NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F057801

Metagenome / Metatranscriptome Family F057801

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F057801
Family Type Metagenome / Metatranscriptome
Number of Sequences 135
Average Sequence Length 167 residues
Representative Sequence IYSISPVFSGDFNIKDYCDGSKTGNDWCVEVDWIESNGNCGGQTTLHTRPGPGSTGCTAWGCAATYMYNGKPSFHMVVSYDAQGHWTTVHDGQTIAPNNLSPQPQDQDWSTLVSQYSKQGAVIYGSQWVGWTPVPSCGSNGNLEGSKYSIRNLKINGVHTQGPVPKSC
Number of Associated Samples 94
Number of Associated Scaffolds 135

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 2.24 %
% of genes near scaffold ends (potentially truncated) 95.56 %
% of genes from short scaffolds (< 2000 bps) 99.26 %
Associated GOLD sequencing projects 88
AlphaFold2 3D model prediction Yes
3D model pTM-score0.43

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (96.296 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(87.407 % of family members)
Environment Ontology (ENVO) Unclassified
(41.481 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(97.037 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 13.27%    β-sheet: 21.94%    Coil/Unstructured: 64.80%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.43
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.30 %
UnclassifiedrootN/A3.70 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300012212|Ga0150985_104874363All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus565Open in IMG/M
3300012469|Ga0150984_103138410All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus521Open in IMG/M
3300022502|Ga0242646_1040889All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus503Open in IMG/M
3300022529|Ga0242668_1149857All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus512Open in IMG/M
3300030529|Ga0210284_1069359All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus527Open in IMG/M
3300030531|Ga0210274_1494596All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus564Open in IMG/M
3300030531|Ga0210274_1919529All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus634Open in IMG/M
3300030533|Ga0247632_1012102All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus598Open in IMG/M
3300030540|Ga0247649_1062769All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus572Open in IMG/M
3300030543|Ga0210289_1606277All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus562Open in IMG/M
3300030545|Ga0210271_10549269All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus575Open in IMG/M
3300030546|Ga0247646_1203203All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus570Open in IMG/M
3300030546|Ga0247646_1277468All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus510Open in IMG/M
3300030547|Ga0247656_1143352All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus592Open in IMG/M
3300030547|Ga0247656_1165636Not Available568Open in IMG/M
3300030547|Ga0247656_1180457All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus554Open in IMG/M
3300030547|Ga0247656_1229249All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus515Open in IMG/M
3300030550|Ga0247631_1135999All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus570Open in IMG/M
3300030550|Ga0247631_1172185All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus540Open in IMG/M
3300030551|Ga0247638_1171430All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus538Open in IMG/M
3300030552|Ga0247654_1029231All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus821Open in IMG/M
3300030553|Ga0247645_1143613All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus597Open in IMG/M
3300030555|Ga0247618_1141558All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus552Open in IMG/M
3300030563|Ga0247653_1112622All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus503Open in IMG/M
3300030565|Ga0247635_1247258All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus560Open in IMG/M
3300030565|Ga0247635_1334191All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus503Open in IMG/M
3300030569|Ga0247628_1191936All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus583Open in IMG/M
3300030569|Ga0247628_1204556All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus569Open in IMG/M
3300030571|Ga0247652_1166822Not Available550Open in IMG/M
3300030574|Ga0247648_1149981All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus570Open in IMG/M
3300030574|Ga0247648_1194671All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus522Open in IMG/M
3300030576|Ga0247644_1167273All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus546Open in IMG/M
3300030577|Ga0210260_10368497All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus524Open in IMG/M
3300030578|Ga0210275_10387877All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus509Open in IMG/M
3300030579|Ga0247633_10271334All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus542Open in IMG/M
3300030579|Ga0247633_10283039All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus535Open in IMG/M
3300030579|Ga0247633_10350730All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus500Open in IMG/M
3300030582|Ga0210261_1178991All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus547Open in IMG/M
3300030583|Ga0210262_1177983All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus583Open in IMG/M
3300030584|Ga0247658_1102543All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus572Open in IMG/M
3300030584|Ga0247658_1136217All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus527Open in IMG/M
3300030590|Ga0247643_1193362All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus506Open in IMG/M
3300030590|Ga0247643_1199739All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus500Open in IMG/M
3300030594|Ga0210280_1165976All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus541Open in IMG/M
3300030600|Ga0247659_1194218All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus532Open in IMG/M
3300030601|Ga0247650_1060538All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus654Open in IMG/M
3300030601|Ga0247650_1115956All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus562Open in IMG/M
3300030604|Ga0247637_1180874All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus539Open in IMG/M
3300030604|Ga0247637_1188358All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus532Open in IMG/M
3300030604|Ga0247637_1207359All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus515Open in IMG/M
3300030604|Ga0247637_1212527All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus511Open in IMG/M
3300030605|Ga0210265_1112967All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus582Open in IMG/M
