NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F057604

Metagenome / Metatranscriptome Family F057604

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F057604
Family Type Metagenome / Metatranscriptome
Number of Sequences 136
Average Sequence Length 42 residues
Representative Sequence EAARGMQLLNKKYFPWKQLLGFFASFSRRERTVFVIRPG
Number of Associated Samples 115
Number of Associated Scaffolds 136

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.74 %
% of genes near scaffold ends (potentially truncated) 99.26 %
% of genes from short scaffolds (< 2000 bps) 94.85 %
Associated GOLD sequencing projects 108
AlphaFold2 3D model prediction Yes
3D model pTM-score0.29

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (93.382 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(24.265 % of family members)
Environment Ontology (ENVO) Unclassified
(32.353 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(56.618 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 37.31%    β-sheet: 0.00%    Coil/Unstructured: 62.69%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.29
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 136 Family Scaffolds
PF09723Zn-ribbon_8 10.29
PF01008IF-2B 9.56
PF02615Ldh_2 8.09
PF00144Beta-lactamase 5.15
PF07676PD40 4.41
PF00903Glyoxalase 1.47
PF02897Peptidase_S9_N 1.47
PF00072Response_reg 0.74
PF00581Rhodanese 0.74
PF02621VitK2_biosynth 0.74
PF00174Oxidored_molyb 0.74
PF01243Putative_PNPOx 0.74
PF07045DUF1330 0.74
PF00557Peptidase_M24 0.74
PF04389Peptidase_M28 0.74
PF00239Resolvase 0.74
PF01053Cys_Met_Meta_PP 0.74
PF02517Rce1-like 0.74
PF01022HTH_5 0.74
PF12681Glyoxalase_2 0.74
PF00069Pkinase 0.74
PF01545Cation_efflux 0.74

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 136 Family Scaffolds
COG01825-methylthioribose/5-deoxyribulose 1-phosphate isomerase (methionine salvage pathway), a paralog of eIF-2B alpha subunitAmino acid transport and metabolism [E] 9.56
COG1184Translation initiation factor 2B subunit, eIF-2B alpha/beta/delta familyTranslation, ribosomal structure and biogenesis [J] 9.56
COG2055Malate/lactate/ureidoglycolate dehydrogenase, LDH2 familyEnergy production and conversion [C] 8.09
COG1680CubicO group peptidase, beta-lactamase class C familyDefense mechanisms [V] 5.15
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 5.15
COG2367Beta-lactamase class ADefense mechanisms [V] 5.15
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 2.94
COG1505Prolyl endopeptidase PreP, S9A serine peptidase familyAmino acid transport and metabolism [E] 1.47
COG1770Protease IIAmino acid transport and metabolism [E] 1.47
COG0053Divalent metal cation (Fe/Co/Zn/Cd) efflux pumpInorganic ion transport and metabolism [P] 0.74
COG0075Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucGAmino acid transport and metabolism [E] 0.74
COG01567-keto-8-aminopelargonate synthetase or related enzymeCoenzyme transport and metabolism [H] 0.74
COG0399dTDP-4-amino-4,6-dideoxygalactose transaminaseCell wall/membrane/envelope biogenesis [M] 0.74
COG0436Aspartate/methionine/tyrosine aminotransferaseAmino acid transport and metabolism [E] 0.74
COG0520Selenocysteine lyase/Cysteine desulfuraseAmino acid transport and metabolism [E] 0.74
COG0626Cystathionine beta-lyase/cystathionine gamma-synthaseAmino acid transport and metabolism [E] 0.74
COG1230Co/Zn/Cd efflux system componentInorganic ion transport and metabolism [P] 0.74
COG1266Membrane protease YdiL, CAAX protease familyPosttranslational modification, protein turnover, chaperones [O] 0.74
COG1427Chorismate dehydratase (menaquinone biosynthesis, futalosine pathway)Coenzyme transport and metabolism [H] 0.74
COG1921Seryl-tRNA(Sec) selenium transferaseTranslation, ribosomal structure and biogenesis [J] 0.74
COG1961Site-specific DNA recombinase SpoIVCA/DNA invertase PinEReplication, recombination and repair [L] 0.74
COG1982Arginine/lysine/ornithine decarboxylaseAmino acid transport and metabolism [E] 0.74
COG2008Threonine aldolaseAmino acid transport and metabolism [E] 0.74
COG2041Molybdopterin-dependent catalytic subunit of periplasmic DMSO/TMAO and protein-methionine-sulfoxide reductasesEnergy production and conversion [C] 0.74
COG2452Predicted site-specific integrase-resolvaseMobilome: prophages, transposons [X] 0.74
COG2873O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependentAmino acid transport and metabolism [E] 0.74
COG3915Uncharacterized conserved proteinFunction unknown [S] 0.74
