Basic Information | |
---|---|
Family ID | F057660 |
Family Type | Metagenome |
Number of Sequences | 136 |
Average Sequence Length | 45 residues |
Representative Sequence | MMEARVDAVFDSLRQDSAFLALTSGADGKLQMPMRNMTGTQNR |
Number of Associated Samples | 114 |
Number of Associated Scaffolds | 136 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 3.05 % |
% of genes near scaffold ends (potentially truncated) | 92.65 % |
% of genes from short scaffolds (< 2000 bps) | 91.18 % |
Associated GOLD sequencing projects | 102 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.35 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (94.118 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (11.029 % of family members) |
Environment Ontology (ENVO) | Unclassified (52.206 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (72.059 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 28.17% β-sheet: 0.00% Coil/Unstructured: 71.83% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.35 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 136 Family Scaffolds |
---|---|---|
PF00083 | Sugar_tr | 44.12 |
PF03239 | FTR1 | 5.88 |
PF01979 | Amidohydro_1 | 5.88 |
PF07690 | MFS_1 | 5.15 |
PF02954 | HTH_8 | 2.94 |
PF02771 | Acyl-CoA_dh_N | 0.74 |
PF10049 | DUF2283 | 0.74 |
PF04255 | DUF433 | 0.74 |
PF12796 | Ank_2 | 0.74 |
PF06282 | DUF1036 | 0.74 |
PF13544 | Obsolete Pfam Family | 0.74 |
PF02452 | PemK_toxin | 0.74 |
PF13193 | AMP-binding_C | 0.74 |
PF04055 | Radical_SAM | 0.74 |
PF01380 | SIS | 0.74 |
PF05598 | DUF772 | 0.74 |
PF10035 | DUF2179 | 0.74 |
PF00459 | Inositol_P | 0.74 |
COG ID | Name | Functional Category | % Frequency in 136 Family Scaffolds |
---|---|---|---|
COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.74 |
COG2337 | mRNA-degrading endonuclease MazF, toxin component of the MazEF toxin-antitoxin module | Defense mechanisms [V] | 0.74 |
COG2442 | Predicted antitoxin component of a toxin-antitoxin system, DUF433 family | Defense mechanisms [V] | 0.74 |
COG5480 | Uncharacterized membrane protein | Function unknown [S] | 0.74 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 94.12 % |
Unclassified | root | N/A | 5.88 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2162886012|MBSR1b_contig_12444246 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_101450402 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 13_1_20CM_4_60_6 | 734 | Open in IMG/M |
3300001139|JGI10220J13317_11058157 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
3300004643|Ga0062591_100698768 | All Organisms → cellular organisms → Bacteria | 917 | Open in IMG/M |
3300004643|Ga0062591_102446027 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
3300005294|Ga0065705_10777109 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
3300005328|Ga0070676_10450862 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 13_1_20CM_4_60_6 | 905 | Open in IMG/M |
3300005338|Ga0068868_101153931 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
3300005340|Ga0070689_100222523 | All Organisms → cellular organisms → Bacteria | 1549 | Open in IMG/M |
3300005343|Ga0070687_101218719 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
3300005364|Ga0070673_101328691 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
3300005366|Ga0070659_100564363 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 975 | Open in IMG/M |
3300005441|Ga0070700_100023070 | All Organisms → cellular organisms → Bacteria | 3638 | Open in IMG/M |
3300005444|Ga0070694_101113523 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
3300005444|Ga0070694_101172525 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 643 | Open in IMG/M |
3300005458|Ga0070681_11754654 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 547 | Open in IMG/M |
3300005459|Ga0068867_100725056 | All Organisms → cellular organisms → Bacteria | 880 | Open in IMG/M |
3300005467|Ga0070706_100308910 | All Organisms → cellular organisms → Bacteria | 1475 | Open in IMG/M |
3300005536|Ga0070697_101367503 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 13_1_20CM_4_60_6 | 632 | Open in IMG/M |