3300030605|Ga0210265_1169421All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus510Open in IMG/M
3300030607|Ga0247615_10321917All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus554Open in IMG/M
3300030608|Ga0247651_10258678All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus561Open in IMG/M
3300030609|Ga0247634_10392013All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus581Open in IMG/M
3300030614|Ga0247657_10213823All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus563Open in IMG/M
3300030615|Ga0257185_10373652All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus535Open in IMG/M
3300030615|Ga0257185_10419038All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus512Open in IMG/M
3300030621|Ga0247655_10326391All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus508Open in IMG/M
3300030622|Ga0265391_10208290All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus599Open in IMG/M
3300030623|Ga0265392_1179825All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus570Open in IMG/M
3300030623|Ga0265392_1259866All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus507Open in IMG/M
3300030625|Ga0210259_10692824All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus518Open in IMG/M
3300030627|Ga0210269_10310193All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus552Open in IMG/M
3300030632|Ga0210250_10851073All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus520Open in IMG/M
3300030633|Ga0247623_10254428All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus559Open in IMG/M
3300030635|Ga0247627_10324910All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus522Open in IMG/M
3300030682|Ga0247622_1151244All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus561Open in IMG/M
3300030682|Ga0247622_1166437All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus541Open in IMG/M
3300030682|Ga0247622_1187568All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus517Open in IMG/M
3300030684|Ga0247617_1094304All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus566Open in IMG/M
3300030684|Ga0247617_1122199All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus531Open in IMG/M
3300030740|Ga0265460_12153421All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus585Open in IMG/M
3300030740|Ga0265460_12614670Not Available539Open in IMG/M
3300030741|Ga0265459_13677934All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus538Open in IMG/M
3300030741|Ga0265459_13958324All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus520Open in IMG/M
3300030743|Ga0265461_13092365All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus560Open in IMG/M
3300030748|Ga0074043_10446110All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus530Open in IMG/M
3300030748|Ga0074043_10583147All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus568Open in IMG/M
3300030748|Ga0074043_11538982All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus520Open in IMG/M
3300030751|Ga0102764_1872053All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus511Open in IMG/M
3300030779|Ga0075378_11017252All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus579Open in IMG/M
3300030790|Ga0138304_1137865All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus507Open in IMG/M
3300030839|Ga0073999_10991426All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus522Open in IMG/M
3300030842|Ga0075404_11220945All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus566Open in IMG/M
3300030843|Ga0075392_11022249All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus656Open in IMG/M
3300030843|Ga0075392_11240044All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus576Open in IMG/M
3300030850|Ga0075387_10028221All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus584Open in IMG/M
3300030850|Ga0075387_10130876All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus551Open in IMG/M
3300030851|Ga0075380_11443911All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus565Open in IMG/M
3300030855|Ga0075374_10187346All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus542Open in IMG/M
3300030858|Ga0102759_1930555All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus538Open in IMG/M
3300030909|Ga0074033_10702198All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus538Open in IMG/M
3300030909|Ga0074033_11015372All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus773Open in IMG/M
3300030922|Ga0138300_1192470All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus522Open in IMG/M
3300030922|Ga0138300_1420142All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus530Open in IMG/M
3300030935|Ga0075401_11832446All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus566Open in IMG/M
3300030937|Ga0138302_1061807All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus514Open in IMG/M
3300030937|Ga0138302_1065762All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus571Open in IMG/M
3300030937|Ga0138302_1806929All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus529Open in IMG/M
3300030938|Ga0138299_10528330All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus572Open in IMG/M
3300030946|Ga0075379_11485573All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus532Open in IMG/M
3300030947|Ga0075390_10106066All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus516Open in IMG/M
3300030949|Ga0074031_1775221All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus550Open in IMG/M
3300030959|Ga0102747_10165368All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus568Open in IMG/M
3300030960|Ga0102745_1000070All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus637Open in IMG/M
3300030962|Ga0138297_1272155All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus511Open in IMG/M
3300030966|Ga0075383_11265960All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus543Open in IMG/M
3300030971|Ga0075375_11666095All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus555Open in IMG/M
3300030979|Ga0068589_11696617All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus556Open in IMG/M
3300030980|Ga0074027_11092576All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus560Open in IMG/M
3300031000|Ga0074035_10502024All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus545Open in IMG/M
3300031015|Ga0138298_1087333Not Available574Open in IMG/M
3300031015|Ga0138298_1189242All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus571Open in IMG/M
3300031022|Ga0138301_1218940All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus515Open in IMG/M
3300031022|Ga0138301_1737766All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus534Open in IMG/M
3300031031|Ga0074042_10821124All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus512Open in IMG/M
