NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F057609

Metagenome / Metatranscriptome Family F057609

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F057609
Family Type Metagenome / Metatranscriptome
Number of Sequences 136
Average Sequence Length 66 residues
Representative Sequence SSDVPLRGAEIGAAAATGLPAMVAFLKAQQDLYAPAVARITQIANGQHVVTVRYDAPGPMGLGGS
Number of Associated Samples 120
Number of Associated Scaffolds 136

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 2.27 %
% of genes near scaffold ends (potentially truncated) 94.85 %
% of genes from short scaffolds (< 2000 bps) 94.85 %
Associated GOLD sequencing projects 120
AlphaFold2 3D model prediction Yes
3D model pTM-score0.41

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (96.324 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(34.559 % of family members)
Environment Ontology (ENVO) Unclassified
(18.382 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(58.088 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 13.98%    β-sheet: 16.13%    Coil/Unstructured: 69.89%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.41
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 136 Family Scaffolds
PF14344DUF4397 91.18
PF04203Sortase 2.21
PF14542Acetyltransf_CG 0.74

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 136 Family Scaffolds
COG3764Sortase (surface protein transpeptidase)Cell wall/membrane/envelope biogenesis [M] 2.21


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.32 %
UnclassifiedrootN/A3.68 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300003218|JGI26339J46600_10101013All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii707Open in IMG/M
3300004081|Ga0063454_100336244All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii969Open in IMG/M
3300004092|Ga0062389_103217102All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii612Open in IMG/M
3300004798|Ga0058859_11780486All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii696Open in IMG/M
3300004800|Ga0058861_11977662All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii953Open in IMG/M
3300005332|Ga0066388_106449155All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii592Open in IMG/M
3300005338|Ga0068868_101554657All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii620Open in IMG/M
3300005435|Ga0070714_102038490All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii559Open in IMG/M
3300005435|Ga0070714_102407983All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii511Open in IMG/M
3300005440|Ga0070705_101350268All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii592Open in IMG/M
3300005445|Ga0070708_101062888All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii758Open in IMG/M
3300005458|Ga0070681_11651530All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii566Open in IMG/M
3300005547|Ga0070693_100245920All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1184Open in IMG/M
3300005764|Ga0066903_104925922All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii709Open in IMG/M
3300006173|Ga0070716_101433367All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii562Open in IMG/M
3300006175|Ga0070712_101729566All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii547Open in IMG/M
3300006176|Ga0070765_100694351All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii961Open in IMG/M
3300006176|Ga0070765_101071258All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii762Open in IMG/M
3300006806|Ga0079220_10296010All Organisms → cellular organisms → Bacteria997Open in IMG/M
3300006806|Ga0079220_12066270All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii509Open in IMG/M
3300006854|Ga0075425_101676326All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii715Open in IMG/M
3300006904|Ga0075424_101827088All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii642Open in IMG/M
3300007076|Ga0075435_100271150All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1447Open in IMG/M
3300009520|Ga0116214_1038901All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1720Open in IMG/M
3300009551|Ga0105238_11928197All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii624Open in IMG/M
3300009698|Ga0116216_10260824All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1058Open in IMG/M
3300010081|Ga0127457_1058825All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii609Open in IMG/M
3300010090|Ga0127471_1030760All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii631Open in IMG/M
3300010104|Ga0127446_1069122All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii794Open in IMG/M