3300005544|Ga0070686_100261750 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 1268 | Open in IMG/M |
3300005545|Ga0070695_100409411 | All Organisms → cellular organisms → Bacteria | 1030 | Open in IMG/M |
3300005548|Ga0070665_101859358 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 608 | Open in IMG/M |
3300005577|Ga0068857_100483427 | All Organisms → cellular organisms → Bacteria | 1161 | Open in IMG/M |
3300005578|Ga0068854_101231172 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
3300005617|Ga0068859_101546052 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
3300005617|Ga0068859_101834217 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
3300005719|Ga0068861_101269727 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 715 | Open in IMG/M |
3300005840|Ga0068870_10484180 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
3300005840|Ga0068870_11080272 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
3300005841|Ga0068863_101580343 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
3300005843|Ga0068860_100049249 | All Organisms → cellular organisms → Bacteria | 4013 | Open in IMG/M |
3300005843|Ga0068860_101781907 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
3300006031|Ga0066651_10788485 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
3300006169|Ga0082029_1063277 | All Organisms → cellular organisms → Bacteria | 1057 | Open in IMG/M |
3300006755|Ga0079222_11071935 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
3300006806|Ga0079220_10296325 | All Organisms → cellular organisms → Bacteria | 997 | Open in IMG/M |
3300006806|Ga0079220_10959960 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
3300006845|Ga0075421_101737330 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
3300006847|Ga0075431_100214417 | All Organisms → cellular organisms → Bacteria | 1965 | Open in IMG/M |
3300006852|Ga0075433_10707291 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
3300006852|Ga0075433_10741278 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
3300006852|Ga0075433_10982397 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
3300006852|Ga0075433_11108961 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
3300006852|Ga0075433_11426109 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
3300006853|Ga0075420_101122967 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
3300006854|Ga0075425_103175410 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
3300006871|Ga0075434_101498762 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 684 | Open in IMG/M |
3300006880|Ga0075429_101037262 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
3300006881|Ga0068865_102099439 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
3300006894|Ga0079215_10214542 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
3300006904|Ga0075424_100716947 | All Organisms → cellular organisms → Bacteria | 1068 | Open in IMG/M |
3300006918|Ga0079216_11049672 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
3300007004|Ga0079218_10385294 | All Organisms → cellular organisms → Bacteria | 1186 | Open in IMG/M |
3300009092|Ga0105250_10429692 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
3300009093|Ga0105240_12633335 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300009098|Ga0105245_11513683 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
3300009101|Ga0105247_10128378 | All Organisms → cellular organisms → Bacteria | 1650 | Open in IMG/M |
3300009137|Ga0066709_103654511 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 558 | Open in IMG/M |
3300009147|Ga0114129_10907813 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 1116 | Open in IMG/M |
3300009147|Ga0114129_11037616 | All Organisms → cellular organisms → Bacteria | 1030 | Open in IMG/M |
3300009147|Ga0114129_11587726 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
3300009177|Ga0105248_11613943 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
3300009610|Ga0105340_1525635 | Not Available | 529 | Open in IMG/M |