3300031035|Ga0074026_11314936All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus845Open in IMG/M
3300031051|Ga0074029_1147262All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus548Open in IMG/M
3300031057|Ga0170834_101430475All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus555Open in IMG/M
3300031057|Ga0170834_104694138All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus536Open in IMG/M
3300031057|Ga0170834_105728114All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus554Open in IMG/M
3300031057|Ga0170834_110743840All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus515Open in IMG/M
3300031057|Ga0170834_112128327All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus511Open in IMG/M
3300031116|Ga0318490_1291097All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus539Open in IMG/M
3300031122|Ga0170822_14628222All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus520Open in IMG/M
3300031128|Ga0170823_10018209All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus540Open in IMG/M
3300031411|Ga0102761_12236808All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus525Open in IMG/M
3300031446|Ga0170820_17200465All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus510Open in IMG/M
3300031474|Ga0170818_103429370All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus540Open in IMG/M
3300031474|Ga0170818_106675324All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus503Open in IMG/M
3300031474|Ga0170818_110185147All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus536Open in IMG/M
3300032756|Ga0315742_13574302All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus502Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil87.41%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil8.89%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated1.48%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.74%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.74%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.74%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300022502Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-19-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022529Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300030529Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO740-VDE013SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030531Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO143-VCO038SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030533Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bb9 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030540Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Db2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030543Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO410-VDE107SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030545Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO142-VCO033SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030546Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cnb11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030547Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Db9 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030550Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bb8 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030551Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cb3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030552Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Db7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030553Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cnb10 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030555Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Ab7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030563Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Dnb6 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030565Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bnb12 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030569Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bnb5 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030571Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Dnb5 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030574Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Db1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030576Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cb9 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030577Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO131-ARE010SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030578Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO105-VCO054SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030579Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bnb10 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030582Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO145-ARE022SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030583Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO145-ARE023SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030584Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Dnb11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030590Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cb8 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030594Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO141-VCO089SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030600Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Dnb12 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030601Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Db3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030604Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cb2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030605Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO144-ARE042SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030607Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Anb4 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030608Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Dnb4 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030609Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bnb11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030614Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Dnb10 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030615Metatranscriptome of plant litter fungal communities from Pinus contorta in Bitterroot National Forest, Montana, United States - GP1-LITTER (Eukaryote Community Metatranscriptome)Host-AssociatedOpen in IMG/M