COG3965Predicted Co/Zn/Cd cation transporter, cation efflux familyInorganic ion transport and metabolism [P] 0.74
COG4100Cystathionine beta-lyase family protein involved in aluminum resistanceInorganic ion transport and metabolism [P] 0.74
COG4449Predicted protease, Abi (CAAX) familyGeneral function prediction only [R] 0.74
COG5470Uncharacterized conserved protein, DUF1330 familyFunction unknown [S] 0.74

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms93.38 %
UnclassifiedrootN/A6.62 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002568|C688J35102_120985894All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia6400Open in IMG/M
3300002917|JGI25616J43925_10232390Not Available698Open in IMG/M
3300004080|Ga0062385_11049486All Organisms → cellular organisms → Bacteria550Open in IMG/M
3300004091|Ga0062387_101361751All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 13_1_20CM_4_60_6563Open in IMG/M
3300005174|Ga0066680_10595947All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium692Open in IMG/M
3300005332|Ga0066388_103502757All Organisms → cellular organisms → Bacteria → Acidobacteria801Open in IMG/M
3300005545|Ga0070695_101560466All Organisms → cellular organisms → Bacteria → Acidobacteria550Open in IMG/M
3300005555|Ga0066692_10330860All Organisms → cellular organisms → Bacteria → Acidobacteria966Open in IMG/M
3300005556|Ga0066707_10819022All Organisms → cellular organisms → Bacteria574Open in IMG/M
3300005576|Ga0066708_10674825Not Available656Open in IMG/M
3300005591|Ga0070761_10687931Not Available640Open in IMG/M
3300005598|Ga0066706_11325187All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300005921|Ga0070766_10462365Not Available839Open in IMG/M
3300006059|Ga0075017_101447571All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium541Open in IMG/M
3300006173|Ga0070716_101659581All Organisms → cellular organisms → Bacteria → Acidobacteria526Open in IMG/M
3300006176|Ga0070765_100285965All Organisms → cellular organisms → Bacteria1521Open in IMG/M
3300006176|Ga0070765_101128241All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae741Open in IMG/M
3300006176|Ga0070765_101995906All Organisms → cellular organisms → Bacteria543Open in IMG/M
3300006176|Ga0070765_102050062All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae535Open in IMG/M
3300006804|Ga0079221_10268435All Organisms → cellular organisms → Bacteria → Acidobacteria981Open in IMG/M
3300007255|Ga0099791_10196406All Organisms → cellular organisms → Bacteria950Open in IMG/M
3300007265|Ga0099794_10310437All Organisms → cellular organisms → Bacteria817Open in IMG/M
3300009012|Ga0066710_101701955All Organisms → cellular organisms → Bacteria960Open in IMG/M
3300009038|Ga0099829_11347600All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium590Open in IMG/M
3300009088|Ga0099830_10818020All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium769Open in IMG/M
3300009089|Ga0099828_11013256All Organisms → cellular organisms → Bacteria740Open in IMG/M
3300009089|Ga0099828_11161560Not Available685Open in IMG/M
3300010046|Ga0126384_12443584All Organisms → cellular organisms → Bacteria → Acidobacteria506Open in IMG/M
3300010048|Ga0126373_10428292All Organisms → cellular organisms → Bacteria → Acidobacteria1353Open in IMG/M
3300010337|Ga0134062_10116955All Organisms → cellular organisms → Bacteria → Acidobacteria1159Open in IMG/M
3300010396|Ga0134126_10520388All Organisms → cellular organisms → Bacteria → Acidobacteria1369Open in IMG/M
3300010865|Ga0126346_1206772All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae542Open in IMG/M
3300010880|Ga0126350_12111336All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae735Open in IMG/M
3300011120|Ga0150983_12596649Not Available1201Open in IMG/M
3300011269|Ga0137392_11459255All Organisms → cellular organisms → Bacteria543Open in IMG/M
3300011270|Ga0137391_10590610All Organisms → cellular organisms → Bacteria932Open in IMG/M
3300011271|Ga0137393_10638585All Organisms → cellular organisms → Bacteria913Open in IMG/M
3300012199|Ga0137383_11024858All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium600Open in IMG/M
3300012206|Ga0137380_10363013All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1290Open in IMG/M
3300012206|Ga0137380_10890337All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium765Open in IMG/M
3300012207|Ga0137381_10355878All Organisms → cellular organisms → Bacteria1276Open in IMG/M
3300012349|Ga0137387_11203582All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300012351|Ga0137386_11176003All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium538Open in IMG/M