3300010120|Ga0127451_1125081All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii515Open in IMG/M
3300010152|Ga0126318_10991427All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii760Open in IMG/M
3300010154|Ga0127503_10861928All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii633Open in IMG/M
3300010333|Ga0134080_10231302All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii810Open in IMG/M
3300010376|Ga0126381_104277173All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii553Open in IMG/M
3300010401|Ga0134121_10801042All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii905Open in IMG/M
3300010859|Ga0126352_1229471All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii602Open in IMG/M
3300010866|Ga0126344_1105567All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii813Open in IMG/M
3300011119|Ga0105246_11607805All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii614Open in IMG/M
3300011120|Ga0150983_10155153All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1114Open in IMG/M
3300011120|Ga0150983_10618110All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii637Open in IMG/M
3300011120|Ga0150983_12735618All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii515Open in IMG/M
3300011120|Ga0150983_13342464All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii976Open in IMG/M
3300011120|Ga0150983_14892696All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii939Open in IMG/M
3300011270|Ga0137391_10573313All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii949Open in IMG/M
3300011332|Ga0126317_10286386All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii628Open in IMG/M
3300012210|Ga0137378_11055884All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii727Open in IMG/M
3300012285|Ga0137370_10664033All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii647Open in IMG/M
3300012357|Ga0137384_10975565All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii682Open in IMG/M
3300012381|Ga0134026_1166936All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii533Open in IMG/M
3300012386|Ga0134046_1195111All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii684Open in IMG/M
3300012391|Ga0134035_1328602All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii716Open in IMG/M
3300012393|Ga0134052_1163478All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii550Open in IMG/M
3300012404|Ga0134024_1270515All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii633Open in IMG/M
3300012409|Ga0134045_1173757All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii500Open in IMG/M
3300012960|Ga0164301_11728221All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii523Open in IMG/M
3300012986|Ga0164304_11798991All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii512Open in IMG/M
3300015359|Ga0134085_10514933All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii548Open in IMG/M
3300018060|Ga0187765_10958327Not Available584Open in IMG/M
3300018433|Ga0066667_12050562All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii527Open in IMG/M
3300020081|Ga0206354_10400656All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2156Open in IMG/M
3300020581|Ga0210399_11536929All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii515Open in IMG/M
3300021403|Ga0210397_10090193All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii2050Open in IMG/M
3300021404|Ga0210389_11013670All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii644Open in IMG/M
3300021474|Ga0210390_10465340All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1066Open in IMG/M
3300021860|Ga0213851_1560787All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii588Open in IMG/M
3300022499|Ga0242641_1007831All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii896Open in IMG/M
3300022528|Ga0242669_1062278All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii660Open in IMG/M
3300022529|Ga0242668_1158331All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii502Open in IMG/M
3300022530|Ga0242658_1065452All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii804Open in IMG/M
3300022532|Ga0242655_10114113All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii757Open in IMG/M
3300022708|Ga0242670_1043720All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii619Open in IMG/M
3300022711|Ga0242674_1010492All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii962Open in IMG/M
3300022713|Ga0242677_1012125All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii961Open in IMG/M