3300030621Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Db8 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030622Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO144-ARE044SO (Eukaryote Community Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300030623Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO144-ARE043SO (Eukaryote Community Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300030625Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO122-ANR120SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030627Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO153-ARE095SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030632Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO132-ANR004SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030633Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Anb12 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030635Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bnb4 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030682Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Anb11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030684Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Anb6 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030740Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assemblyEnvironmentalOpen in IMG/M
3300030741Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assemblyEnvironmentalOpen in IMG/M
3300030743Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assemblyEnvironmentalOpen in IMG/M
3300030748Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Litter C3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030751Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PO 2B (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030779Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB1 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030790Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_OS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300030839Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil TCEFB (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030842Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB3 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030843Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB2 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030850Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB1 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030851Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA9 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030855Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA9 Emin (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030858Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 6B (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030909Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Mineral N2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030922Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A9_OS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300030934Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB3 Emin (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030935Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA7 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030937Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A4_MS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300030938Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A4_OS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300030946Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA7 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030947Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB3 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030949Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Humus C3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030959Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines Pi 2A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030960Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 1B (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030962Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A4_MS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300030966Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB4 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030971Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030979Forest soil microbial communities from France, for metatranscriptomics studies - Site 11 - Champenoux / Amance forest (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030980Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Humus N2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031000Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Mineral C1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031015Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A9_MS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300031022Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_MS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300031031Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Litter C2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031035Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Humus N1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031051Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Humus C1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031116Metatranscriptome of forest soil fungal communities from Los Alamos, New Mexico, United States - Jemez Pines Pi 5A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031122Oak Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031128Oak Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031411Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PO 1A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300032756Forest Soil Metatranscriptomics Site 2 Humus Litter Mineral Combined AssemblyEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0150985_10487436313300012212Avena Fatua RhizosphereTHPGVNANIYSISPQLSGDFDNKLYCDGQKNGTEWCLDVDWIESNGGCGGQTTLHSRPGPGSTGCTAWGCANSYMYNGKSSFHMVISFDSQGKWTTTHDGIVISASNLSPPPQDQDWQVVQQYLSQRGAVIYGSQWVGWVPQSSCGQNGNLAGSVYSIRNLKINGSVVKGTRPRTC*
Ga0150984_10313841013300012469Avena Fatua RhizosphereNLYSISPVFSGSFDIKDYCDGAKTGNDWCVEVDWIESNGNCGGQTTLHTRPGPGSTGCTAWGCAATYMYNGHPSFHMMISFDAQGHWTTVRDGQTIAPNNLNPQPQEQDWSTLVGQFNKQGAVVYGSQWVGWTPVPSCGSNGNLDGSKYSIKNLKINGVHMQGPVPKSC*
Ga0242646_104088913300022502SoilANIYSISPDFSGSFQNTDYCDGQKNGTEWCLEVDWIESNGGCGGQTTLHSRPGPGSTGCTAWGCANSYTYNGKSAFHMVVSFDSQGKWTTTHDGVVINPGNLSPQPQDYDWQIVQQYYSQRGAVIYGSQWVGWVPLTSCGNNGNLAGSVYSVKNLKITGTVVKGPEP