3300009840|Ga0126313_10207885 | All Organisms → cellular organisms → Bacteria | 1504 | Open in IMG/M |
3300010036|Ga0126305_10249554 | All Organisms → cellular organisms → Bacteria | 1140 | Open in IMG/M |
3300010041|Ga0126312_10369575 | All Organisms → cellular organisms → Bacteria | 1018 | Open in IMG/M |
3300010041|Ga0126312_10567037 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
3300010045|Ga0126311_11819390 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 516 | Open in IMG/M |
3300010360|Ga0126372_10356316 | All Organisms → cellular organisms → Bacteria | 1315 | Open in IMG/M |
3300010375|Ga0105239_10695913 | All Organisms → cellular organisms → Bacteria | 1162 | Open in IMG/M |
3300010397|Ga0134124_11238879 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
3300010400|Ga0134122_11717872 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 656 | Open in IMG/M |
3300010400|Ga0134122_12999811 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
3300011119|Ga0105246_11348839 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
3300011119|Ga0105246_12156190 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
3300012022|Ga0120191_10046940 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 739 | Open in IMG/M |
3300012896|Ga0157303_10246750 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
3300012899|Ga0157299_10241292 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
3300012918|Ga0137396_10100594 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2063 | Open in IMG/M |
3300012922|Ga0137394_11013915 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
3300012922|Ga0137394_11512488 | Not Available | 530 | Open in IMG/M |
3300012923|Ga0137359_10068391 | All Organisms → cellular organisms → Bacteria | 3103 | Open in IMG/M |
3300012929|Ga0137404_11306461 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Poribacteria → unclassified Candidatus Poribacteria → Candidatus Poribacteria bacterium | 669 | Open in IMG/M |
3300012930|Ga0137407_12044401 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 547 | Open in IMG/M |
3300012944|Ga0137410_11233138 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 645 | Open in IMG/M |
3300012948|Ga0126375_11647022 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 554 | Open in IMG/M |
3300012960|Ga0164301_10186035 | All Organisms → cellular organisms → Bacteria | 1310 | Open in IMG/M |
3300013297|Ga0157378_11144280 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
3300013306|Ga0163162_10759570 | All Organisms → cellular organisms → Bacteria | 1088 | Open in IMG/M |
3300013754|Ga0120183_1016421 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 587 | Open in IMG/M |
3300014325|Ga0163163_10243578 | All Organisms → cellular organisms → Bacteria | 1848 | Open in IMG/M |
3300014968|Ga0157379_11513425 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
3300015054|Ga0137420_1382484 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1929 | Open in IMG/M |
3300015264|Ga0137403_10670297 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 899 | Open in IMG/M |
3300015371|Ga0132258_12641690 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 13_1_20CM_4_60_6 | 1254 | Open in IMG/M |
3300015374|Ga0132255_100125016 | All Organisms → cellular organisms → Bacteria | 3543 | Open in IMG/M |
3300017792|Ga0163161_10275530 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 13_1_20CM_4_60_6 | 1318 | Open in IMG/M |
3300018076|Ga0184609_10528078 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
3300018422|Ga0190265_12550430 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 609 | Open in IMG/M |
3300018476|Ga0190274_12711406 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
3300019487|Ga0187893_10164868 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1771 | Open in IMG/M |
3300025735|Ga0207713_1237626 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
3300025911|Ga0207654_10470693 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
3300025912|Ga0207707_10325025 | All Organisms → cellular organisms → Bacteria | 1328 | Open in IMG/M |