3300012357|Ga0137384_10335779All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1254Open in IMG/M
3300012361|Ga0137360_10869652All Organisms → cellular organisms → Bacteria777Open in IMG/M
3300012361|Ga0137360_10968823All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium734Open in IMG/M
3300012362|Ga0137361_10619968All Organisms → cellular organisms → Bacteria991Open in IMG/M
3300012362|Ga0137361_10710599All Organisms → cellular organisms → Bacteria918Open in IMG/M
3300012363|Ga0137390_11118054All Organisms → cellular organisms → Bacteria737Open in IMG/M
3300012917|Ga0137395_10721730All Organisms → cellular organisms → Bacteria721Open in IMG/M
3300012917|Ga0137395_11107207All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300012923|Ga0137359_10838248All Organisms → cellular organisms → Bacteria795Open in IMG/M
3300012927|Ga0137416_10832388All Organisms → cellular organisms → Bacteria818Open in IMG/M
3300012929|Ga0137404_10051157All Organisms → cellular organisms → Bacteria3167Open in IMG/M
3300012930|Ga0137407_10695237All Organisms → cellular organisms → Bacteria → Acidobacteria958Open in IMG/M
3300012964|Ga0153916_11279641All Organisms → cellular organisms → Bacteria811Open in IMG/M
3300012971|Ga0126369_12952012All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium557Open in IMG/M
3300012986|Ga0164304_11125003All Organisms → cellular organisms → Bacteria630Open in IMG/M
3300014201|Ga0181537_11243100All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium502Open in IMG/M
3300014495|Ga0182015_10425868All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium854Open in IMG/M
3300014501|Ga0182024_11241858All Organisms → cellular organisms → Bacteria868Open in IMG/M
3300015054|Ga0137420_1405919All Organisms → cellular organisms → Bacteria1065Open in IMG/M
3300015087|Ga0167637_1014169All Organisms → cellular organisms → Bacteria1167Open in IMG/M
3300017656|Ga0134112_10490775All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300017933|Ga0187801_10009223All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3202Open in IMG/M
3300017955|Ga0187817_10985946All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae540Open in IMG/M
3300017972|Ga0187781_10220650All Organisms → cellular organisms → Bacteria1339Open in IMG/M
3300017974|Ga0187777_10293002All Organisms → cellular organisms → Bacteria1111Open in IMG/M
3300017974|Ga0187777_10462396Not Available883Open in IMG/M
3300017993|Ga0187823_10193058All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → unclassified Pirellulales → Pirellulales bacterium664Open in IMG/M
3300018433|Ga0066667_10725600All Organisms → cellular organisms → Bacteria836Open in IMG/M
3300018468|Ga0066662_11281691All Organisms → cellular organisms → Bacteria749Open in IMG/M
3300020579|Ga0210407_10922193All Organisms → cellular organisms → Bacteria669Open in IMG/M
3300020579|Ga0210407_11225419All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300020581|Ga0210399_10218482All Organisms → cellular organisms → Bacteria → Proteobacteria1587Open in IMG/M
3300020581|Ga0210399_10928583All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae704Open in IMG/M
3300020582|Ga0210395_11008883All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium616Open in IMG/M
3300021088|Ga0210404_10652355All Organisms → cellular organisms → Bacteria599Open in IMG/M
3300021168|Ga0210406_10183248All Organisms → cellular organisms → Bacteria1743Open in IMG/M
3300021168|Ga0210406_10232838All Organisms → cellular organisms → Bacteria1517Open in IMG/M
3300021170|Ga0210400_10202476All Organisms → cellular organisms → Bacteria1614Open in IMG/M
3300021170|Ga0210400_11430352Not Available550Open in IMG/M
3300021171|Ga0210405_10621273All Organisms → cellular organisms → Bacteria840Open in IMG/M
3300021401|Ga0210393_10381833All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1148Open in IMG/M
3300021405|Ga0210387_10053422All Organisms → cellular organisms → Bacteria3257Open in IMG/M
3300021420|Ga0210394_10801338All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae823Open in IMG/M
3300021420|Ga0210394_11225679All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium643Open in IMG/M
3300021476|Ga0187846_10309054All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_58_21653Open in IMG/M
3300021478|Ga0210402_11142887All Organisms → cellular organisms → Bacteria706Open in IMG/M