Ga0242668_114985713300022529SoilKTHPGVNANIYSISPDFSGSFQNTDYCDGQKNGTEWCLEVDWIESNGGCGGQTTLHSRPGPGSTGCTAWGCANSYTYNGKSAFHMVVSFDSQGKWTTTHDGVVINPANLSPQPQDYDWQIVQQYYSQRGAVIYGSQWVGWVPLTSCGNNGALAGSVYSVKNLKITGTVVK
Ga0210284_106935913300030529SoilIYSICPTFTGSFKNTDYCDGSKNESGWCVEVDFIESNGPCGGQTTLHTRVGPGENGCTAWGCLSTYLYTGKTAFHMVVSFDQTGQWTTTHDGIVINPSSLNPLPQTLDWQTLQQQYTKTGAVIYSTQWVGWVPMESTCGPNGVLSGSVYKVSNLKINGTLVQGPEPTKC
Ga0210274_149459613300030531SoilHPGVNANFYSISPVFSGDFNIKDYCDGSKTGSDWCVEVDWIESNGHCGGQSTLHTRPGPGSNGCTAWGCAATYMYNGKPSFHMEIRYDANGQWTTVHDGAVINPSNLSPQPQAQDWSTLVGQYSKQGAVLYGSQWVGWVPVSSCGSNGDLAGSTYSIKNIRINGTHVQGPTPSLC
Ga0210274_191952913300030531SoilLYWDNSKRWRCLNKLQWFQNNCCIQYMNTICIVIYSISPDFSGSFQNTDYCDGQKNGTEWCLEVDWIESNGGCGGQTTLHSRPGPGSNGCTAWGCASSYMYNGKSSFHMSVSFDSNGHWTTTHDGQVIGPNNLSPQPQQEDWNVVQQYLSQRGAVIYGSQWVGWVPDSSCGNNGNLVGSVYSVRNLKITGTVVKGPEPRKC
Ga0247632_101210213300030533SoilDFSQTHPGVNANIYSISPDFSGSFTNKDYCDGQKNGTEWCLEVDWIESNGGCGGQTTLHSRPGPGSTGCTAWGCANSYTYNGKSSFHMVISFDEQGKWTTTHDGIVISPSNLSPPPQDQDWQVTQQYLSQRGAVIYSSQWVGWVPVSSCGQNGNLAGSVYSVRNLKINGSVVKGTRPRTC
Ga0247649_106276913300030540SoilAKTGADWCVEVDWIESNGNCGGQTTLHTRQGPGSTGCTAWGCAATYMYNGKSSFHMEIRYDANGQWTNVHDGQTIAPSNLNPQPQAQDWSTLMQAYAKQGAVIYGSQWVGWVPVSACGPNGKLDGSKYSVKNLKINGVHTQGPAPKTC
Ga0210289_160627713300030543SoilVDFSATHDGVNANVYSICPQFTGGFNQNDYCDGSKTGSDWCVEFDFIESNGHCGGQSTLHTREGPGNDGCTAWGCASDYLYNGRNSFHMAVLFDSAGHWTTIHDGVVISPNSLNPQPQDQDWQALQQHYSQLGAVIFSSQWVGWVPVSSCGGNGNLSGSVYSVKNLRINGTVVQGPEPRK
Ga0210271_1054926913300030545SoilDFSKTNQGVNANIFSICPSFTGSFNLSDYCDGQGKTGSDWCVEVDFIETNGPCGGQSTLHTRPGPGSTGCTSYGCLSAYLYNGKSAFHMVITFDELGHWTTSHDGTIISPNNLNPAPLDYDWQMLQQQYTKFGTVLYSSQWVGWVPQTNSCGGNGILDGSFFRISNLKINGTHVQGPEATKC
Ga0247646_120320313300030546SoilDFDQKLYCDGQKNGTEWCLEVDWIESNGGCGGQTTLHSRPGPGSTGCTAWGCANSYMYNGKSSFHMVISFDAQGKWTTTHDGIVISSGNLSPQPQDQDWQVVQQYLSQRGAVIYGSQWVGWVPQSSCGQNGNLAGSIYSIRNLKINGSVVKGTRPRTC
Ga0247646_127746813300030546SoilGGFKLSDYCDGSKNGSDWCVEVDWIESNGGCGGQSTLHTRPGPGSTGCTAWGCASAYLYNGKSSFHMVVTYDSSGRWTTTHNGQVISPTNLNPEPEDYDWQMVQEYYTKRGSVVYGSQWVGWVPISSCGPNGNLDGSVYTVRNLNINGTLVQGPEPRRC
Ga0247656_114335213300030547SoilTHPGVNANFYSISPVFSGDFDVKEYCDGSKTGSDWCVEVDWIESNGHCGGQSTLHTRPGPGETGCTAWGCAATYMYNGKPSFHMEIRYDASGQWTTVHDGMVINPSNLNPQPQSQDWSTLVEQYSKQGSVLYGSQWVGWVPISSCGSNGDLAGSSYSIKNIRINGTHLQGPTPSLC
Ga0247656_116563613300030547SoilHKGVNANLYTISPTFSGSFTAKDYCDGAKPAGADWCTEVDWIESNGPCGGQTTLHTRPGPGSDGCTAWGCEATYMYNGRNSFHMEIRYDANGQWTTVHDGQTISPSNLSPQPQAQDWSTLVQYYSKQGAVIYGSQWVGWVPVQACGPNGDLNGSKYSVKNLKINGVHMQGPVPKTC
Ga0247656_118045713300030547SoilANIFSISPIITSGGFKLADYCDGSKNGSDWCVEVDWIESNGACGGQSTLHTRPGPGSTGCTAWGCAEDYMYNGKSSFHMVVSYDSTGHWTTTHDGQVISPTNLNPEPQDYDWQMVQEYYTKRGSVVYSSQWVGWVPISSCGPNGNLAGSIFSVKNLKINGTLVQGPEPHRC
Ga0247656_122924913300030547SoilPVYSGSFKLTDYCDGAKTGADWCVEVDWIESNGNCGGQTTLHTRQGPGSTGCTAWGCAATYMYNGKSSFHMEIRYDANGQWTTVHDGQTIAPSNLNPQPQAQDWSTLMQAYAKQGAVIYGSQWVGWVPVTACGPNGKLDGSKYSVKNLKINGVHTQGPAPKTC
Ga0247631_113599913300030550SoilIYSISPKFSGSFNINDYCDGAKTGNDWCVEVDWIESNGGCGGQTTLHTRPGPGSDGCTAWGCANAYQYNGKNSFHMVESYDAQGHWTTTHNGVVINPTNLSPQPQQQDWTALQQYYSTRGAVVYGSQWVGWVPIDSCGSNGNLAGSVYTVRNLKITGTVVQGPTPHSC
Ga0247631_117218513300030550SoilANIYSISPVFSGDFNIKDYCDGAKTGNDWCVEVDWIESNGNCGGQTTLHTRPGPGSTGCTAWGCAATYMYNGKPSFHMVVSYDAQGHWTTVHDGQTIAPNNLSPQPQDQDWSTLVSQYSKQGAVIYGSQWVGWTPVPSCGSNGNLEGSKYSIRNLKINGVHTQGPVPKSC
Ga0247638_117143013300030551SoilYSISPQLSGDFDNKLYCDGQKNGTEWCLEVDWIESNGGCGGQTTLHSRPGPGSTGCTAWGCANSYMYNGKSSFHMVISFDEQGKWTTTHDGIVISASNLSPPPQDQDWQVVQQYLSQRGAVIYGSQWVGWVPQSSCGQNGNLAGSVYSIRNLKINGSVVKGTRPRTC
Ga0247654_102923123300030552SoilMELKTGNDWCVEVDWIESNGNCGGQTTLHTRPGPGSTGCTAWGCAATYMYNGHPSFHMTVSYDAQGHWTTVRDGQTIAPNNLSPQPQDQDWSTLVSQYAKQGATVYGSQWVGWTPVPSCGSNGNLDGSKYTVRNLKINGVHTQGPVPKSC
Ga0247645_114361313300030553SoilPGVNANLYSISPVFSGTFNVKDYCDGSKTGNDWCVEVDWIESNGNCGGQTTLHTRPGPGSTGCTAWGCAATYMYNGHSSFHMVVSYDAQGHWTTVRDGNTIAPGNLNPQPQDQDWSTLVSQYNKQGAVVYGSQWVGWTPVPSCGSNGNLDGSKYTIRNLKINGVHMQGPVPKSC
Ga0247618_114155813300030555SoilATHPGVNANFYSISPVFSGDFNVKDYCDGSKTGSDWCVEVDWIESNGHCGGQSTLHTRPGPGSNGCTAWGCAATYMYNGKPSFHMEIRYDTNGQWTTIHDGVVINPTNLSPQPQSQDWSTLVQQYSKQGAVFFGSQWVGWVPVSDCGSNGDIAGSVYSIKNIRINGTHIQGPTPSLC
Ga0247653_111262213300030563SoilGQKNGTEWCLEVDWIESNGGCGGQTTLHSRPGPGSTGCTAWGCAASYMYNGKSSFHMVVSFDSSGKWTTTHDGQVIGPNNLAPVPQQEDWQVVQQYLSQRGAVIYGSQWVGWVPDSSCGNNGNLVGSVYSVRNLKITGTVVKGPEPRKC
Ga0247635_124725813300030565SoilPGVNANIFSISPIITSGGFKLADYCDGSKNGSDWCVEVDWIESNGACGGESTLHTRPGPGSTGCTAWGCLEAYMYNGKSSFHMVVSYDSSGHWTTTHDGQVISPTNLNPEPQDYDWQMVQEYYTKRGSVVYSSQWVGWVPISSCGPNGNLAGSIFSVKNLKINGTLVQGPEPHRC
Ga0247635_133419113300030565SoilDYCDGAKPAGADWCTEVDWIESNGPCGGQTTLHTRPGPGSDGCTAWGCEATYMYNGRNSFHMEIRYDANGQWTTVHDGQTISPSNLSPQPQAQDWSTLVQYYSKQGAVIYGSQWVGWVPVTACGPNGKLDGSKYSVKNLKINGVHTQGPAPKTC
Ga0247628_119193613300030569SoilNIYSISPQLSGDFDNKLYCDGQKNGTEWCLEVDWIESNGGCGGQTTLHSRPGPGSTGCTAWGCANSYMYNGKSSFHMVISFDEQGKWTTTHDGIVISASNLSPPPQDQDWQVVQQYLSQRGAVIYGSQWVGWVPQSSCGQNGNLAGSVYSIRNLKINGSVVKGTRPRTC
Ga0247628_120455613300030569SoilIDLSATHPGVNANIYAICPVFSGSFNINDYCDGAKTGNDWCVEVDWIESNGGCGGQTTLHTRPGPGSTGCTAWGCAASYTYNGKNSFHMEIRYDANGQWTTIHDGQTIAPANLSPQPQSQDWSTLVSQYSKQGATIYGSQWVGWVPVPSCGGNGNLGGSKYSVKNLKINGVHTQGPVPKS
Ga0247652_116682213300030571SoilPGVNANIYTISPTFSGSFNNKAYCDGAKTGADWCTEVDWIESNGPCGGQTTLHTRPGPGSDGCTAWGCEATYMYNGRNSFHMEIRYDANGQWTTVHDGQTISPSNLSPQPQAQDWSTLVQYYSKQGAVIYGSQWVGWVPVQACGPNGDLNGSKYSVKNLKINGVHMQGPVPKTC
Ga0247648_114998113300030574SoilGVNANIFSISPMISSGGFKLSDYCDGSKNGSDWCVEVDWIESNGGCGGQSTLHTRPGHVSTGCDAGGCAADYLYNGRTSFHMVVSYDSSGRWTTTHDGKVISPTNLNPQPQDYDWQMVQQYYTQRGSVLYGSQWVGWVPISSCGPNGNLAGSIYSVRNLRINGTIVQGPEPRRC
Ga0247648_119467113300030574SoilKLYCDGQKNGTEWCLEVDWIESNGGCGGQTTLHSRPGPGSTGCTAWGCANSYMYNGKSSFHMVISFDAQGKWTTTHDGIVISSGNLSPQPQDQDWQVVQQYLSQRGAVIYGSQWVGWVPQSSCGQNGNLAGSIYSIRNLKINGSVVKGTRPRTC
Ga0247644_116727313300030576SoilPVYSGSFKLTDYCDGAKTGADWCVEVDWIESNGNCGGQTTLHTRQGPGSTGCTAWGCAATYMYNGKSSFHMEIRYDANGQWTTVHDGQTIAPSNLNPQPQAQDWSTLMQAYAKQGAVIYGSQWVGWVPVSACGPNGKLDGSKYSVKNLKINGVHTQGPAPKTC
Ga0210260_1036849713300030577SoilSPDFSGSFQNTDYCDGQKNGTEWCLEVDWIESNGGCGGQTTLHSRPGPGSTGCTAWGCANSYTYNGKSAFHMVVSFDSTGKWTTTHDGVVINPSNLSPQPQDYDWQIVQQYYSQRGAVIYGSQWVGWVPLTSCGSNGALAGSVYSVKNMKITGTVVKGPEPKQC
Ga0210275_1038787713300030578SoilGSFQNTDYCDGQKNGTEWCLEVDWIESNGGCGGQTTLHSRPGPGSTGCTAWGCANSYTYNGKSAFHMVVSFDSQGKWTTTHDGVVINPANLSPQPQDYDWQIVQQYYSQRGAVIYGSQWVGWVPLTSCGNNGNLAGSVYSVKNIKITGTVVKGPEPKQC
Ga0247633_1027133413300030579SoilVNANIYTISPVYSGSFKLTDYCDGAKTGADWCVEVDWIESNGNCGGQTTLHTRQGPGSTGCTAWGCAATYMYNGKSSFHMEIRYDANGQWTTVHDGQTIAPSNLNPQPQAQDWSTLMQAYAKQGAVIYGSQWVGWVPVTACGPNGKLDGSKYSVKNLKINGVHTQEPAPKTC
Ga0247633_1028303913300030579SoilDFSGSFTNKEYCDGQKNGTEWCLEVDWIESNGGCGGQTTLHSRPGPGSNGCTAWGCAASYMYNGKSSFHMVVSFDSSGKWTTTHDGQVIGPNNLAPVPQQEDWQVVQQYLSQRGAVIYGSQWVGWVPDSSCGSNGDLVGSVYSVKNLKITGTVVKGPEPHKC