3300025918|Ga0207662_10607288 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
3300025932|Ga0207690_11734708 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
3300025933|Ga0207706_10441830 | All Organisms → cellular organisms → Bacteria | 1126 | Open in IMG/M |
3300025933|Ga0207706_11497121 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 551 | Open in IMG/M |
3300025936|Ga0207670_10598042 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
3300025938|Ga0207704_10257230 | All Organisms → cellular organisms → Bacteria | 1314 | Open in IMG/M |
3300025938|Ga0207704_11958980 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
3300025938|Ga0207704_11969661 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300025941|Ga0207711_10404559 | All Organisms → cellular organisms → Bacteria | 1268 | Open in IMG/M |
3300025941|Ga0207711_11269606 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
3300025942|Ga0207689_10204282 | All Organisms → cellular organisms → Bacteria | 1631 | Open in IMG/M |
3300025960|Ga0207651_10121500 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1982 | Open in IMG/M |
3300025981|Ga0207640_10058219 | All Organisms → cellular organisms → Bacteria | 2545 | Open in IMG/M |
3300025996|Ga0208777_1010479 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
3300026035|Ga0207703_10400490 | All Organisms → cellular organisms → Bacteria | 1273 | Open in IMG/M |
3300026035|Ga0207703_12160276 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
3300026041|Ga0207639_10243641 | All Organisms → cellular organisms → Bacteria | 1564 | Open in IMG/M |
3300026046|Ga0208780_1025617 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 548 | Open in IMG/M |
3300026078|Ga0207702_12382457 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae | 517 | Open in IMG/M |
3300026089|Ga0207648_11406314 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 656 | Open in IMG/M |
3300026142|Ga0207698_10604521 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 13_1_20CM_4_60_6 | 1081 | Open in IMG/M |
3300028380|Ga0268265_12216551 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
3300028381|Ga0268264_12513950 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
3300031731|Ga0307405_11624507 | Not Available | 571 | Open in IMG/M |
3300032004|Ga0307414_10028926 | All Organisms → cellular organisms → Bacteria | 3601 | Open in IMG/M |
3300032012|Ga0310902_10410240 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
3300032211|Ga0310896_10337350 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 11.03% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.82% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 8.09% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 7.35% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 4.41% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.41% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 4.41% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 4.41% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.68% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 3.68% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 3.68% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.94% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.21% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.21% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.21% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.21% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.21% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.47% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.47% |
Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 1.47% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.47% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.47% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.47% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.47% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.47% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.47% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.74% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.74% |
Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 0.74% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.74% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.74% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.74% |
Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 0.74% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.74% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.74% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.74% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.74% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.74% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300001139 | Soil microbial communities from Great Prairies - Wisconsin, Switchgrass soil | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009610 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 | Environmental | Open in IMG/M |
3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300012022 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C6 | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012896 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2 | Environmental | Open in IMG/M |
3300012899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2 | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300013754 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C1.rep2 | Environmental | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300019487 | White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaG | Environmental | Open in IMG/M |
3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025996 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_301 (SPAdes) | Environmental | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026046 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D1 (SPAdes) | Environmental | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
MBSR1b_0087.00005800 | 2162886012 | Miscanthus Rhizosphere | AKEMMEARVDAVFDSLRQDSAFLALTRGADGKLQMPMRNMTGTQNR |
INPhiseqgaiiFebDRAFT_1014504021 | 3300000364 | Soil | EMMEARVDAVFDSLRQDSSFLALTSGADGRLQMPMGNMRGTQQQQQ* |
JGI10220J13317_110581572 | 3300001139 | Soil | ERYPAVREKEMMEARVDFVFDSLREDSEFLALTSGADGKLQMPMKSMEMR* |
Ga0062591_1006987681 | 3300004643 | Soil | ARVDAVFDSLRQDSQFLALTSGADGKLQMPMRNMTGSSNRD* |
Ga0062591_1024460272 | 3300004643 | Soil | MMEARVDAVFDSLRQDSAFLALTSGADGKLQMPMRNMTGTQNR* |
Ga0065705_107771092 | 3300005294 | Switchgrass Rhizosphere | RVDAVFDSLRQDSQFLALTSGADGKLRMPMRNMTGSSNRD* |
Ga0070676_104508622 | 3300005328 | Miscanthus Rhizosphere | AKEMMEAGVDAVFDSLRQDSAFLALTSGADGRLQMPMKMGGTQNQNQ* |
Ga0068868_1011539312 | 3300005338 | Miscanthus Rhizosphere | KEMMEARVDAVFDSLRQDSAFLALTSGADGRLQMPMRNMTGTQNR* |
Ga0070689_1002225232 | 3300005340 | Switchgrass Rhizosphere | VRAKEMMEARVDAVFDSLRQDSAFLALTSGADGKLQMPMRNMTGTQNR* |
Ga0070687_1012187191 | 3300005343 | Switchgrass Rhizosphere | RAKEMMEARVDAVFDSLRQDSAFLALTSGADGRLQMPMRNMTGTQNR* |
Ga0070673_1013286911 | 3300005364 | Switchgrass Rhizosphere | AKEMMEARVDAVFDSLRQDSAFLALTSGADGRLQMPMRNMTGTQNR* |
Ga0070659_1005643631 | 3300005366 | Corn Rhizosphere | ERYQTVRAKEMMEARVDAVFDSLRQDSAFLALTSGADGRLQMPMRNMTGTQNR* |
Ga0070700_1000230704 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | AKEMMEARVDAVFDSLRSDKAFLALTKGADGMLPMPMKDMRGNQNQQR* |
Ga0070694_1011135231 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | AVRAKEMMEARVDAVFDSLRNDRGFMALTKGADGMLPMPMRDMRGNQNQQR* |
Ga0070694_1011725251 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | AVREKEMMEARVDAVFDSLRADPAFLALTRNADGRLQMPMKPMGVRSGAIR* |
Ga0070681_117546541 | 3300005458 | Corn Rhizosphere | EARVDAVFDSLRQDSQFLALTSGADGKLPMPMKPLTGTMQNQR* |
Ga0068867_1007250562 | 3300005459 | Miscanthus Rhizosphere | RVDAVFDSLRQDSAFLALTSGADGRLQMPMRNMTGTQNR* |
Ga0070706_1003089101 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | SKEMMEARVDAVFDTLREDAAFVALTRGADGKLPMPMRDVKTMQNRER* |
Ga0070697_1013675031 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | YQAVRAKEMMEARVDAVFDSLREDAAFMALTRSADGKLPMPMRDAKGVQNR* |