3300022713|Ga0242677_1030678All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii717Open in IMG/M
3300022714|Ga0242671_1010662All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1119Open in IMG/M
3300022715|Ga0242678_1028488All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii723Open in IMG/M
3300022717|Ga0242661_1031492All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii916Open in IMG/M
3300022718|Ga0242675_1009496All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1165Open in IMG/M
3300022718|Ga0242675_1073700All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii615Open in IMG/M
3300022718|Ga0242675_1089686All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii577Open in IMG/M
3300022720|Ga0242672_1015798All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii986Open in IMG/M
3300022720|Ga0242672_1088348All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii589Open in IMG/M
3300022722|Ga0242657_1069547All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii814Open in IMG/M
3300022726|Ga0242654_10301468All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii589Open in IMG/M
3300024178|Ga0247694_1034238All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii571Open in IMG/M
3300024254|Ga0247661_1067512All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii663Open in IMG/M
3300024288|Ga0179589_10085961All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1260Open in IMG/M
3300024288|Ga0179589_10175845All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii925Open in IMG/M
3300025931|Ga0207644_10500150All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1003Open in IMG/M
3300025960|Ga0207651_10830246All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii820Open in IMG/M
3300026095|Ga0207676_10727400All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii964Open in IMG/M
3300027775|Ga0209177_10122880All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii851Open in IMG/M
3300027857|Ga0209166_10402848All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii710Open in IMG/M
3300027857|Ga0209166_10566729All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii579Open in IMG/M
3300027898|Ga0209067_10490165All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii697Open in IMG/M
3300029701|Ga0222748_1013668All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1095Open in IMG/M
3300030529|Ga0210284_1337747All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii717Open in IMG/M
3300030625|Ga0210259_10048783All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii785Open in IMG/M
3300030863|Ga0265766_1008303All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii710Open in IMG/M
3300031545|Ga0318541_10241743All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1003Open in IMG/M
3300031545|Ga0318541_10766728All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii538Open in IMG/M
3300031564|Ga0318573_10070540All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1745Open in IMG/M
3300031708|Ga0310686_104385028All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii629Open in IMG/M
3300031715|Ga0307476_10461910All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii940Open in IMG/M
3300031719|Ga0306917_10949380All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii672Open in IMG/M
3300031764|Ga0318535_10391902All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii620Open in IMG/M
3300031771|Ga0318546_10087841All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2019Open in IMG/M
3300031777|Ga0318543_10250584All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii790Open in IMG/M
3300031779|Ga0318566_10493943All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii600Open in IMG/M
3300031795|Ga0318557_10467996All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii579Open in IMG/M
3300031796|Ga0318576_10129435All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1169Open in IMG/M
3300031799|Ga0318565_10068243All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1675Open in IMG/M
3300031808|Ga0316037_114709All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii566Open in IMG/M
3300031819|Ga0318568_10272650All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1049Open in IMG/M
3300031859|Ga0318527_10383166All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii599Open in IMG/M
3300031880|Ga0318544_10291415All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii633Open in IMG/M
3300031890|Ga0306925_10841930All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii948Open in IMG/M
3300031890|Ga0306925_11744828All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii599Open in IMG/M