Ga0247633_1035073013300030579SoilGSFNINDYCDGAKTGNDWCVEVDWIESNGGCGGQTTLHTRPGPGSDGCTAWGCANAYQYNGKNSFHMVESYDAQGHWTTTHNGVVINPTNLSPQPQQQDWTALQQYYSTRGAVVYGSQWVGWVPIDSCGSNGNLAGSVYTVRNLKITGTVVQGPTPHSC
Ga0210261_117899113300030582SoilYDLDFTKTHPGVNANIYSISPDFSGSFQNTDYCDGQKNGTEWCLEVDWIESNGGCGGQTTLHSRPGPGSTGCTAWGCANSYTYNGKSAFHMVVSFDSTGKWTTTHDGVVINPANLSPQPQDYDWQIVQQYYSQRGAVIYGSQWVGWVPLTSCGNNGNLAGSVYSVKNLKITGTVVKGPEPRK
Ga0210262_117798313300030583SoilFDIDLSATHPGVNANIYSISPVFSGSFNINAYCDGAKTGSDWCVEVDWIESNGHCGGQTTLHTRAGPGSTGCTAWGCAASYQYNGRDSFHMVISYDAQGHWTTVRDGQTIAPNNLNPQPQDQDWSTLMQQYSKQGAVVYGSQWVGWVPVPSCGGNGQLDGSKYSIKNLKINGVHMQGPVPKSC
Ga0247658_110254313300030584SoilNIYSISPELSGDFDQKLYCDGQKNGTEWCLEVDWIESNGGCGGQTTLHSRPGPGSTGCTAWGCANSYMYNGKSSFHMVISFDAQGKWTTTHDGIVISSGNLSPQPQDQDWQVVQQYLSQRGAVIYGSQWVGWVPQSSCGQNGNLAGSIYSIRNLKINGSVVKGTRPRTC
Ga0247658_113621713300030584SoilIYSISPVFSGDFNIKDYCDGSKTGNDWCVEVDWIESNGNCGGQTTLHTRPGPGSTGCTAWGCAATYMYNGKPSFHMVVSYDAQGHWTTVHDGQTIAPNNLSPQPQDQDWSTLVSQYSKQGAVIYGSQWVGWTPVPSCGSNGNLEGSKYSIRNLKINGVHTQGPVPKSC
Ga0247643_119336213300030590SoilMGIVEGNRRCIRDLGPGSNGCTAWGCAATYMYNGKPSFHMEIRYDMNGQWTTVHDGEVINPSNLNPQPQSQDWSTLVQQYSKQGAVLYGSQWVGWVPVSSCGSNGDLAGSVYSIKNIRINGTHVQGPTPSLC
Ga0247643_119973913300030590SoilDFNVKDYCDGSKTGSDWCVEVDWIESNGHCGGQSTLHTRPGPGETGCTAWGCAATYMYNGKPSFHMEIRYDASGQWTTVHDGMVINPSNLNPQPQSQDWSTLVEQYSKQGSVLYGSQWVGWVPISSCGSNGDLAGSSYSIKNIRINGTHLQGPTPSLC
Ga0210280_116597613300030594SoilYSISPTFSGSFKNTDYCDGSKTDAGWCVEVDWIESNGPCGGQTTLHTRAGPGSNGCTAWGCAATYLYNGKPSFHMVVSFDNAGHWTTIHDGIVINPGNLNPQPQDLDWQTLVQQYTKMGAVVYSSQWVGWVPVSSCGGNGVLDGSVYRVSNLKINGTLVQGPEPRKC
Ga0247659_119421813300030600SoilANFYSISPVFSGDFDVKEYCDGSKTGSDWCVEVDWIESNGHCGGQSTLHTRPGPGENGCTAWGCLAAYMYAKPSFHMEIRYDTNGQWTTVHDGVVINPSNLNPQPQSQDWSTLVSQYSKQGSVLYGSQWVGWVPISSCGSNGDLAGSSYSIKNIRINGTHVQGPTPSLC
Ga0247650_106053813300030601SoilVGLRLKPRLTSLEDQWNMISIFPKLILELMLIFFSISPMISSSGFKLSDYCDGSKNGSDWCVEVDWIESNGGCGGQSTLHTRPGPGSTGCTAWGCASAYLYNGKSSFHMVLTYDSSGRWTTTHDGKVISPTNLSPEPEDYDWQMVQEYYTKRGSVVYGSQWVGWVPISSCGPNGNLAGSVYTVKNLKINGTLVQGPEPRRC
Ga0247650_111595613300030601SoilSPDFSGSFTNKEYCDGQKNGTEWCLEVDWIESNGGCGGQTTLHSRPGPGSNGCTAWGCAASYMYNGKSSFHMVVSFDSSGKWTTTHDGQVIGPNNLAPVPQQEDWQVVQQYLSQRGAVIYGSQWVGWVPDSSCGSNGDLVGSVYSVKNLKITGTVVKGPEPNKF
Ga0247637_118087413300030604SoilIYSISPQLSGDFDNKLYCDGQKNGTEWCLEVDWIESNGGCGGQTTLHSRPGPGSTGCTAWGCANSYTYNGKSSFHMVISFDEQGKWTTTHDGVVISPTNLSPQPQNEDWQVVQQYLSQRGAVIYSSQWVGWVPVSSCGQNGNLAGSVYSVRNLKINGSVVKGTRPRTC
Ga0247637_118835813300030604SoilPPVYSGSFKLTDYCDGAKTGADWCVEVDWIESNGNCGGQTTLHTRQGPGSTGCTAWGCAATYMYNGKSSFHMEIRYDANGQWTTVHDGQTIAPSNLNPQPQAQDWSTLMQAYAKQGAVIYGSQWVGWVPVTACGPNGKLDGSKYSVKNLKINGVHTQGPAPKTC
Ga0247637_120735913300030604SoilFSGSFNINDYCDGAKTGNDWCVEVDWIESNGGCGGQTTLHTRPGPGSTGCTAWGCAASYTDNGKNSFHMEIRYDANGQWTTIHDGQTIAPANLSPQPQSQDWSTLVSQYSKQGATIYGSQWVGWVPVPSCGGNGNLGGSKYSVKNLKINGVHTQGPVPKSC
Ga0247637_121252713300030604SoilTFSGSFTAKDYCDGAKPAGADWCTEVDWIESNGPCGGQTTLHTRPGPGSDGCTAWGCEATYMYNGRNSFHMEIRYDANGQWTTVHDGQTISPSNLSPQPQAQDWSTLVQYYSKQGAVIYGSQWVGWVPVQACGPNGDLNGSKYSVKNLKINGVHMQGPVPKTC
Ga0210265_111296713300030605SoilDLDFTKTHPGVNANIYSISPDFSGSFQNTDYCDGQKNGTEWCLEVDWIESNGGCGGQTTLHSRPGPGSTGCTAWGCANSYTYNGKSAFHMVVSFDSTGKWTTTHDGVVINPANLSPQPQDYDWQIVQQYYSQRGAVIYGSQWVGWVPLTSCGNNGNLAGSVYSVKNLKITGTVVKGPEPRKC
Ga0210265_116942113300030605SoilYSICPQFTGGFNQNDYCDGSKTGSDWCVEVDFIESNGQCGGQSTLHTREGPGNDGCTAWGCESNYLYNGKTAFHMVVSFDSAGHWTTIHDGIVISPNTLNPQPQDQDWQTLQQQYTKFGAVIYSSQWVGWVPVNSCGGNGNVDGSVYTVKNLRINGTVVQGPEPTKCF
Ga0247615_1032191713300030607SoilGDFNIKDYCDGSKTGNDWCVEVDWIESNGNCGGQTTLHTRPGPGSTGCTAWGCAATYMYNGKPSFHMVVSYDAQGHWTTVHDGQTIAPNNLSPQPQDQDWSTLVSQYSKQGAVIYGSQWVGWTPVPSCGSNGNLEGSKYSIRNLKNKCVHTQEPIPKSF
Ga0247651_1025867813300030608SoilIFSISPMISSSGFKLSDYCDGSKNGSDWCVEVDWIESNGGCGGQSTLHTRPGPGSTGCTAWGCASAYLYNGKSSFHMVLTYDSSGRWTTTHDGKVISPTNLSPEPEDYDWQMVQEYYTKRGSVVYGSQWVGWVPISSCGPNGNLAGSIYSVRNLKINGTLVQGPEPRRC
Ga0247634_1039201313300030609SoilVDFSQTHPGVNANIYSISPQLSGDFDNKLYCDGQKNGTEWCLEVDWIESNGGCGGQTTLHSRPGPGSTGCTAWGCANSYTYNGKSSFHMVISFDEQGKWTTTHDGVVISPTNLSPQPQNEDWQVVQQYLSQRGAVIYSSQWVGWVPLTSCGQNGNLAGSVYSVRNLKINGSVVKGTRPRT
Ga0247657_1021382313300030614SoilGVNANIFSISPIITSEGFKLADYCDGSKNGSDWCVEVDWIESNGACGGQSTLHTRPGPGSTGCTAWGCAEDYMYNGKSSFHMVVSYDSTGHWTTTHDGQVISPTNLNPEPQDYDWQMVQEYYTKRGSVVYGSQWVGWVPISSCGPNGNLAGSIYSVRNLKINGTLVQGPEPRRC
Ga0257185_1037365213300030615Host-AssociatedNANIYTISPTFAGSFSAKAYCDGAKTGADWCAEVDWIESNGHCGGQTTLHTKEGPGTNGCTAWGCAATYMYNGHESFHMEIRYDANGQWTTIHDGQTIAPSNLNPQPQSSDWSVLVDYYTKKGGVIYGSQWVGWVPVTSCGPNGNLEGSKYSIKNLKINGVHLQGPEPKQC
Ga0257185_1041903813300030615Host-AssociatedGSFQNTDYCDGQKNGTEWCLEVDWIESNGGCGGQTTLHSRPGPGSTGCTAWGCANSYTYNGKSAFHMVVSFDSTGKWTTTHDGVVINPSNLSPQPQDYDWQIVQQYYSQRGAVIYGSQWVGWVPLTSCGSNGALAGSVYSVKNMKITGTVVKGPEPKQC
Ga0247655_1032639113300030621SoilFSGQFGINDYCDGAKTGNEWCVEVDWIESNGGCGGQTTLHTRPGPGSTGCTAWGCAADYQYNGKNSFHMVESYDAEGKWTSSHDGVVINPTNLSPQPQDQDWTTLKQYYQQFGAVVYGSQWVGWVPINSCGSNGDLNGSVYVVKNLKITGTVVQGPEPHRC
Ga0265391_1020829013300030622SoilLDFTKTHPGVNANIYSISPDFSGSFQNTDYCDGQKNGTEWCLEVDWIESNGGCGGQTTLHSRPGPGSTGCTAWGCANSYTYNGKSAFHMVVSFDSTGKWTTTHDGVVINPANLSPQPQDYDWQIVQQYYSQRGAVIYGSQWVGWVPLTSCGNNGNLAGSVYSVKNLKITGTVVKGPEPRK
Ga0265392_117982513300030623SoilPGVNANIYSISPVFSGSFSINAYCDGAKTGSDWCVEVDWIESNGHCGGQTTLHTRAGPGSTGCTAWGCAATYQYNGRDSFHMVISYDAQGHWTTVRDGQTIAPNNLNPQPQDQDWNTLVQQYSKQGAVVYGSQWVGWVPVPSCGGNGQLDGSKYTIKNLKINGVHVQGPVPKSC
Ga0265392_125986613300030623SoilFNPSNYCDGSKTGSDWCAEVDFIESNGQCGGQTTLHTRQGPGSTGCTAWGCGADYLYNGKKTFNLVVKFDSAGHWTTIHDGVVISPTGLNPQPQDQDWQTLQQQYSKFGAVIYSSQWVGWVPVSSCGGNGNLSGSVYTVRNLRINGTVVQGPEPNKC
Ga0210259_1069282413300030625SoilPGVNANIYSICPTFTGSFKNTDYCDGSKNESGWCVEVDFIESNDPCGGQTTLHTLVGPGENGCTAWGCLSTYLYTGKTAFHMVVSFDQTGQWTTTHDGIVINPSSLNPLPQTLDWQTLQQQYTKTGAVIYSTQWVGWVPMESTCGPNGVLSGSVYKVSNLKINGTLVQGPEP
Ga0210269_1031019313300030627SoilFDVDFSGTHRGVNANIYTISPNFNGDFNPKLYCDGAKTGSDWCVEVDWIESNGNCGGQTTLHTRPGPGSDGCTAWGCGKSYMYGSRPSFHMKILYDSNGKWTTIRDGVIIGPQDLNPRPQDQDWSTLVDHYRRNGAVIYSSQWVGWTPVDSCGSNGVLDGSFFAIKNLKINGTLVHGPEPRKC
Ga0210250_1085107313300030632SoilLDFSKVHQGVNANIYSICPAFSGSFKNTDYCDGSKTGADWCVEVDWIESNGPCGGQSTLHTRPGPGETGCTAWGCASSYLYNGKSAFHMVISYDESGHWTTTHDGVVINPNNLNPVPQDYDWQMVQQQYGKNGAVFYSSQWVGWVPITNSCGGNGALDGSVYSVSNLKINGSV
Ga0247623_1025442813300030633SoilGDFDNKLYCDGQKNGTEWCLEVDWIESNGGCGGQTTLHSRPGPGSTGCTAWGCANSYMYNGKSSFHMVISFDAQGKWTTTHDGIVISSGNLSPQPQDQDWQVVQQYLSQRGAVIYGSQWVGWVPQSSCGQNGNLAGSIYSIRNLKINGSVVKGTRPRTC
Ga0247627_1032491013300030635SoilLSDYCDGSKNGSDWCVEVDWIESNGGCGGQSTLHTRPGPGSTGCTAWGCASAYLYNGKSSFHMVLTYDSSGRWTTTHDGKVISPTNLSPEPEDYDWQMVQEYYTKRGSVVYGSQWVGWVPISSCGPNGNLAGSIYSVRNLKINGTLVQGPEPRRC
Ga0247622_115124413300030682SoilTHFGVNANIYVICPVFSGSFNINDYCDGAKTGNDWCVEVDWIESNGGCGGQTTLHTRPGPGSTGCTAWGCAASYTYNGKNSFHMEIRYDANGQWTTIHDGQTIAPANLSPQPQSQDWSTLVSQYSKQGATIYGSQWVGWVPVPSCGGNGNLGGSKYSVKNLKINGVHTQGPVPKSC