Ga0070686_1002617501 | 3300005544 | Switchgrass Rhizosphere | VRAKEMMEARVDAVFDSLRSDKAFLALTKGADGMLPMPMKDMRGNQNQQR* |
Ga0070695_1004094112 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | KEMMEARVDAVFDSLRQDSQFLALTKGADGKLPMPMKNMTGTMQNQR* |
Ga0070665_1018593581 | 3300005548 | Switchgrass Rhizosphere | RAKEMMEARVDAVFDSLRQDSAFLALTSGADGRLQMPMKEMKGTMQNQ* |
Ga0068857_1004834271 | 3300005577 | Corn Rhizosphere | RAKEMMEARVDAVFDSLRQDSAFLALTSGADGRLQMPMKNMTGSANRD* |
Ga0068854_1012311722 | 3300005578 | Corn Rhizosphere | VFDSLRQDSAFLALTSGADGKLQMPMRNMTGTQNR* |
Ga0068859_1015460521 | 3300005617 | Switchgrass Rhizosphere | MMEARVDAVFDSLRQDSAFLALTSGADGRLQMPMRNMTGTQNR* |
Ga0068859_1018342171 | 3300005617 | Switchgrass Rhizosphere | TVRAKEMMEARVDAVFDSLRYDSSFLALTSGADGRLQMPMRDMRGMPNR* |
Ga0068861_1012697273 | 3300005719 | Switchgrass Rhizosphere | QAVREKEMMEARVDVVFDSLRQDRTFLALTSGADGKLPMPMPGMGTGTRENR* |
Ga0068870_104841802 | 3300005840 | Miscanthus Rhizosphere | YHAVRAKEMMEARVDAVFDSLRQDSAFLALTNGADGKLQMPMKNMTGSSNRD* |
Ga0068870_110802722 | 3300005840 | Miscanthus Rhizosphere | AKEMMEARVDAVFDSLRQDSQFLALTSGADGKLRMPMRNMTGSSNRD* |
Ga0068863_1015803431 | 3300005841 | Switchgrass Rhizosphere | ARVDAVFDSLRQDSAFLALTSGADGRLQMPMRNMTGTANQK* |
Ga0068860_1000492491 | 3300005843 | Switchgrass Rhizosphere | EMMEARVDAVFDSLRQDSAFLALTSGADGRLQMPMRNMTGTQNR* |
Ga0068860_1017819071 | 3300005843 | Switchgrass Rhizosphere | FDSLRQDSAFLALTSGADGRLQMPMRNMTGTQNR* |
Ga0066651_107884851 | 3300006031 | Soil | EMMEARVDAVFDSLRQDSAFLALTSGADCRLPMPMKNMTGMPNRN* |
Ga0082029_10632772 | 3300006169 | Termite Nest | RAKEMMEARVDAVFDSLRQDSAFLALTRGADGKLQMPMRNMTGTQNR* |
Ga0079222_110719352 | 3300006755 | Agricultural Soil | AVFDSLRQDSDFLALTSGADGRLPMPMRNLTGSSNR* |
Ga0079220_102963251 | 3300006806 | Agricultural Soil | VRAKEMMEARVDAVFDSLRQDSQFLALTSGADGKLPMPMRPMTGTMQNQR* |
Ga0079220_109599602 | 3300006806 | Agricultural Soil | RVDAVFDSLRQDSQFLALTSGADGKLPMPMKSMTGTMQNQR* |
Ga0075421_1017373302 | 3300006845 | Populus Rhizosphere | VDAVFDSLRQDSDFLALTSGADGKLQMPMRHITGSANRD* |
Ga0075431_1002144173 | 3300006847 | Populus Rhizosphere | FDSLRQDSDFLALTSGADGKLQMPMRHITGSANRD* |
Ga0075433_107072911 | 3300006852 | Populus Rhizosphere | RVDAVFDSLRQDSSFLALTSGADGKLQMPMRPMTGTNNR* |
Ga0075433_107412782 | 3300006852 | Populus Rhizosphere | VRSKEMMEARVDAVFDSLRQDSSFLALTSGADGRLQMPMRDVKGMQQQR* |
Ga0075433_109823972 | 3300006852 | Populus Rhizosphere | FDSLRQDSAFLALTSGADGKLQMPMRNMTGTTNRD* |
Ga0075433_111089612 | 3300006852 | Populus Rhizosphere | RVDAVFDSLRQDSAFLALTSGADGKLRMPMRNMTGSANPD* |
Ga0075433_114261092 | 3300006852 | Populus Rhizosphere | DSLRQDSKFLALTSGADGKLQMPMKNMTGTMNQE* |
Ga0075420_1011229671 | 3300006853 | Populus Rhizosphere | YEAVREKEMMEARVDAVFDSIRYDSSFLALTSGADGKLQMPMRGMPGMQNR* |
Ga0075425_1031754102 | 3300006854 | Populus Rhizosphere | EMMEARVDAVFDSLRQDSDFLALTSGADGKLQMPMKNMTGSSNR* |
Ga0075434_1014987621 | 3300006871 | Populus Rhizosphere | EARVDAVFDSLRQDSSFLALTSGADGRLQMPMRDVKGMQQQR* |
Ga0075429_1010372622 | 3300006880 | Populus Rhizosphere | QAVRAKEMMEARVDAVFDSLRQDSTFLALTSGADGKLQMPMKNMTGSTNRD* |
Ga0068865_1020994392 | 3300006881 | Miscanthus Rhizosphere | VFDSLRQDSAFLALTSGADGKLQMPMRNMTGTTNRD* |
Ga0079215_102145422 | 3300006894 | Agricultural Soil | EMMEARVDAVFDSLRQDSAFLALTSGADGKLAMPMKNMTGTMNQR* |
Ga0075424_1007169471 | 3300006904 | Populus Rhizosphere | VRAKEMMEARVDAVFDSLRQDSTFLALTSGADGKLQMPMKNMSGTMNQE* |
Ga0079216_110496721 | 3300006918 | Agricultural Soil | ARVDAVFDSLRQDSAFLALTSGADGKLPMPMKNMTGTMNQR* |
Ga0079218_103852941 | 3300007004 | Agricultural Soil | VDAVFETLRQDSQFLALTSGADGKLMMPMPMKDTRSMQNQQR* |
Ga0105250_104296921 | 3300009092 | Switchgrass Rhizosphere | VFDSLRQDSAFLALTSGADGRLQMPMRNMTGTQNR* |
Ga0105240_126333351 | 3300009093 | Corn Rhizosphere | MMEARVDAVFDSLRQDSDFLALTSSADGTLQMPMRNTTGTQNR* |
Ga0105245_115136831 | 3300009098 | Miscanthus Rhizosphere | DAVFDSLRQDSAFLALTSGADGRLQMPMRNMTGTQNR* |
Ga0105247_101283781 | 3300009101 | Switchgrass Rhizosphere | YERYQAVRAKEMMEARVDAVFDSLRQDSDFLALTSGADGKLQMPMRNTTGTQNR* |
Ga0066709_1036545111 | 3300009137 | Grasslands Soil | SVRAKEMMEARVDAVFDSIRTDREFVALTNGADGRLQMPMKGMNGARDNR* |