3300031896|Ga0318551_10571874All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii651Open in IMG/M
3300031946|Ga0310910_10696847All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii803Open in IMG/M
3300031954|Ga0306926_11967229All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii658Open in IMG/M
3300031954|Ga0306926_12810903All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii525Open in IMG/M
3300032035|Ga0310911_10751949All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii564Open in IMG/M
3300032065|Ga0318513_10338287All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii732Open in IMG/M
3300032067|Ga0318524_10450432All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii673Open in IMG/M
3300032091|Ga0318577_10104295All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1329Open in IMG/M
3300032261|Ga0306920_102093867All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii790Open in IMG/M
3300032770|Ga0335085_11889130All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii609Open in IMG/M
3300032783|Ga0335079_10455839All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1370Open in IMG/M
3300032805|Ga0335078_10816582All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1134Open in IMG/M
3300033004|Ga0335084_11484488All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii671Open in IMG/M
3300034163|Ga0370515_0282921All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii702Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil34.56%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil9.56%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.41%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.41%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.68%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil3.68%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.68%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.94%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil2.21%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil2.21%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.21%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.21%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.47%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.47%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.47%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.47%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.47%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil1.47%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated1.47%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.47%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil1.47%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds0.74%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.74%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.74%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.74%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.74%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.74%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.74%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.74%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.74%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.74%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.74%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.74%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.74%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.74%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.74%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300003218Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1EnvironmentalOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004798Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300004800Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009520Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaGEnvironmentalOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300009824Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaGEnvironmentalOpen in IMG/M