3300021478|Ga0210402_11358556All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium638Open in IMG/M
3300021479|Ga0210410_10154742All Organisms → cellular organisms → Bacteria2044Open in IMG/M
3300021479|Ga0210410_11057714All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium701Open in IMG/M
3300021479|Ga0210410_11796136All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300021861|Ga0213853_10729690All Organisms → cellular organisms → Bacteria1310Open in IMG/M
3300022531|Ga0242660_1184705All Organisms → cellular organisms → Bacteria565Open in IMG/M
3300024323|Ga0247666_1097828All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_58_4583Open in IMG/M
3300024330|Ga0137417_1483251All Organisms → cellular organisms → Bacteria → Acidobacteria1681Open in IMG/M
3300026294|Ga0209839_10035358All Organisms → cellular organisms → Bacteria1872Open in IMG/M
3300026294|Ga0209839_10271776All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium526Open in IMG/M
3300026312|Ga0209153_1110293All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1039Open in IMG/M
3300026328|Ga0209802_1302327All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300026330|Ga0209473_1076442All Organisms → cellular organisms → Bacteria1418Open in IMG/M
3300026496|Ga0257157_1031081All Organisms → cellular organisms → Bacteria881Open in IMG/M
3300026529|Ga0209806_1185669All Organisms → cellular organisms → Bacteria745Open in IMG/M
3300026540|Ga0209376_1208498All Organisms → cellular organisms → Bacteria881Open in IMG/M
3300026551|Ga0209648_10426403All Organisms → cellular organisms → Bacteria845Open in IMG/M
3300027070|Ga0208365_1025317All Organisms → cellular organisms → Bacteria772Open in IMG/M
3300027074|Ga0208092_108134All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia641Open in IMG/M
3300027671|Ga0209588_1086417All Organisms → cellular organisms → Bacteria1012Open in IMG/M
3300027698|Ga0209446_1031997All Organisms → cellular organisms → Bacteria1321Open in IMG/M
3300027775|Ga0209177_10262053All Organisms → cellular organisms → Bacteria643Open in IMG/M
3300027846|Ga0209180_10432597All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium743Open in IMG/M
3300027857|Ga0209166_10482468All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium638Open in IMG/M
3300027862|Ga0209701_10581542All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium597Open in IMG/M
3300027895|Ga0209624_10236820All Organisms → cellular organisms → Bacteria1213Open in IMG/M
3300028016|Ga0265354_1027524All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae546Open in IMG/M
3300028037|Ga0265349_1000316All Organisms → cellular organisms → Bacteria6008Open in IMG/M
3300028047|Ga0209526_10822750All Organisms → cellular organisms → Bacteria573Open in IMG/M
3300028536|Ga0137415_10690626All Organisms → cellular organisms → Bacteria833Open in IMG/M
3300028906|Ga0308309_11915150All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae500Open in IMG/M
3300030813|Ga0265750_1053557All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae616Open in IMG/M
3300030878|Ga0265770_1011366Not Available1306Open in IMG/M
3300030879|Ga0265765_1000549All Organisms → cellular organisms → Bacteria3020Open in IMG/M
3300031708|Ga0310686_118002375All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → unclassified Pirellulales → Pirellulales bacterium641Open in IMG/M
3300031715|Ga0307476_11401610All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae508Open in IMG/M
3300031754|Ga0307475_10382745All Organisms → cellular organisms → Bacteria → Acidobacteria1130Open in IMG/M
3300031754|Ga0307475_10660018All Organisms → cellular organisms → Bacteria835Open in IMG/M
3300031754|Ga0307475_11104161All Organisms → cellular organisms → Bacteria620Open in IMG/M
3300031754|Ga0307475_11372417All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300031820|Ga0307473_10459775All Organisms → cellular organisms → Bacteria850Open in IMG/M
3300031823|Ga0307478_11572986All Organisms → cellular organisms → Bacteria543Open in IMG/M
3300031962|Ga0307479_11300622All Organisms → cellular organisms → Bacteria688Open in IMG/M
3300031996|Ga0308176_10712234All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1042Open in IMG/M
3300032205|Ga0307472_101019519All Organisms → cellular organisms → Bacteria777Open in IMG/M