Ga0114129_109078132 | 3300009147 | Populus Rhizosphere | AKEMMEARVDAVFDSLREDPSFVALTRGADGKLPMPMKPMGGRSGNNN* |
Ga0114129_110376162 | 3300009147 | Populus Rhizosphere | AKEMMEARVDAVFDSLRQDSDFLALTSGADGKLQMPMRHITGSANRD* |
Ga0114129_115877262 | 3300009147 | Populus Rhizosphere | AVRAKEMMEARVDAVFDSLRQDAGFLALTRGADGKLAMPMKNMGTPSGPNR* |
Ga0105248_116139432 | 3300009177 | Switchgrass Rhizosphere | DSIRQDSAFLALTSGADGRLQMPMKEMKGTMQNQ* |
Ga0105340_15256351 | 3300009610 | Soil | KEMMEARVDAVFSSLLSDPKFMALTADADNRLQMPSMKGMGGGR* |
Ga0126313_102078852 | 3300009840 | Serpentine Soil | YQAVRAKEMMEARVDAVFDSLRKDSAFLALTRGADGKLQMPMRNMTGTQNR* |
Ga0126305_102495541 | 3300010036 | Serpentine Soil | VDAVFDSLRKDSAFLALTRGADGKLQMPMRNMTGTQNR* |
Ga0126312_103695751 | 3300010041 | Serpentine Soil | EMMEARVDAVFDSLRYDTAFLALTSGADGKLQMPMRDMRGMQNR* |
Ga0126312_105670371 | 3300010041 | Serpentine Soil | ERYQAVRAKEMMEARVDAVFDSLRQDSTFLALTSGADGKLQMPMKNMTGSSNRD* |
Ga0126311_118193902 | 3300010045 | Serpentine Soil | FDSVRYDSTFLALTSGADGRLQMPMRDMRGMPNR* |
Ga0126372_103563161 | 3300010360 | Tropical Forest Soil | FDSLRQDSSFLALTSGADGRLQMPMRDVKGMQQQR* |
Ga0105239_106959132 | 3300010375 | Corn Rhizosphere | AVFDSLRQDSAFLALTSGADGRLQMPMKNMTGSANRD* |
Ga0134124_112388792 | 3300010397 | Terrestrial Soil | MEARVDAVFDSLRQDSAFLALTSGADGKLQMPMRNMTGTQNR* |
Ga0134122_117178721 | 3300010400 | Terrestrial Soil | RYQSVRAKEMMEARVDAVFDSLRQDSAFLALTKGADGRLQMPMKGMTGTQQNQ* |
Ga0134122_129998111 | 3300010400 | Terrestrial Soil | KEMMEARVDAVFDSLRSDQAFLALTSGADGRLQMPMKIMAPGSRENQ* |
Ga0105246_113488392 | 3300011119 | Miscanthus Rhizosphere | EMMEARVDAVFDSLRQDSAFFALTSGADGRLQMPMRNMTGTQNR* |
Ga0105246_121561902 | 3300011119 | Miscanthus Rhizosphere | AVFDSLRQDSAFLALTSGADGKLQMPMRNMTGTANQD* |
Ga0120191_100469401 | 3300012022 | Terrestrial | ESIRQDHEFMELTSGADGKLQMPMRDMNGRSENR* |
Ga0137363_112507651 | 3300012202 | Vadose Zone Soil | AVFDTLREDPSFAALTRGADGKLPLPMRDMKTMQNRER* |
Ga0137360_100857051 | 3300012361 | Vadose Zone Soil | EMMEARVDAVFDTLREDPSFVALTRGADGKLPMPMRDMKTMQNRER* |
Ga0137358_100054327 | 3300012582 | Vadose Zone Soil | VFDTLREDAAFIALTRGADGKLPMPMRDVKTMQNRER* |
Ga0157303_102467502 | 3300012896 | Soil | YQTVRAKEMMEARVDAVFDSLRQDSAFLALTSGADGRLQMPMKNMTGSGNRD* |
Ga0157299_102412922 | 3300012899 | Soil | DAVFDSLRQDSSFLALTRGADGKLPMPMKNMTGTMQNNQR* |
Ga0137396_101005941 | 3300012918 | Vadose Zone Soil | YQSVRAKEMMEARVDAVFDSLRADPGFIALTRNADGRLPMPMKGMGSQPGTNK* |
Ga0137394_110139151 | 3300012922 | Vadose Zone Soil | AVRSKEMMEARVDAVFDSLRQDSAFLALTRDADGRLMMPMKSMGSPSENK* |
Ga0137394_115124882 | 3300012922 | Vadose Zone Soil | EMMEARVDAVFDSLRTDPGFLALTSGADGRLQMPMKNMGQRQ* |
Ga0137359_100683911 | 3300012923 | Vadose Zone Soil | QAVRSKEMMEARVDAVFDTLREDAAFVALTRGADGKLPMPMRDVKTMQNRER* |
Ga0137404_113064611 | 3300012929 | Vadose Zone Soil | VFDSLRQDSEFLALTRHADGRLMMPMKNMGTGSENK* |
Ga0137407_120444011 | 3300012930 | Vadose Zone Soil | VRTKEMMEARVDAVFDSLREDPAFLALTQGADGKLAMPMRDVKTMQTPER* |
Ga0137410_112331382 | 3300012944 | Vadose Zone Soil | MMEARVDAVFDSLRSDSAFLALTSGADGRLPMPTPMKGMGGSRENR* |
Ga0126375_116470221 | 3300012948 | Tropical Forest Soil | MMEARVDAVFDSVRSDSEFMALTSGADGKLPMPMRDVKGTQNQNR* |
Ga0164301_101860352 | 3300012960 | Soil | QAVRTKEMMEARVDAVFDSLRQDSQFLALTSGADGKLPMPMKNMTGTMQNQR* |
Ga0157378_111442802 | 3300013297 | Miscanthus Rhizosphere | HTVRAKESMEARVDAVLDSIRYDSGFLALTSGADGKLQMPMRGMKDMRSMQNQDR* |
Ga0163162_107595702 | 3300013306 | Switchgrass Rhizosphere | RVDAVFDSLRQDSAFLALTSGADGKLQMPMRNMTGTQNR* |
Ga0120183_10164211 | 3300013754 | Terrestrial | MEARVDAVFDSLRQDSAFLALTSGADGKLQMPMRNMTGTANQD* |
Ga0163163_102435782 | 3300014325 | Switchgrass Rhizosphere | AKEMMEARVDAVFDSLRQDSAFLALTSGADGRLQMPMKNTTGSANRD* |
Ga0157379_115134251 | 3300014968 | Switchgrass Rhizosphere | ERYHAVRAKEMMEARVDAVFDSLRQDSAFLALTSGADGKLQMPMRNMTGTQNR* |
Ga0137420_13824841 | 3300015054 | Vadose Zone Soil | YKAVRSKEMMEARVDAVFDSLREDPKFLALTSGADGRLQMPMKNMGGARENR* |
Ga0137403_106702971 | 3300015264 | Vadose Zone Soil | TKEMMEARVDAVFDSLREDPAFLALTQGADGKLAMPMRDVKTMQTPER* |