3300010081Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_0_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010090Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_24_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010104Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_16_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010120Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_24_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010152Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010154Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010859Boreal forest soil eukaryotic communities from Alaska, USA - C5-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010866Boreal forest soil eukaryotic communities from Alaska, USA - C1-3 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300011332Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012381Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_24_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012386Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_24_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012391Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_16_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012393Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_0_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012404Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_8_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012409Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_16_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300015359Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015EnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300020081Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021860Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022499Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-14-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022528Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022529Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022530Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022532Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022708Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022711Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022713Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022714Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022715Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022717Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022718Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022720Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022722Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022726Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300024178Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK35EnvironmentalOpen in IMG/M
3300024254Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK02EnvironmentalOpen in IMG/M
3300024288Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungalEnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300027857Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027898Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300029701Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030529Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO740-VDE013SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030625Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO122-ANR120SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030863Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031808Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLE3 metaT (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031859Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25EnvironmentalOpen in IMG/M
3300031880Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032065Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032091Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300034163Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI26339J46600_1010101323300003218Bog Forest SoilPGVSSDVPLRGAEIGAAASASLPAMVAFLSAQQSQYAPAVARITKVANGQPVVTVRYDAPGPMGLGGS*
Ga0063454_10033624423300004081SoilGAEIGAAASAGLPAMVAFMHAQQGGYAPAVARITRNASGRPVFIVRYDAPGPMELDGS*
Ga0062389_10321710223300004092Bog Forest SoilLVAFDDPSPGVSSDVPLRGAEIGATASAGLPAMVAFLRAQQSQYAPAVARITQGANGQSVVTVRYDAPGPMGLGGS*
Ga0058859_1178048613300004798Host-AssociatedLRGAEIGASTAAGLPAMVTFLKAQQDQYAPAVASVTQIANGRHVVTVRYDAPGPMGLEGS
Ga0058861_1197766223300004800Host-AssociatedVPLRGAEIGAATAAGLPAMVTFLKAQQDEYAPAVASITQNANGRAVVTVRYDAPGPMALEGS*
Ga0066388_10644915513300005332Tropical Forest SoilLVAFDDPSPGASSDVPLRGAEIGAAAAAGLPAMVAFLKAQQDLYAPAVARITQIANGQHVVTVRYDAPGPMGLGGS*
Ga0068868_10155465713300005338Miscanthus RhizosphereASPDVPLRGAEIGASTAAGLPAMVTFLKAQQDEYAPAVASITQIANGRHVVTVRYDAPGPMGLGGS*
Ga0070714_10203849023300005435Agricultural SoilGASPDVPLRGAEIGAATAAGLPAMVTFLKAQQDEYAPAVASITQIANGRHVVTVRYDAPGPMALEGS*
Ga0070714_10240798313300005435Agricultural SoilAEIGAATAAGLPAMVTFLKAQQNEYAPAVASLTQIANGRHVVTVRYDAPGPMALEGS*