3300032892|Ga0335081_12640294All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300033513|Ga0316628_103293327All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → unclassified Pirellulales → Pirellulales bacterium586Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil24.26%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil16.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil7.35%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil6.62%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil5.15%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.41%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.68%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil3.68%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil2.21%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.21%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.21%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.21%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.47%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.47%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.47%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil1.47%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.47%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil1.47%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds0.74%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.74%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.74%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.74%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.74%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.74%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.74%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.74%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.74%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.74%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.74%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.74%
BiofilmEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm0.74%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.74%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300002917Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cmEnvironmentalOpen in IMG/M
3300004080Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300004091Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300005174Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010865Boreal forest soil eukaryotic communities from Alaska, USA - C3-3 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010880Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012964Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300014201Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaGEnvironmentalOpen in IMG/M
3300014495Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300015054Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015087Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6A, Proglacial plain, adjacent to northern proglacial tributary)EnvironmentalOpen in IMG/M
3300017656Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015EnvironmentalOpen in IMG/M
3300017933Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300017993Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021476Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2)EnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021861Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022531Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300024323Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK07EnvironmentalOpen in IMG/M
3300024330Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300026294Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes)EnvironmentalOpen in IMG/M
3300026312Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes)EnvironmentalOpen in IMG/M
3300026328Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes)EnvironmentalOpen in IMG/M
3300026330Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes)EnvironmentalOpen in IMG/M
3300026496Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-AEnvironmentalOpen in IMG/M
3300026529Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes)EnvironmentalOpen in IMG/M
3300026540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes)EnvironmentalOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300027070Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF004 (SPAdes)EnvironmentalOpen in IMG/M
3300027074Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF014 (SPAdes)EnvironmentalOpen in IMG/M
3300027671Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes)EnvironmentalOpen in IMG/M
