSDNQAANKLVDAGGSWFEDVGSTPTASNLLSKESEG |
| Ga0214919_103535721 | 3300023184 | Freshwater | TWMLRSTGQWQGNRTPDNQAANKLVDAGGIWFEDVGSTPTASIFSVR |
| Ga0256312_10348682 | 3300024861 | Freshwater | MLRGTGQWQGNRTPDNQAANKLVDAGGIWFEDVGSTPTAS |
| Ga0209552_10067605 | 3300027563 | Freshwater Lake | MLRGTGQWQGNRTPDNQAANKLVDAGGIWFEDVGSTPTASISSVR |
| Ga0209651_10109264 | 3300027581 | Freshwater Lake | WMLRGTGQWQGNRTPDNQAANKLVDAGGIWFEDVGSTPTASILIYKAYIKFIA |
| Ga0209651_10673142 | 3300027581 | Freshwater Lake | WMLRGTGQWQGNRTPDNQAANKLVDAGGIWFEDVGSTPTASMFPISG |
| Ga0208966_11442481 | 3300027586 | Freshwater Lentic | QGNRTPDNQAANKLVDAGGIWFEDVGSTPTASIFSVR |
| Ga0208951_10365811 | 3300027621 | Freshwater Lentic | MLRGTGQWQGNRTPDNQAANKLVDAGGIWFEDVGSTPTASIFSV |
| Ga0208951_10753401 | 3300027621 | Freshwater Lentic | MLRRAGQWQGNRSPDNQTANKLVDAGGSWFEDVGSTPTASIFSHAL |
| Ga0209135_10439642 | 3300027642 | Freshwater Lake | MLRGTGQWQGNRTPDNQAANKLVDAGGIWFEDVGSTPTASILIYKAYIKFIA |
| Ga0209135_11297822 | 3300027642 | Freshwater Lake | MLRRAGQWQGNRSPDNQTANKLVDAGGSWFEDVGSTPTASIFSHALD |
| Ga0209135_11650971 | 3300027642 | Freshwater Lake | WQGNRSPDNQTANKLVDAGGSWFEDVGSTPTASISIYRGLH |
| Ga0209356_10172563 | 3300027644 | Freshwater Lake | MLRGTGQWQGNRTPDNQAANKLVDAGGIWFEDVGSTPTASIFNRTVKMVI |
| Ga0209356_10477781 | 3300027644 | Freshwater Lake | MLRSTGQWQGNRTPDNQAANKLVDAGGIWFEDVGSTPTASMFPIYG |
| Ga0209356_12111711 | 3300027644 | Freshwater Lake | TPDNQAANKLVDAGGIWFEDVGSTPTASILIYRCLH |
| Ga0209357_10142344 | 3300027656 | Freshwater Lake | MLRRAGQWQGNRSPDNQTANKLVDAGGSWFEDVGSTPTASIF |
| Ga0209033_12112542 | 3300027697 | Freshwater Lake | MLRSTGQWQGNRTPDNQAANKLVDAGGIWFEDVGSTPTASIN |
| Ga0209443_12226561 | 3300027707 | Freshwater Lake | MLRGTGQWQGNRTPDNQAANKLVDAGGIWFEDVGSTPTASIFSYG |
| Ga0209617_100547834 | 3300027720 | Freshwater And Sediment | QGNRTPDNQAANKLVDAGGIWFEDVGSTPTASINT |
| Ga0209617_100578681 | 3300027720 | Freshwater And Sediment | MLRSTGQWQGNRTPDNQAANKLVDAGGIWFEDVGSTPTASTLLI |
| Ga0209617_101434311 | 3300027720 | Freshwater And Sediment | GQWQGNRTPDNQAANKLVDAGGIWFEDVGSTPTASMLIYRYL |
| Ga0209617_103781782 | 3300027720 | Freshwater And Sediment | GNRTPDNQAANKLVDAGGIWFEDVGSTPTASIFSVR |
| (restricted) Ga0247833_10195697 | 3300027730 | Freshwater | GQWQGNRTPDNQAANKLVDAGGSWFEDVGSTPTASILIYRHLH |
| Ga0209297_10104281 | 3300027733 | Freshwater Lake | MLRGTGQWQGNRTPDNQAANKLVDAGGIWFEDVGSTPTASMFPISGC |
| Ga0209597_12152961 | 3300027746 | Freshwater Lake | QWQGNRTPDNQAANKLVDAGGIWFEDVGSTPTASILIYMHLH |
| Ga0209444_1000530210 | 3300027756 | Freshwater Lake | MLRRAGQWQGNRSPDNQTANKLVDAGGSWFEDVGSTPTASIFSY |
| Ga0209296_11456641 | 3300027759 | Freshwater Lake | MLRSTGQWQGNRTPDNQAANKLVDAGGIWFEDVGSTPTASIFSV |
| Ga0209598_100891581 | 3300027760 | Freshwater Lake | QGNRTPDNQAANKLVDAGGIWFEDVGSTPTASILIYMHLH |
| Ga0209598_102333671 | 3300027760 | Freshwater Lake | QGNRTPDNQAANKLVDAGGIWFEDVGSTPTASIIPIFG |
| Ga0209086_100561103 | 3300027770 | Freshwater Lake | RTPDNQAANKLVDAGGIWFEDVGSTPTASILIYMHLH |
| Ga0209086_101904231 | 3300027770 | Freshwater Lake | GNRTPDNQAANKLVDAGGIWFEDVGSTPTASILIYMHLH |
| Ga0209107_100452233 | 3300027797 | Freshwater And Sediment | MLRSTGQWQGNRTPDNQAANKLVDAGGIWFEDVGSTPTASMFPIFG |
| Ga0209550_100458491 | 3300027892 | Freshwater Lake | QGNRTPDNQAANKLVDAGGIWFEDVGSTPTASMFPIYG |
| Ga0209400_10327681 | 3300027963 | Freshwater Lake | MLRRTGQWQGNRPPDNQAANKLVDAGGSWFEDVGSTPTASILIYRHLNQYYCLVGI |
| Ga0209400_12421821 | 3300027963 | Freshwater Lake | TWMLRSTGQWQGNRTPDNQAANKLVDAGGSWFEDVGSTPTASNLLSQD |
| Ga0304730_11996581 | 3300028394 | Freshwater Lake | TGQWQGNRTPDNQAANKLVDAGGIWFEDVGSTPTASILIYKYLQ |
| (restricted) Ga0247839_11513732 | 3300028553 | Freshwater | GNRTPDNQAANKLVDAGGSWFEDVGSTPTASILIYRHLH |
| (restricted) Ga0247832_10643243 | 3300028557 | Freshwater | QGNRTPDNQAANKLVDAGGSWFEDVGSTPTASILIYRHLH |
| Ga0315904_100803996 | 3300031951 | Freshwater | MLRRTGQWQGNRTPDNQAANKLVDAGGIWFEDVGSTPTASINI |
| Ga0335049_0874166_407_523 | 3300034272 | Freshwater | QGNRTPDNQAANKLVDAGGIWFEDVGSTPTASIFPISG |
| ⦗Top⦘ |