Ga0070705_10135026823300005440Corn, Switchgrass And Miscanthus RhizosphereVPLRGAEIGAATAAGLPAMVTFLKAQQDEYAPAVASITQIANGRHVVTVRYDAPGPMGLEGS*
Ga0070708_10106288813300005445Corn, Switchgrass And Miscanthus RhizosphereASPDVPLRGAEIGAATAAGLPAMVTFLKAQQDEYAPAVASITQIANGRHVVTVRYDAPGPMGLEGS*
Ga0070681_1165153023300005458Corn RhizosphereDVPLRGAEIGASTAAGLPAMVTFLKAQQDEYAPAVASITQNANGRHVVTVRYDAPGPMALEGS*
Ga0070686_10084345223300005544Switchgrass RhizosphereASTAAGLPAMVTFLKAQQDEYAPAVASITQNANGRHVVTVRYDAPGPMALEGS*
Ga0070693_10024592023300005547Corn, Switchgrass And Miscanthus RhizosphereDPSPGASPDVPLRGAEIGAATAAGLPAMVTFLKAQQDEYAPAVASITQIANGRHVVTVRYDAPGPMGLEGS*
Ga0066903_10492592223300005764Tropical Forest SoilSSDVPLRGAEIGAAASAGLPAMVKFLSAQQAQYAPAVARISQIANGQHVVTVRYDAPGPMGLGGS*
Ga0070716_10143336713300006173Corn, Switchgrass And Miscanthus RhizosphereAFDDPSPGASPDVPLRGAEIGAATAAGLPAMVTFLKAQQNEYAPAVASLTQIANGRHVVTVRYDAPGPMALEGS*
Ga0070712_10172956613300006175Corn, Switchgrass And Miscanthus RhizosphereSPGASPDVPLRGAEIGAATAAGLPAMVTFLKAQQDEYAPAVASLTQLANGRHVVTVRYDAPGPMALEGS*
Ga0070765_10069435113300006176SoilFDDPSPGVSSDVPLRGAELGTAATAGLSAMVTFLNAQQSQYKTAVASITQVANGQSVVTVRYDAPGPMGLGGS*
Ga0070765_10107125813300006176SoilGVEIGAAAAAGLPAMVAFLKAQQDEYAPAVASITEIANGQHVVTVRYDAPGPMGLGGS*
Ga0079220_1029601013300006806Agricultural SoilDVPLRGAELGATAATGLPAMVAFLKAQQDLYAPAVARITQIANGQRVVTVRYDAPGPMGLEGS*
Ga0079220_1206627023300006806Agricultural SoilVPLRGAEIGAATAAGLPAMVTFLKAQQDEYAPAVASITQIANGQHVVTVRYDAPGPMGLDG*
Ga0075425_10167632613300006854Populus RhizosphereVPLRGAEIGAATAAGLSAMVTFLKAQQDQYAPAVASITQVANGQHVVTVRYDAPGPMGLEGS*
Ga0075424_10182708813300006904Populus RhizosphereSPGASPDVPLRGAEIGAATAAGLPAMVTFLKAQQDEYAPAVANITQIANGQHVVTVRYDAPGPMALEGS*
Ga0075435_10027115033300007076Populus RhizosphereVPLRGAEIGAATAAGLPAMVTFLKAQQDEYAPAVASLTQIANGRHVVTVRYDAPGPMALEGS*
Ga0116214_103890113300009520Peatlands SoilSSGVPLRGAEIGAAASTGLPAMVAFLGAQQSQYAPAVARITQVAKGQSVVTVRYDAPGPMGLGGP*
Ga0105238_1192819723300009551Corn RhizosphereSPGASPDVPLRGAEIGASTAAGLPAMVTFLKAQQDEYAPAVASVTQIANGRHVVTVRYDAPGPMGLEGS*
Ga0116216_1026082423300009698Peatlands SoilGVSSDVPLRGVEIGAATSAGLSAMVTFLSAQQSQYAPAVARITQVAKGQHVVTVRYDAPGPMGLGGS*
Ga0116219_1004783313300009824Peatlands SoilLGAAASAGLPAMVAFLSAQQSQYAPAVARITQVANGKSVVTVRYDAPGPMGLGGS*
Ga0127457_105882523300010081Grasslands SoilLRSVEIGAAAAAGLPAMVAFLKAQQDQYAPAVASITETANGQHVVTVRYDAPGPMGLEGS
Ga0127471_103076023300010090Grasslands SoilSDVPLRSVEIGAAAAAGLPAMVAFLKAQQDQYAPAVASITETANGQHVVTVRYDAPGPMGLGGS*
Ga0127446_106912223300010104Grasslands SoilFDDPSPGASSDVPLRGAQIGAIAPAGLPAMVTFLKAQQDQYAPAVASIKQIANGQHVVTVRYDAPGPMGLGGS*
Ga0127451_112508113300010120Grasslands SoilSDVPLRSVEIGAAAAAGLPAMVAFLKAQQDQYAPAVASITETANGQHLVTVRYDAPGPMGLGGS*
Ga0126318_1099142713300010152SoilSDVPLRGAELGAAASTGLSAMVKFFSAQQDLYAPAVARITQIANGQRVVTVRYDAPGPMSLEGS*
Ga0127503_1086192823300010154SoilAELGAAAATGLPAMVAFLKAQQDQYAPAVASITQIANGQHVVTVRYDAPGPMGLGGS*
Ga0134086_1021764923300010323Grasslands SoilGAAAASGLPAMVKFLQAQQDQYAPAVASITQIANGQHVVTVRYDAPGPLGLDGS*
Ga0134080_1023130223300010333Grasslands SoilASSDVPLRGAQIGAIAPAGLPAMVTFLKAQQDQYAPAVASIKQIANGQHVVTVRYDAPGPMGLGGS*
Ga0134128_1282653513300010373Terrestrial SoilIGAAVPAGLPAMAAFMRAQQGEFAPAVARITQDAGGRHVFIVRYDAPGPMGLEGS*
Ga0126381_10427717313300010376Tropical Forest SoilIQLVAFDDPSPGASSDIPLRGAELGSAASAGLPAMVKFLSAQQDQYAPAVARITQIANGQHVVTVRYDAPGPMGLEGS*
Ga0134121_1080104213300010401Terrestrial SoilAFDDPSPGAGSDVPLRGAEIGAATAAGLPAMVAFLKAQQDQYAPAVASITQIANGQHVVTVRYDAPGPMGLGGS*
Ga0126352_122947123300010859Boreal Forest SoilPDVPLRGAEIGAAASAGLPAMVAFLSAQQSQYAPAVARITQVAEGKSVVTVRYDAPGPMGLGGS*
Ga0126344_110556713300010866Boreal Forest SoilPDVPMRGAELGAAASTSLSAMVAFVRAQQGQFAPAVARITQDAGGQHVFIVRYDAPGPMGLEGS*
Ga0105246_1160780523300011119Miscanthus RhizosphereQLVAFDDSSPGASPDVPLRGAEIGASTAAGLPAMVTFLKAQQDEYAPAVASITQNANGRHVVTVRYDAPGPMALEGS*
Ga0150983_1015515313300011120Forest SoilPGASSEVPLRGAELGAAASAGLPAMVAFLKAQQDQYAPAVARITQTASGQSVVTVRYDAPGPMGLGGS*
Ga0150983_1061811023300011120Forest SoilLVAFDDPSPGASSDVPLRGAEIGATASAGLPAMVAFLRAQQNQYAPAVARITQGANGQSVVTVRYDAPGPMGLGGS*
Ga0150983_1273561823300011120Forest SoilVAFDDPSPGASSDVPLRGAELGAAAATSLPAMVSFYKAQQVQYAPTVASITRTANGIQVVTVRYDAPGPMGLTGS*
Ga0150983_1334246413300011120Forest SoilDVPLRGAELGAAAATGLPAMVTFLKAQQDQYAPAVARITQIANGQHVVTVRYDAPGPMGLGGS*
Ga0150983_1489269613300011120Forest SoilLQLVAFDDPSPGVSSDVPLRGAEIGAAASAGLPAMVAFLRAQQSQYAPAVARITKVAKGQSMVTVRYDAPGPMGLGGS*
Ga0137391_1057331313300011270Vadose Zone SoilLGAAAPTGLPAMVAFLKAQQSQYAPAVDRIIQVANGQQVVIVRYDAPGLLGLGGS*
Ga0126317_1028638613300011332SoilSPDVPLRGAEIGAATAAGLPAMVTFLKAQQDQYAPAVASITQVANGQHVVTVRYAAPGPMGLEGS*