Ga0247622_116643713300030682SoilQLSGDFDNKLYCDGQKNGTEWCLEVDWIESNGGCGGQTTLHSRPGPGSTGCTAWGCANSYMYNGKSSFHMVISFDEQGKWTTTHDGIVISASNLSPPPQDQDWQVVQQYLSQRGAVIYGSQWVGWVPQSSCGQNGNLAGSVYSIRNLKINGSVVKGTRPRTC
Ga0247622_118756813300030682SoilQLSGDFDNKLYCDGQKNGTEWCLEVDWIESNGGCGGQTTLHSRPGPGSTGCTAWGCANSYMYNGKSSFHMVISFDAQGKWTTTHDGIVISSGNLSPQPQDQDWQVVQQYLSQRGAVIYGSQWVGWVPQSSCGQNGNLAGSIYSIRNLKINGSVVKGTRPRTC
Ga0247617_109430413300030684SoilANIYTISPVYSGSFKLTDYCDGAKTGADWCVEVDWIESNGNCGGQTTLHTRQGPGSTGCTAWGCAATYMYNGKSSFHMEIRYDANGQWTTVHDGQTIAPSNLNPQPQAQDWSTLMQAYTKQGAVIYGSQWVGWVPVTACGPNGKLDGSKYSVKNLKINGVHTQGPAPKTC
Ga0247617_112219913300030684SoilAICPVFSGSFNINDYCDGAKTGNDWCVEVDWIESNGGCGGQTTLHTRPGPGSTGCTAWGCAASYTYNGKNSFHMEIRYDANGQWTTIHDGQTIAPANLSPQPQSQDWSTLVSQYSKQGATIYGSQWVGWVPVPSCGGNGNLGGSKYSVKNLKINGVHTQGPVPKSC
Ga0265460_1215342113300030740SoilDIDFSQTHPGVNANIFSISPIITAEGFKLADYCDGAKNGSDWCVEVDWIESNGGCGGQSTLHTRPGPGSTGCTAYGCAADYMYNGRSSFHMVVSYDSTGHWTTTHDGQVISPTNLNPEPQDYDWQMVQEYYTKRGSVVYGSHWVGWVPISSCGPNGNLEGSVYSVRNLKINGTLVQGPEPRRC
Ga0265460_1261467013300030740SoilGVNANIYSICPTFTGSFKNTDYCDGSKNESGWCVEVDFIESNGPCGGQTTLHTRVGPGENGCTAWGCLSTYLYTGKTAFHMVVSFDQTGQWTTTHDGIVINPSSLNPLPQTLDWQTLQQQYTKTGAVIYSTQWVGWVPMESTCGPNGVLSGSVYKVSNLKINGTLVQGPEPTKC
Ga0265459_1367793413300030741SoilPGVNANIYSICPTFTGSFKNTDYCDGSKNESGWCVEVDFIESNDPCGGQTTLHTRVGPGENGCTAWGCLSTYLYTGKTAFHMVVSFDQTGQWTTTHDGIVINPSSLNPLPQTLDWQTLQQQYTKTGAVIYSTQWVGWVPMESTCGPNGVLSGSVYKVSNLKINGTLVQGPEPTKC
Ga0265459_1395832413300030741SoilPTFTGSFNLSDYCDGSKTGTDFCVEVDFIESNGPCGGQSTLHTVEGKDKGCNAFGCEVDYLFNGKSAFHMILSFDETGHWTTNYDGVIISPNSLKPLPGDSDWQMVQDTFSKVGTVIYSSQWVGWVPDTDSCGGNGVLDGSVYKLSNLRINGTHIQGPEPNKCF
Ga0265461_1309236513300030743SoilTFNPIDFYAPICPSFTSITIISILETTTKSWTNWCVEVHWIESNGPCGGQSTLHTRPGPGETGCTAWGCASSYLYNGKSAFHMVISYDESGHWTTTHDGVVINPNNLNPVPQDYDWQMVQQQYGKNGAVFYSSQWVGWVPITNSCGGNGALDGSVYSVSNLKINGTVVNGPEPKKC
Ga0074043_1044611013300030748SoilSPVFSGDFNVKDYCDGSKTGSDWCVEVDWIESNGHCGGQSTLHTRPGPGSNGCTAWGCAATYMYNGKPSFHMEIRYDANGQWTTVHDGAVINPSNLSPQPQAQDWSTLVGQYSKQGAVLYGSQWVGWVPVSSCGSNGDLAGSTYSIKNIRINGTHVQGPTPSLC
Ga0074043_1058314723300030748SoilVFSGSFNINAYCDGAKTGSDWCVEVDWIESNGHCGGQTTLHTRAGPGSTGCTAWGCAATYQYNGRDSFHMVISYDAQGHWTTVRDGQTIAPNNLNPQPQDQDWSTLMQQYSKQGAVVYGSQWVGWVPVPSCGGNGQLDGSKYSIKNLKINGVHMQGPVPKSC
Ga0074043_1153898213300030748SoilPDFSGSFQNTDYCDGQKNGTEWCLEVDWIESNGGCGGQTTLHSRPGPGSTGCTAWGCANSYTYNGKSAFHMVVSFDSTGKWTTTHDGVVINPSNLSPQPQDYDWQIVQQYYSQRGAVIYGSQWVGWVPLTSCGSNGALAGSVYSVKNMKITGTVVKGPEPKQC
Ga0102764_187205313300030751SoilKDYCDGAKTGNDWCVEVDWIESNGNCGGQTTLHTRPGPGSTGCTAWGCAATYMYNGKPSFHMTVSYDAQGHWTTVRDGQTIAPNNLNPQPQDQDWSTLLSQYAKQGATIYGSQWVGWTPVPSCGSNGNLDGSKYTVRNLKINGVHTQGPEPKTC
Ga0075378_1101725213300030779SoilHPGVNANIFSISPMISSGGFKLSDYCDGSKNGSDWCVEVDWIESNGGCGGQSTLHTRPGPGSTGCTAWGCAASYLYNGKSSFHMVVTYDSSGHWTTTHDGQVISPPNLNPEPQDYDWQMVQEYYTKRGSVVYGSQWVGWVPISSCGPNGNLAGSVYSVRNLKINGTLVQGPEPRRC
Ga0138304_113786513300030790SoilKLYCDGQKNGTEWCLEVDWIESNGGCGGQTTLHSRPGPGSTGCTAWGCANSYTYNGKSSFHMVISFDEQGKWTTTHDGVVIGPGNLSPPPQDQDWQVVQQYLSQRGAVIYSSQWVGWVPVSSCGQNGNLAGSVYSVRNLKINGSVVKGTRPRTC
Ga0073999_1099142613300030839SoilVNANIFSISPIITTEGFKLADYCDGSKNESDWCVEVDWIESNGGCGGQSTLHTRPGPGSTGCTAWGCEADYMYNGRSSFHMVVSYDSSGHWTTTHDGQVISPTNLNPEPQDYDWQMVQEYYTKRGSVVYGSQWVGWVPISSCGPNGNLAGSVYTVRNLKINGTLVQGPEPRRC
Ga0075404_1122094513300030842SoilPGVNANIYSISPVFSGSFNINAYCDGAKTGSDWCVEVDWIESNGHCGGQTTLHTRAGPGSTGCTAWGCAASYQYNGRDNFHMVISYDAQGHWTTVRDGQTIAPNNLSPQPQDQDWSTLVQQYSKQGAVVYGSQWVGWVPVPSCGGNGQLDGSKYSIKNLKINGVHVQGPVPKSC
Ga0075392_1102224923300030843SoilVFSGSFNINAYCDGAKTGSDWCVEVDWIESNGHCGGQTTLHTRAGPGSTGCTAWGCAASYQYNGRDNFHMVISYDAQGHWTTVRDGQTIAPNNLSPQPQDQDWSTLVQQYSKQGAVVYGSQWVGWVPVPSCGGNGQLDGSKYSIKNLKINGVHVQGPVPKSC
Ga0075392_1124004413300030843SoilTHPGVNANFYSISPVFSGDFNVKDHCDGSKTGSDWCVEVDWIESNGHCGGQSTLHTRPGPGSNGCTAWGCAATYMYNGKPSFHMEIRYDANGQWTTVHDGAVINPSNLSPQPQAQDWSTLVGQYSKQGAVLYGSQWVGWVPVSSCGSNGDLAGSTYSIKNIRINGTHVQGPTPSLC
Ga0075387_1002822113300030850SoilYDIDLSQTHPGVNANIYSISPQLSGDFDNKLYCDGQKNGTEWCLEVDWIESNGGCGGQTTLHSRPGPGSTGCTAWGCANSYMYNGKTSFHMVISFDEQGKWTTTHDGIVISASNLSPPPQDQDWQVVQQYLSQRGAVIYGSQWVGWVPQSSCGQNGNLAGSVYSIRNLKINGSVVKGTKPRTC
Ga0075387_1013087613300030850SoilANIYSISPDFSGSFQNTDYCDGQKNGTEWCLEVDWIESNGHCGGQTTLHSRPGPGDTGCTAWGCANSYTYGATTAFHMVVSFDSTGKWTTSHNGVVINPGNLSPQPQDYDWQVVQQYYSQRGAVIYSSQWVGWVPVTSCGGNGVLAGSVYSVKNLKITGTVVKGPEPRKC
Ga0075380_1144391113300030851SoilATHPGVNANFYSISPVFSGDFNVKDYCDGSKTGSDWCVEVDWIESNGHCGGQSTLHTRPGPGSNGCTAWGCAATYMYNGKPSFHMEIRYDANGQWTTVHDGAVINPSNLSPQPQAQDWSTLVGQYSKQGAVLYGSQWVGWVPVSSCGSNGDLAGSTYSIKNIRINGTHVQGPTPSLC
Ga0075374_1018734613300030855SoilNFYSISPVFSGDFNVKDYCDGSKTGSDWCVEVDWIESNGHCGGQSTLHTRPGPGSNGCTAWGCAATYMYNGKPSFHMEIRYDANGQWTTVHDGAVINPSNLSPQPQAQDWSTLVGQYSKQGAVLYGSQWVGWVPVSSCGSNGDLAGSTYSIKNIRINGTHVQGPTPSLC
Ga0102759_193055513300030858SoilNIYSISPQLTGDFDNKLYCDGQKNGTEWCLEVDWIESNGGCGGQTTLHSRPGPGSTGCTAWGCANSYMYNGKSSFHMVISFDEQGKWTTTHDGIVINAGNLSPPPQDQDWQVVQQYLSQRGAVIYGSQWVGWVPQSSCGQNGNLAGSVYSIRNLKINGSVVKGTRPRTC
Ga0074033_1070219813300030909SoilSFTGSFKNTDYCDGAKTGADWCTEVDFIESNGPCGGQTTLHTREGPGENGCTAWGCEANYLYNGKSSFHMIVAFDEIGHWTTTHDGIVISPNNLSPVPQDQDWLTLQQHYTKEGAVIYSSQWVGWVPVTSCGGNGNLDGSVFKVSNIRINGTVVQGPEPNKCF
Ga0074033_1101537223300030909SoilVDWIESNGHCGGQSTLHTRPGPGSNGCTAWGCAATYMYNGKPSFHMEIRYDANGQWTTVHDGAVINPSNLSPQPQAQDWSTLVGQYSKQGAVLYGSQWVGWVPVSSCGSNGDLAGSTYSIKNIRINGTHVQGPTPSLC
Ga0138300_119247013300030922SoilDFSGDFDNKDYCDGQKNGTEWCLEVDWIESNGGCGGQTTLHSRPGPGSTGCTAWGCANSYTYNGKSSFHMVISFDEQGKWTTTHDGVVISPSNLSPPPQDQDWQVTQQYLSQRGAVIYGSQWVGWVPLSSCGQNGNLAGSVYSVRNLKINGSVVKGTRPRTC
Ga0138300_142014213300030922SoilEGFKLADYCDGAKNESDWCVEVDWIESNGGCGGASTLHTRPGPGTTGCTAWGCEADYMYNGKSSFHMVASYDSSGHWTTTHDGQVISPTNLNPEPQDYDWQMVQEYYTKRGSVVYGSQWVGWVPIPSCGPNGNLAGSIYSVRNLKINGTLVQGPEPRRC
Ga0075391_1088681713300030934SoilSFSGSFSQGSYCDGAKTGSSWCVEVDWIESNGNCGGQSTLHTRPGPGSNGCTAWGCAKDYYYNSRPSFHVKIIYDTNGKWTTIHDGAYISPGDLNPKAQDQDWSTLAEQYKGNGAVIYSSQWVGWVPLSSCGSNGNLNGSSYSISNLVINGSHVHGPEPRKC
Ga0075401_1183244613300030935SoilDFSQTHPGVNANIFSISPVISSGGFKLSDYCDGSKNGSDWCVEVDWIESNGGCGGQSTLHTRPGPGSTGCTAWGCAASYLYNGKSSFHMVVTYDSSGRWTTTHDGKVISPTNLNPEPQDYDWQMVQEYYTKRGSVVYGSQWVGWVPISSCGPNGNLDGSVYSVKNLKINGTLVQGPEPRR
Ga0138302_106180713300030937SoilDFNIKSYCDGSKTGNDWCVEVDWIESNGNCGGQTTLHTRPGPGSTGCTAWGCEATYMYNGHNSFHMMVSYDAQGHWTTVRDGQTIAPNNLNPQPQDQDWNTLVSQYSKQGAVVYGSQWVGWTPVPACGSNGNLDGSRYSIRNLKINGVHMQGPVPKSC
Ga0138302_106576213300030937SoilGVNANIYSISPKFSGQFSQAAYCDGSKTGADWCVEVDYIESNGPCGGQSTLHTREGPGSTGCTAWGCASDYLYNGRNSFHMQVLFDSAGHWTTIHDGVVIAPNSLNPQPQDQDWQALQQQYSQFGAVIFSSQWVGWVPVNSCGGNGNLNGSVYSVKNLRINGTVVQGPEPNKCF
Ga0138302_180692913300030937SoilGVNANIYSISPDFSGSFQNTDYCDGQKNGTEWCLEVDWIESNGGCGGQTTLHSRPGPGSNGCTAWGCANSYTYNGKSAFHMVVSFDSTGKWTTTHDGVVINPSNLSPQPQDYDWQMVQQYYSQRGAVIYGSQWVGWVPLTSCGNNGDLAGSVYSVKNLKITGTVVKGPEPKQC