Ga0132258_126416902 | 3300015371 | Arabidopsis Rhizosphere | EARVDAVFDSLRQDSSFLALTSGADGRLQMPTGNMKGMQQK* |
Ga0132255_1001250165 | 3300015374 | Arabidopsis Rhizosphere | RYQAVRAKEMMEARVDAVFDSLRNDRGFMALTKGADGMLPMPMRDMRGNQNQQR* |
Ga0163161_102755302 | 3300017792 | Switchgrass Rhizosphere | YQSVRAKEMMEARVDAVFDSIRQDSAFLALTSGADGRLQMPMKMGGTQNQNQ |
Ga0184605_100107312 | 3300018027 | Groundwater Sediment | MMEARVDTVFDSLREDAAFVALTRGADGKLPMPMKDVKGMQNRER |
Ga0184609_105280781 | 3300018076 | Groundwater Sediment | MMEARVDAVFDSLREDPAFVALTVGADGKLPMPMKGMNGSRDNR |
Ga0190265_125504301 | 3300018422 | Soil | MMEARVDAVFDSLRSDSAFLALTKGADGMLQMPMRDMRGNQNQQRN |
Ga0190274_127114061 | 3300018476 | Soil | DAVFDSLRQDSAFLALTRGADGKLQMPMRNMTGTQNR |
Ga0187893_101648681 | 3300019487 | Microbial Mat On Rocks | VFDSLREDSAFLALTSGADGKLQMPMKGMNMNGSRENR |
Ga0207713_12376261 | 3300025735 | Switchgrass Rhizosphere | KEMMEARVDAVFDSLRQDSAFLALTSGADGRLQMPMKNMTGSANRD |
Ga0207654_104706931 | 3300025911 | Corn Rhizosphere | MEARVDAVFDSLRQDSAFLALTSGADGKLQMPMKNMSGSANRD |
Ga0207707_103250251 | 3300025912 | Corn Rhizosphere | MEARVDAVFDSLRQDSKFLALTSGADGRLQMPMRNMTGSSNRD |
Ga0207662_106072881 | 3300025918 | Switchgrass Rhizosphere | EARVDAVFDSLRQDSAFLALTRGADGRLQMPMKNMTGSANRD |
Ga0207690_117347082 | 3300025932 | Corn Rhizosphere | RVDAVFDSLRQDSEFLALTSGADGRLQMPMRNMTGSANKD |
Ga0207706_104418301 | 3300025933 | Corn Rhizosphere | YPAVREKEMMEARVDFVFDSLREDSEFLALTSGADGKLQMPMKSMEMR |
Ga0207706_114971211 | 3300025933 | Corn Rhizosphere | ERYQAVRAKEMMEARVDAVFDSLRQDSAFLALTSGADGKLQMPMKNMTGSTNRD |
Ga0207670_105980422 | 3300025936 | Switchgrass Rhizosphere | RAVRAKEMMEARVDAVFDSLRQDSAFLALTSGADGKLQMPMRNMTGTQNR |
Ga0207704_102572301 | 3300025938 | Miscanthus Rhizosphere | LLVAFARVDAVFDSLRNDRGFMALTKGADGMLPMPMRDMRGNQNQQR |
Ga0207704_119589802 | 3300025938 | Miscanthus Rhizosphere | AKEMMEARVDAVFDSLRQDSDFLALTSGADGKLQMPMRNTTGTQNR |
Ga0207704_119696612 | 3300025938 | Miscanthus Rhizosphere | MEARVDAVFDSLRQDSAFLALTSGADGKLQMPMRNMTGTANQD |
Ga0207711_104045592 | 3300025941 | Switchgrass Rhizosphere | AVRAKEMMEARVDAVFDSLRQDSQFLALTSGADGKLRMPMRNMTGSSNRD |
Ga0207711_112696061 | 3300025941 | Switchgrass Rhizosphere | VDAVFDSLRQDSAFLALTSGADGRLQMPMRNMTGTQNR |
Ga0207689_102042824 | 3300025942 | Miscanthus Rhizosphere | VRAKEMMEARVDAVFDSLRQDSEFLALTNGADGKLRMPMRNMTGSSNRD |
Ga0207651_101215003 | 3300025960 | Switchgrass Rhizosphere | AKEMMEARVDAVFDSLRQDSAFLALTSGADGRLQMPMRNMTGTQNR |
Ga0207640_100582191 | 3300025981 | Corn Rhizosphere | YHAVRAPEMMEARVDAVFDSLRQDSAFLALTSGADGKLQMPMRNMTGTQNR |
Ga0208777_10104791 | 3300025996 | Rice Paddy Soil | RYQAVRAKEMMEARVDAVFDTLRQDSAFLALTSGADGKLQMPMRNITGTQNR |
Ga0207703_104004901 | 3300026035 | Switchgrass Rhizosphere | VDAVFDSLRQDSNFLALTSGADGKLQMPMRNMTGTQNR |
Ga0207703_121602761 | 3300026035 | Switchgrass Rhizosphere | YERYPAVREKEMMEARVDFVFDSLREDSEFLALTSGADGKLQMPMKSMEMR |
Ga0207639_102436411 | 3300026041 | Corn Rhizosphere | VDAVFDSLRQDSAFLALTSGADGRLQMPMKNMTGSANRD |
Ga0208780_10256171 | 3300026046 | Natural And Restored Wetlands | KEMMEARVDAVFDSLRQDSAFLALTSGADGKLMMPMRPLTSTANQH |
Ga0207702_123824572 | 3300026078 | Corn Rhizosphere | MMEARVDAVFDSLRQDSSFLALTSRADGKLQMPMRPMTGTNNR |
Ga0207648_114063142 | 3300026089 | Miscanthus Rhizosphere | MMEARVDAVFDSLRNDRGFMALTKGADGMLPMPMRDMRGNQN |
Ga0207648_116438491 | 3300026089 | Miscanthus Rhizosphere | RVDAVFDSLRADSDFLALTRQADGKLPMPEPMKGMNMPSQNR |
Ga0207698_106045212 | 3300026142 | Corn Rhizosphere | AVFDSLRQDSAFLALTSGADGRLQMPMKMGGTQNQNQ |
Ga0268265_122165511 | 3300028380 | Switchgrass Rhizosphere | MMEARVDAVFDSLREDPEFLALTSDADGKLQMPMKSMEMRQ |
Ga0268264_125139502 | 3300028381 | Switchgrass Rhizosphere | EMMEARVDAVFDSLRQDSAFLALTSGADGRLQMPMKNMTGSANRD |
Ga0307405_116245072 | 3300031731 | Rhizosphere | FDSLREDTAFVALTSGADGKLPIPMKGMNGSMQNR |
Ga0307414_100289261 | 3300032004 | Rhizosphere | YQAVRAKEMMEARVDAVFDSLRQDSAFLALTSGADGKLQMPMKNMTGSSNR |
Ga0310902_104102402 | 3300032012 | Soil | EMMEARVDAVFDSIRYDSGFLALTSGADGKLQMPMRGMKDMRSMQNQDR |
Ga0310896_103373501 | 3300032211 | Soil | QTVRAKEMMEARVDAVFDSIRYDSGFLALTSGADGKLQMPMRGMKDMRSMQNQDR |
⦗Top⦘ |