Ga0137378_1105588423300012210Vadose Zone SoilASSEVPLRGAELGAAASAGLPAMVAFLKAQQNQYAPAVARITQTTSGQSVVTVRYDAPGPMGLGGS*
Ga0137370_1066403313300012285Vadose Zone SoilRGVEIGAATAAGLPAMVAFLRAQQNQYAPAVANITEMANGQHVVTVRYDAPGPMGLEGS*
Ga0137384_1097556523300012357Vadose Zone SoilPLRGADIGAATAAGLPAMVTFLKAQQDQYAPAVANIIQIANGQHVVTVRYDAPGPMGLEGS*
Ga0134026_116693623300012381Grasslands SoilVPLRGAEIGAAFPAGLSAMAAFMRAQQGEFAPAVARITQDAGGRHVFIVRYDAPGPMGLEGS*
Ga0134046_119511133300012386Grasslands SoilGASSDVPLRSVEIGAAAAAGLPAMVAFLKAQQDQYAPAVASITETANGQHVVTVRYDAPGPMGLGGS*
Ga0134035_132860223300012391Grasslands SoilASSDVPLRGVEIGAAAAAGLPAMVAFLKAQQDQYAPTVASITEIANGQHVVTVRYDAPGPMGLGGS*
Ga0134052_116347823300012393Grasslands SoilGASPDVPLRGAEIGAATPAGLPAMVTFLKAQQDQYAPAVASITQLANGRHVVTVRYDAPGPMGLEGS*
Ga0134024_127051523300012404Grasslands SoilASSDVPLRGVEIGAATAAGLPAMVAFLRAQQNQYAPAVANITEMANGQHVVTVRYDAPGPMGLGGS*
Ga0134045_117375723300012409Grasslands SoilFDDLSPGASSDVPLRSVEIGAAAAAGLPAMVAFLKAQQDQYAPAVASITETANGQHVVTVRYDAPGPMGLGGS*
Ga0164301_1172822123300012960SoilGASPDVPLRGAEIGTATAAGLPAMVTFLKAQQDEYAPAVASITQIANGQHVVTVRYDAPGPMGLGGS*
Ga0164304_1179899113300012986SoilPGAGSEVPLRGAEIGAAAAAGLPAMVAFLKAQQDQYAPAVASITQIANGQHVVTVRYDAPGPMGLGGS*
Ga0134085_1051493313300015359Grasslands SoilIHLVAFDDPSPGASSDVPLRGVEIGAAAASGLPAMVKFLQAQQDQYAPAVASITQIANGQHVVTVRYDAPGPMGLGGS*
Ga0187765_1095832723300018060Tropical PeatlandVPLRGAELGAATTTGLPAMVAFYKAQQDQYAPTVATITQSTNGQHVVTVRYDAPGPMGLGGS
Ga0066667_1205056223300018433Grasslands SoilDVPLRGAEIGAAAAAGLPAMVAFLKAQQDQYAPAVASIIQIANGQHVVTVRYDAPGPMGLGGS
Ga0206354_1040065613300020081Corn, Switchgrass And Miscanthus RhizospherePGASPDVPLRGAEIGAATAAGLPAMVTFLKAQQDEYAPAVASITQIANGRHVVTVRYDAPGPMGLEGS
Ga0210399_1153692913300020581SoilPGASSDVPLRGAELGATAATGLPAMVAFLKAQQDLYAPAVARITQIANGQRVVTVRYDAPGPMGLEGS
Ga0210397_1009019343300021403SoilPGASSDVPLRGAEIGATASAGLPAMVAFLRAQQNQYAPAVARITQGANGQSVVTVRYDAPGPMGLGGS
Ga0210389_1101367023300021404SoilAPAPGAGSDVPLRGAELGAAAATGLPAMVAFLKAQQDQYAPAVASITQIANGQRVVTVRYDAPGPMGLGGS
Ga0210390_1046534013300021474SoilFDDPSPGVSSDVPLRGAEIGATASAGLPAMVAFLRAQQSQYAPAVARITQGANGQSVVTVRYDAPGPMGLGGS
Ga0213851_156078713300021860WatershedsFDDPSPGVNSDVPLRGAEIGAAASAGLSAMVTFLRAQQSQYAPAVAHITKVAKGQSVVTVRYDAPGPMGLGGS
Ga0242641_100783113300022499SoilDVPLRGAEIGATASAGLPAMVAFLRAQQNQYAPAVARITQGANGQSVVTVRYDAPGPMGLGGS
Ga0242669_106227813300022528SoilLRGAELGAAAATGLPAMVAFLKAQQDQYAPAVASITQIANGQHVVTVRYDAPGPMGLGGS
Ga0242668_115833123300022529SoilSDVPLRGVEIGAATAAGLPAMVAFLRAQQNQYAPAVANITEMANGQHVVTVRYDAPGPMGLGGS
Ga0242658_106545213300022530SoilDVPLRGAEIGAAASAGLPAMVAFMRAQQGEYAPAVARITQNASGRPVFIVRYDAPGPMELDGS
Ga0242655_1011411313300022532SoilDDLSPGASSDVPLRGVEIGAAAAAGLPAMVAFLKAQQDEYAPAVASITEIANGQHVVTVRYDAPGPMGLGGS
Ga0242670_104372013300022708SoilSSDVPLRGVEIGAATAAGLPAMVAFLKAQQDEYAPAVANITETANGQHVVTVRYDAPGPMGLGGS
Ga0242674_101049213300022711SoilDDPSPGVSSDVPLRCAEIGATASAGLPAMVAFLRAQQSQYAPAVARITQGANGQSVVTVRYDAPGPMGLGGS
Ga0242677_101212523300022713SoilSDVPLRGAEIGATASAGLPAMVAFLRAQQNQYAPAVARITQGANGQSVVTVRYDAPGPMGLGGP
Ga0242677_103067823300022713SoilSSDVPLRGAELGTAATAGLSAMVTFLNAQQSQYKPAVASITQVANGQSVVTVRYDAPGPMGLGGS
Ga0242671_101066213300022714SoilASSDVPLRGAEIGATASAGLPAMVAFLRAQQSQYAPAVARITQGANGQSVVTVRYDAPGPMGLGGS
Ga0242678_102848823300022715SoilSSDVPLRGVEIGAAAAAGLPAMVAFLKAQQDEYAPAAANITETANGQHVVTVRYDAPGPMGLGGS
Ga0242661_103149223300022717SoilVAFDDPSPGASSDVPLRGAELGAAAATGLPAMVTFLKAQQDQYAPAVASITKIANGQHVVTVRYDAPGPMGLGGS
Ga0242675_100949623300022718SoilPGVSSDVPLRGAELGTAATAGLSAMVTFLNAQQSQYKPAVASITQVANGQSVVTVRYDAPGPMGLGGS
Ga0242675_107370013300022718SoilAELGATAATGLPAMVAFLKAQQDLYAPAVARITQIANGQRVVTVRYDAPGPMGLGGS
Ga0242675_108968623300022718SoilSSEIPLRGAELGAAAATSLPAMVSFYKAQQVQYAPTVASITRTANGIQVVTVRYDAPGPMGLTGL
Ga0242672_101579813300022720SoilGASSDVPLRGVEIGAAAAAGLPAMVAFLKAQQDEYAPAVASITEIANGQHVVTVRYDAPGPMGLGGS
Ga0242672_108834823300022720SoilDVPLRGAELGAAAATGLSAMVTFLKAQQDQYAPAVASITKIANGQHVVTVRYDAPGPMGLGGS
Ga0242657_106954713300022722SoilSDVPLRGVEIGAAAAAGLPAMVAFLKAQQDEYAPAVASITEIANGQHVVTVRYDAPGPMGLGGS
Ga0242654_1030146823300022726SoilLVAFDDPSPGASSDVPLRGAELGAAAAKSLPAMVAFYKAQQVQYAPTVASITQTANGIQVVTVRYDAPGPMGLTGS
Ga0247694_103423823300024178SoilDVPLRGAEIGAATAAGLPAMVTFLKAQQDEYAPAVASITQIANGRHVVTVRYDAPGPMGLEGS
Ga0247661_106751223300024254SoilEIGAATAAGLPAMVTFLKAQQDEYAPAVASITQIANGRHVVTVRYDAPGPMGLEGS
Ga0179589_1008596133300024288Vadose Zone SoilPSPGAGSDVPLRGAEIGAAAAAGLSAMVAFLKAQQDQYAPAVASITQIANGQHVVTVRYDAPGPMGLGGS
Ga0179589_1017584523300024288Vadose Zone SoilSPGASPDVPLRGAEIGAATAAGLPAMVTFLKAQQDEYAPAVASITQIANGQHVVTVRYDAPGPMALEGS