Ga0138299_1052833013300030938SoilGTHPGVNANLYSISPIFSGSFDIKDYCDGAKTGNDWCVEVDWIESNGNCGGQTTLHTRQGPGSTGCTAWGCAATYMYNGHPSFHMTVSYDAQGHWTTVRDGQTIAPNNLNPQPQDQDWSTLVSQYAKQGATVYGSQWVGWTPVPSCGSNGNLDGSKYTVRNLKINGVHTQGPVPKSC
Ga0075379_1148557313300030946SoilQTHPGVNANIFSISPMISSGGFKLSDYCDGSKNGSDWCVEVDWIESNGGCGGQSTLHTRPGPGSTGCTAWGCAASYLYNGKSSFHMVVTYDSSGHWTTTHDGQVISPPNLNPEPQDYDWQMVQEYYTKRGSVVYGSQWVGWVPISSCGPNGNLAGSVYSVRNLKINGTLVQGPEPRR
Ga0075390_1010606613300030947SoilDLDFSQTHPGVNANIYSISPDFSGSFTNKDYCDGQKNGTEWCLEVDWIESNGGCGGQTTLHSRPGPGSTGCTAWGCAASYMYNGKSSFHMSVSFDSAGKWTTTHDGQTIAPNNLAPQPQQEDWNVVVQYLSQRGAVIYGSQWVGWVPDSSCGNNGNLVGSVYSVRNIKITG
Ga0074031_177522113300030949SoilPGVNANIYSISPVFSGSFNINAYCDGAKTGSDWCVEVDWIESNGHCGGQTTLHTRAGPGSTGCTAWGCAASYQYNGRDSFHMVISYDAQGHWTTVRDGQTIAPNNLNPQPQDQDWSTLMQQYSKQGAVVYGSQWVGWVPVPSCGGNGQLDGSKYSIKNLKINGVHMQGPVPKSC
Ga0102747_1016536813300030959SoilGVNANLYSISPVFSGDFNIKAYCDGSKTGNDWCVEVDWIESNGNCGGQTTLHTRPGPGSTGCTAWGCEATYMYNGKPSFHMVVSYDAQGHWTTVRDGQTIAPNNLNPQPQDQDWNTLLSQYTKQGAVVYGSQWVGWTPVPSCGSNGNLDGSRYTIRNLKINGIHLQGPEPKTC
Ga0102745_100007013300030960SoilIYSISPDFSGSFQNTDYCDGQKNGTEWCLEVDWIESNGGCGGQTTLHSRPGPGSTGCTAWGCANSYTYNGKSAFHMVVSFDSTGKWTTTHDGVVINPSNLSPQPQDYDWQIVQQYYSQRGAVIYGSQWVGWVPLTSCGSNGALAGSVYSVKNMKITGTVVKGPEPKQC
Ga0138297_127215513300030962SoilGSFNIKDYCDGAKTGSDWCVEVDWIESNGNCGGQTTLHTRPGPGSTGCTAWGCAATYMYNGQPSFHMTVSYDAQGHWTTVRNGQTIAPNNLNPQPQDQDWSTLVSQYAKQGATVYGSQWVGWTPVPSCGSNGNLDGSKYTVRNLKINGVHTQGPVPKSC
Ga0075383_1126596013300030966SoilDYCDGQKNGTEWCLEVDWIESNGGCGGQTTLHSRPGPGSNGCTAWGCAASYMYNGKSSFHMSVSFDSAGKWTTTHDGQVIAPNNLAPQPQQEDWNVVVQYLSQRGAVIYGSQWVGWVPDSSCGNNGNLVGSVYSVRNIKITGTVVKGPEPKKC
Ga0075375_1166609513300030971SoilHPGVNANLYSISPVFSGDFNKGDYCDGSKTGSDWCVEVDWIESNGGCGGQTTLHTRAGPGSNGCTAWGCAATYMYNGKNSFHMQVSYDAQGHWTTVRDGQTIAPNNLNPQPQDQDWSILVGQYSKQGGVIYGSQWVGWVPVPACGPNGNLEGSRYSIRNLRINGQHVLGPVPKQC
Ga0068589_1169661713300030979SoilPGVNANIFSISPMISSGGFKLSDYCDGSKNGSDWCVEVDWIESNGGCGGQSTLHTRPGPGSTGCTAWGCASAYLYNGKSSFHMVVTYDSSGRWTTTHDGQVISPTNLNPEPQDYDWQMVQEYYTKRGSVVYGSQWVGWVPISSCGPNGNLAGSVYSVRNLKINGTLVQGPEPRRC
Ga0074027_1109257613300030980SoilTHPGVNANLYSISPVFSGDFNIKSYCDGSKTGNDWCVEVDWIESNGNCGGQTTLHTRPGPGSTGCTAWGCEATYMYNGHNSFHMMVSYDAQGHWTTVRDGQTIAPNNLNPQPQDQDWNTLVQQYSKQGAVVYGSQWVGWVPVPSCGGNGQLDGSKYSIKNLKINGVHMQGPVPKSC
Ga0074035_1050202413300031000SoilIYSISPVFSGSFNINAYCDGAKTGSDWCVEVDWIESNGHCGGQTTLHTRAGPGSTGCTAWGCAATYQYNGRDSFHMVISYDAQGHWTTVRDGQTIAPNNLNPQPQDQDWNTLVQQYSKQGAVVYGSQWVGWVPVPSCGGNGQLDGSKYSIKNLKINGVHVQGPVPKSC
Ga0138298_108733313300031015SoilSQTHPGVNANIYSISPEFSGDFDNKLYCDGQKNGTEWCLEVDWIESNGGCGGQTTLHSRPGPGSTGCTAWGCANSYMYNGKTSFHMVISFDEQGKWTTTHDGIVISSGNLSPPPQDQDWQVVQQYLSQRGAVIYGSQWVGWVPQSSCGQNGNLAGSVYSIRNLKINGSVVKGTKPRTC
Ga0138298_118924213300031015SoilANIYSISPEFSGSFTNNAYCDGQKNGTEWCLEVDWIESNGGCGGQTTLHSRPGPGSNGCTAWGCASSYMYNGKSSFHMSVSFDSNGHWTTTHDGQVIGPNNLSPQPQQEDWNVVQQYLSQRGAVIYGSQWVGWVPDSSCGNNGNLVGSVYSVRNLKITGTVVKGPEPRKC
Ga0138301_121894013300031022SoilNKDYCDGQKNGTEWCLEVDWIESNGGCGGQTTLHSRPGPGSNGCTAWGCASSYMYNGKSSFHMSVSFDSNGHWTTTHDGQVIGPNNLSPQPQQEDWNVVQQYLSQRGAVIYGSQWVGWVPDSSCGNNGNLVGSVYSVRNLKITGTVVKGPEPRKC
Ga0138301_173776613300031022SoilISPDFSGSFQNTDYCDGQKNGTEWCLEVDWIESNGGCGGQTTLHSRRGPGSNGCTAWGCANSYTYNGKSAFHMVVSFDSTGKWTTTHDGVVINPSNLSPQPQDYDWQMVQQYYSQRGAVIYGSQWVGWVPLTSCGGNGVFGRIYLLSQKFEDYWYGS
Ga0074042_1082112413300031031SoilVFSGSFNINAYCDGAKTGSDWCVEVDWIESNGHCGGQTTLHTRAGPGSTGCTAWGCAASYQYNGRDSFHMVISYDAQGHWTTVRDGQTIAPNNLNPQPQDQDWSTLMQQYSKQGAVVYGSQWVGWVPVPSCGGNGQLDGSKYSIKNLKINGVHVQGPVPKSC
Ga0074026_1131493613300031035SoilLEVDWIESNGGCGGQTTLHSRPGPGSNGCTAWGCANSYTYNGKSAFHMVVSFDSTGKWTTTHDGVVINPGNLSPQPQDYDWQMVQQYYSQRGAVIYGSQWVGWVPLTSCGNNGNLAGSVYSVKNLKITGTVVKGPEPRKC
Ga0074029_114726213300031051SoilPVFSGSFSPTDYCDGSKTGSDWCVEVDWIESNGNCGGQTTLHTRQGPGSNGCTAWGCAASYYYNGQPSFHMQIKYDTAGHWTTIHDGQVISPSNLSPPPQDLDWSTLVGQYSKQGAVIYGSQWVGWTPVASCGSNGNLAGSRYSIKNLRINGVHTQGPIPKGC
Ga0170834_10143047513300031057Forest SoilNANIYSISPDFSGSFQNTDYCDGQKNGTEWCLEVDWIESNGHCGGQTTLHSRPGPGDTGCTAWGCANSYTYGATTAFHMVVSFDSTGKWTTSHNGVVINPGNLSPQPQDYDWQVVQQYYSQRGAVIYSSQWVGWVPVTSCGGNGVLAGSVYSVKNLKITGTVVKGPEPRKC
Ga0170834_10469413813300031057Forest SoilHPGVNANLYSISPVFSGDFNIKDYCDGSKTGNDWCVEVDWIESNGNCGGQTTLHTRPGPGSDGCTAWGCAATYMYNGHDSFHMVVSYDAQGHWTTVRDGQTIAPNNLNPQPQNQDWTTLVSQYSKQGAVIYGSQWVGWTPVPSCGSNGKLDGSKYSIRNIKINGQHVSGPVPKSC
Ga0170834_10572811413300031057Forest SoilANLYSISPVFSGSFNIKDYCDGAKTGSDWCVEVDWIESNGNCGGQTTLHTRPGPGSTGCTAWGCAATYMYSGQPSFHMTVSYDAQGHWTTVRNGQTIAPNNLNPQPQDQDWSTLVSQYAKQGATVYGSQWVGWTPVPSCGSNGNLDGSKYTVRNLKINGVHTQGPVPKSC
Ga0170834_11074384013300031057Forest SoilGSFQNTDYCDGQKNGTEWCLEIDWIESNGGCGGQTTLHSRPGPGSTGCTAWGCANSYLYNGKKAFHMVVSFDSTGKWTTTHDGVVINPTNLSPQPQDYDWQIVQQYYSQRGAVIYGSQWVGWVPVTSCGGNGDLTGSIYSVKNLKITGTVVKGPTPKQC
Ga0170834_11212832713300031057Forest SoilDYCDGSKNGSDWCVEVDWIESNGGCGGQSTLHTRPGPGSTGCTAWGCAASYLYNGKSSFHMVVTYDSSGHWTTTHDGQVISPPNLNPEPQDYDWQMVQEYYTKRGSVVYGSQWVGWVPISSCGPNGNLAGSVYSVRNLKINGTLVQGPEPRRC
Ga0318490_129109713300031116SoilHPGVNANIYSISPDFSGSFQNTDYCDGQKNGTEWCLEVDWIESNGGCGGQTTLHSRPGPGSTGCTAWGCANSYTYNGKSAFHMVVSFDSTGKWTTTHDGVVINPSNLSPQPQDYDWQIVQQYYSQRGAVIYGSQWVGWVPLTSCGNNGALAGSVYSVKNLKITGTVVKGPEPKQC
Ga0170822_1462822213300031122Forest SoilDYCDGAKTGNDWCVEVDWIESNGNCGGQTTLHTRPGPGSTGCTAWGCAATYMYSGQPSFHMTVSYDAQGHWTTVRNGQTIAPNNLNPQPQDQDWSTLVSQYAKQGATVYGSQWVGWTPVPSCGSNGNLDGSKYTVRNLKINGVHTQGPVPKSC
Ga0170823_1001820913300031128Forest SoilIYSISPDFSGSFQNTDYCDGQKNGTEWCLEIDWIESNGGCGGQTTLHSRPGPGSTGCTAWGCANSYLYNGKKAFHMVVSFDSTGKWTTTHDGVVINPTNLSPQPQDYDWQIVQQYYSQRGAVIYGSQWVGWVPVTSCGGNGDLTGSIYSVKNLKITGTVVKGPEPKQC
Ga0102761_1223680813300031411SoilSPVFSGDFNTKDYCDGSKTGSDWCVEVDWIESNGGCGGQTTLHTRAGPGSNGCTAWGCAATYMYNGKNSFHMQVSYDAQGHWTTVRDGQTIAPDNLNPKPQDQDWSILVGQYSKQGGVIYGSQWVGWVPVPACGPNGNLEGSKYSIRNLRINGQHLLGPEPKQC
Ga0170820_1720046513300031446Forest SoilGDFDNKLYCDGQKNGTEWCLEVDWIESNGGCGGQTTLHSRPGPGSTGCTAWGCANSYTYNGKSSFHMVISFDEQGKWTTTHDGVVIAPSNLSPAPQDQDWQVVQQYLSQRGAVIYSSQWVGWVPVSSCGQNGNLAGSVYSVRNLKINGSVVKGTRPRTC
Ga0170818_10342937013300031474Forest SoilANIYSISPDFSGSFQNTDYCDGQKNGTEWCLEVDWIESNGGCGGQTTLHSRPGPGSNGCTAWGCANSYTYNGKSAFHMVVSFDSTGKWTTTHDGVVINPSNLSPQPQDYDWQIVQQYYSQRGAVIYGSQWVGWVPLTSCGSNGALAGSVYSVKNMKITGTVVKGPEPKQC
Ga0170818_10667532413300031474Forest SoilQNTDYCDGQKNGTEWCLEVDWIESNGGCGGQTTLHSRPGPGSTGCTAWGCANSYTYNGKSSFHMVISFDEQGKWTTTHDGVVIAPSNLSPAPQDQDWQVVQQYLSQRGAVIYSSQWVGWVPLTSCGQNGNLAGSVYSVRNLKINGSVVKGTRPRTC
Ga0170818_11018514713300031474Forest SoilNIYSISPDFSGSFTNKDYCDGQKNGTEWCLEVDWIESNGGCGGQTTLHSRPGPGSTGCTAWGCAASYKYNGKSSFHMSVSFDSAGKWTTTHDGQVIAPNNLAPQPQQEDWNVVVQYLSQRGAVIYGSQWVGWVPDSSCGNNGNLVGSVYSVRNIKITGTVVKGPEPKKC
Ga0315742_1357430213300032756Forest SoilGEFSQAAYCDGSKTGSDWCVEVDYIESNGPCGGQSTLHTREGPGSNGCTAWGCASDYLYNGRNSFHMAVLFDSAGHWTTIHDGVVISPNSLNPQPQDQDWQALQQHYSQLGAVIFSSQWVGWVPVSSCGGNGNLSGSVYSVKNLRINGTVVQGPEPRKC

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.