Ga0207644_1050015023300025931Switchgrass RhizosphereMPLKLIAFEDLSPGASADVPLRGAEIGAAAPAGLSAMAAFMRAQQGEFAPAVARITQDASGRRVFIVRYDAPGPMGLEGS
Ga0207651_1083024613300025960Switchgrass RhizosphereASPDVPLRGAEIGASTAAGLPAMVTFLKAQQDEYAPAVASITQNANGRHVVTVRYDAPGPMALEGS
Ga0207676_1072740013300026095Switchgrass RhizosphereLRGAEIGAAAPAGLSAMAAFMRAQQGEFAPAVARITQDASGRRVFIVRYDAPGPMGLEGS
Ga0209177_1012288023300027775Agricultural SoilEDLSPGASTDVPLRGAEIGAAVPAGLPTMAAFMRAQQGEFAPAVARITQDAGGRRVFIVRYDAPGPMGLEGS
Ga0209166_1040284823300027857Surface SoilPDVPLRGAELGAAAPTGLPAMVAFLKAQQSQYAPAEARITQIANGQQVVIVRYDAPGPLGLGGS
Ga0209166_1056672913300027857Surface SoilRGVEIGAAAPAGLSAMVAFMRAQQGEFAPAVARITQDAGGRHVFIARYDAPGPMGLDGS
Ga0209067_1049016523300027898WatershedsVSSDVPLRGAEVGAAASAGLPAMVTFLRAQQSQYAPTVARITQGSNGQSVVTVRYDAPGPMGLGGS
Ga0222748_101366823300029701SoilVSSDVPLRGAELGTAATAGLSAVVTFLNAQQSQYKPAVASITQVANGQSVVTVRYDAPGPMGLGGS
Ga0210284_133774723300030529SoilVPLRGVEIGAAASAGLPAMLAFLTAQQPSFAPAKAVITRNASGRSVLSVRYDAPSPMDVGGS
Ga0210259_1004878323300030625SoilSDVPLRGAEIGAVASVGLPAMVVFLRAQQSQYAPAVARITQGANGQSVVTVRYDAPGPMGLGGS
Ga0265766_100830313300030863SoilGVSSDVPLRGAEIGATASAGLPAMVAFLRAQQSQYAPAVARITQGANGQSVVTVRYDAPGPMGLGGS
Ga0318541_1024174313300031545SoilVSSDVPLRGAQLGATASAGLPAMVTFLNAQQDQFAPAVARIIKTASGQSVVTVRYDAPGPMGLGGS
Ga0318541_1076672813300031545SoilSPGASSDVPLRGAEIGAVAATGLPAMVAFLKAQQDLYAPAVARITQIANGQHVVTVRYDAPGPMGLGGS
Ga0318573_1007054033300031564SoilPLRGAEIGAAAATGLPAMVAFLKAQQDLYAPAVARITQIANGQHVVTVRYDAPGPMGLGG
Ga0310686_10438502823300031708SoilGVSSDVPLRGAEIGATAAAGLPAMVTFLGAQQTQYAPAVTRITQVANGQSVVTVRYDAPGPMGLGGS
Ga0307476_1046191023300031715Hardwood Forest SoilLRLVSFDDPSPGVNSDVPLRGAELGTAATAGLSAMVTFLNAQQSQYKPAVASITQVANGQSVVTVRYDAPGPMGRGGS
Ga0306917_1094938023300031719SoilLVAFDDPSPGASSDVPLRGAELGAAAATGLSAMVTFLGAQQDLYAPAVARITQIADGQRVVTVRYDAPGPMGLGDS
Ga0318535_1039190223300031764SoilPLRGAELGAAAPASLPAMVAFLVAQQSQFAPAVARITKTANGQSVVIVRYDAPGPMGLEG
Ga0318546_1008784143300031771SoilAELGAAATTGLPAMVAFYNAQQDQYAPTVASITQSTNGQHVVTVRYDAPGPMGLGGS
Ga0318543_1025058413300031777SoilSPGVSSDIPLRGAELGAAATTGLPAMVAFYKAQQDQYAPTVASITQSTNGQHVVTVRYDAPGPMGLGGS
Ga0318566_1049394323300031779SoilPGASSDVPLRGAELGAAASAGLPAMVRFLSAQQDLYAPAVARITQIANGQHVVTVRYDAPGPMGLGDS
Ga0318557_1046799613300031795SoilGAQLGATASAGLPAMVTFLNAQQDQFAPAVARIIKTASGQSVVTVRYDAPGPMGLGGS
Ga0318576_1012943533300031796SoilAELGAAATTGLPAMVAFYKAQQDQYAPTVASITQSTNGQHVVAVRYDAPGPMGLGGS
Ga0318565_1006824333300031799SoilRLVAFDDPSPGASSGVPLRGAELGAAAPASLPAMVAFLVAQQSQFAPAVARITKTANGQSVVIVRYDAPGPMGLEGS
Ga0316037_11470923300031808SoilSSDVPLRGAEIGAAASAGLPAMVAFLRAQQSQYAPAVARITQGANGQSVVTVRYDAPGPMGLGGS
Ga0318568_1027265013300031819SoilAFDDPSPGVSSDVPLRGAELGAAAPASLPAMVAFLVAQQSQFAPAVARITKTANGQSVVIVRYDAPGPMGLEGS
Ga0318527_1038316623300031859SoilAELGAAASAGLPAMVAFLSAQQDQYAPAVARITRIANGQSVVIVRYDAPGPMGLGGS
Ga0318544_1029141513300031880SoilSSDVPLRGAEIGAAAATGLPAMVAFLKAQQDLYAPAVARITQIANGQHVVTVRYDAPGPMGLGGS
Ga0306925_1084193023300031890SoilSSDIPLRGAELGAAATTGLPAMVAFYNAQQDQYAPTVASITQSTNGQHVVAVRYDAPGPMGLGGS
Ga0306925_1174482813300031890SoilDDPSPGVSSGVPLRGAEHGAAAPASLPAMVAFLVAQQSQFAPAVARITKTANGQSVVIVRYDAPGPMGLEGS
Ga0318551_1057187423300031896SoilDVPLRGAELGSAASAGLPAMVKFLSAQQDQYAPAVARITQIANGQHVVTVRYDAPGPMGLEGS
Ga0310910_1069684723300031946SoilDPSPGVSPDIPLRGAEVGAAASAGLPAMVTFLKAQQDQFAPAVARITKTASGQSVVTVRYDAPGPMGLGDS
Ga0306926_1196722913300031954SoilDPSPGASSDVPLRGAEIGAAAATGLPAMVAFLKAQQDLYAPAVARITQIANGQHVVTVRYDAPGPMGLGGS
Ga0306926_1281090323300031954SoilRLVAFDDPSPGVSSGVPLRGAELGAAAPASLPAMVAFLVAQQSQFAPAVARITKTANGQSVVIVRYDAPGPMGLEGS
Ga0310911_1075194913300032035SoilFDDPSPGASSDVPLRGAEIGAAAATGLPAMVAFLKAQQDLYAPAVARITQIANGQHVVTVRYDAPGPMGLGGS
Ga0318513_1033828713300032065SoilFDDPSPGVSSGVPLRGAELGAAAPASLPAMVAFLVAQQSQFAPAVARITKTANGQSVVIVRYDAPGPMGLEGS
Ga0318524_1045043223300032067SoilQLVAFDDPSPGASSDVPLRGAELGAAAATGLSAMVTFLGAQQDLYAPAVARITQIADGQRVVTVRYDAPGPMGLGDS
Ga0318577_1010429533300032091SoilLRGAEIGAAAATGLPAMVAFLKAQQDLYAPAVARITQIANGQHVVTVRYDAPGPMGLGGS
Ga0306920_10209386713300032261SoilELGAAATTGLPAMVAFYKAQQDQYAPTVASITQSTNGQHVVTVRYDAPGPMGLGGS
Ga0335085_1188913023300032770SoilDDPSPGVSSDVPLRGAELGAAAAAGLPAMVAFLSAQQSPYAPAVARITQTANGQSVVTVRYDAPGPMGLDGS
Ga0335079_1045583913300032783SoilAFDDPSPGVDSDVPLRGAELGAAAPAGLSAMVTFLNAQQSQFAPAVARVTKTANGQSVVTVRYDAPGPMGLGGS
Ga0335078_1081658213300032805SoilVSSDVPLRGAELGAAVAAGLPAMVAFLSAQQSPYAPAVARITQTANGQSVVTVRYDAPGPMGLGGS
Ga0335084_1148448823300033004SoilSDVPLRGAELGAAATTGLPAMVAFYKAQQDQYAPTVASITQSTNGQHVVTVRYDAPGPMGLGGS
Ga0370515_0282921_3_1823300034163Untreated Peat SoilRGAEIGAASTAGLSAVLGFLRAQQAPYLPASAAIARAVSGQSVVTVRYDAPGPMDVGGS


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.