3300027698Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027857Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027862Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027895Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300028016Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1Host-AssociatedOpen in IMG/M
3300028037Soil microbial communities from Maridalen valley, Oslo, Norway - NSE1EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300030813Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030878Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030879Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300033513Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_CEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
C688J35102_12098589453300002568SoilGVEFEYGMQLLNKKYFPWKQLLDFFAKFRPRERAVIAITPVDARK*
JGI25616J43925_1023239013300002917Grasslands SoilGMQLLNKKYFPWKQMLDFFASFRRRERTVFVIRSAETEVVK*
Ga0062385_1104948613300004080Bog Forest SoilVTGPEADRGMQLLNKKYFPLKQILGFFAAFRPRQRTVFAIRPA*
Ga0062387_10136175123300004091Bog Forest SoilEILPGERAARGIQLLNRKYFPVKQILGFFASFSRRERVVFAIRPA*
Ga0066680_1059594713300005174SoilEEAAKGMRLLNRKYLPLKQLLDFFAMFRQRERTVFALRIV*
Ga0066388_10350275723300005332Tropical Forest SoilSEAEHGMKELNKKYVPWKQLLDFFASFRKRERTVFAIRPA*
Ga0070695_10156046623300005545Corn, Switchgrass And Miscanthus RhizosphereFPYGMRLLNKKYFPWKQLLDFFAKFRPHERAVIAIMPAKAWK*
Ga0066692_1033086033300005555SoilARGVQLLNKKYFPWKQLLDFFAKFRNRQHTVFVLRSA*
Ga0066707_1081902223300005556SoilQAQIVTGEEDARGVRLLNKKYFPWKQLLDFFAKFRNRKHTVFVLRPA*
Ga0066708_1067482513300005576SoilHGMQLLNKKYVPWKQLLDFFAMFRKRERTVFVIRPT*
Ga0070761_1068793113300005591SoilRAEILSGDVALHATRLLNRKYFPLKQILGFFALFSRRERVVMALRPA*
Ga0066706_1132518713300005598SoilGEEAARGMQLLNRKYFPWKQLLGFFASFSRRGRTVFVIRPA*
Ga0070766_1046236513300005921SoilMGLLNKRYFPLKQLLGFFAQFSRRPRIVIALHPA*
Ga0075017_10144757113300006059WatershedsRGMALLNKKYFPWKQLLGFFALFSNRERIVFVIRPV*
Ga0070716_10165958113300006173Corn, Switchgrass And Miscanthus RhizosphereERGMQLLNKKYWPWKQILDFFSRFGKHGRVMFAIREAK*
Ga0070765_10028596533300006176SoilGEIASQAMRLLNKKYFPLKQLLGFFAVFSRRERIVMAIRPA*
Ga0070765_10112824113300006176SoilEEATYGMRLLNLKYFPWKQLLGFVALFSRRERIVMAIRPE*
Ga0070765_10199590613300006176SoilARAVTGEEAARGMRLLNSKYFPLKQILGFFAFFSRRERVVFAIRPA*
Ga0070765_10205006213300006176SoilDANAEIVTGEIASQAMKLLNKKYFPLKQILGFFALFSRRERIVMAIRPA*
Ga0079221_1026843513300006804Agricultural SoilHGMQLLNRKYLPWKQLLDFFAMFRKRERTVFVIRPA*
Ga0099791_1019640613300007255Vadose Zone SoilPEAEHGMRLLNKKYVPWKQLLDFFAMFRQRERTVFVIRPA*
Ga0099794_1031043713300007265Vadose Zone SoilGAEAEHGMKLLNKKYMPWKQLLDFFSFFSRNKRVVFLIRPA*
Ga0066710_10170195523300009012Grasslands SoilEAEHGMKLLNKKYAPWKHLLDFFAKFRKRERTVFVIRPV
Ga0099829_1134760013300009038Vadose Zone SoilIVTGDAAQHGMGLLNKKYIPWKQLLDFFSSFSRHTRVVFAIRPA*
Ga0099830_1081802013300009088Vadose Zone SoilVTGAEAEHGMGLLNQKYVPWKQLLDFFARFRERERTVFAIRPV*
Ga0099828_1101325613300009089Vadose Zone SoilEAARGMQLLNKKYFPWKQLLGFFASFSRRERTVFVIRPG*
Ga0099828_1116156013300009089Vadose Zone SoilMRLLNEKYLPWKQLLDFFAKFRKRERTVFVIRPAENEATK*
Ga0126384_1244358413300010046Tropical Forest SoilGTEFSYGMQLLNKKYFPWKQVLDFFASFVRREHAMIAISPV*
Ga0126373_1042829213300010048Tropical Forest SoilARVEILAGMEAQHGMQLLNQKYAPWKQLLDFFAMFRKRERTVFLIRPN*
Ga0134062_1011695513300010337Grasslands SoilAARGMQLLNRKYFPWKQLLGFFASFSRRGRTVFVIRPA*
Ga0134126_1052038813300010396Terrestrial SoilMRLLNKKYFPWKQLLDFFAKFLPHERAVIAIMPAKAWK*
Ga0126346_120677213300010865Boreal Forest SoilDANAEIVTGESASQAMKLLNKKYFPLKQLLGFFALFSRRERIVMAIRPA*
Ga0126350_1211133613300010880Boreal Forest SoilESASQAMKLLNKKYFPLKQLLGFFALFSRRERIVMAIRPA*
Ga0150983_1259664923300011120Forest SoilGMGLLNKKYFPWKQILSLFALFSRRERVVMAIHPA*
Ga0137392_1145925513300011269Vadose Zone SoilEHGMKLLNKKYMPWKQLLDFFSFFSRNKRVVFLIRPA*
Ga0137391_1059061023300011270Vadose Zone SoilEIISGEDAARGIQLLNKKYFPWKQLLAVFASLSRRERIVFAIRPA*
Ga0137393_1063858513300011271Vadose Zone SoilAEHGMTLLNKKYFPWKQLLGFFSLFSRNKPVVFLIRPA*
Ga0137383_1102485813300012199Vadose Zone SoilHGMRLLNQKYVPWKQLLDFFARFRERERTVFAIRPA*
Ga0137380_1036301313300012206Vadose Zone SoilIVTGAEAEHGMRLLNQKYVPWKQLLDFFARFRERERTVFAIRPA*
Ga0137380_1089033713300012206Vadose Zone SoilGMGLLNQKYVPWKQLLDFFARFRKRERTVFAIRPA*
Ga0137381_1035587843300012207Vadose Zone SoilARGMQLLNRKYFPWKQLLGFFASFSRRERTVFEIRPA*
Ga0137387_1120358213300012349Vadose Zone SoilMQLLNRKYLPWKQLLDFFAMFRKRERTVFVIHPA*
Ga0137386_1117600323300012351Vadose Zone SoilAEAQHGMQLLNRKYFPVKQLLDFLAMFRRRERTVFLIRPA*
Ga0137384_1033577933300012357Vadose Zone SoilVTGAEAEHGMGLLNQKYVPWKQLLDFFARFRKRERTVFAIRPA*
Ga0137360_1086965223300012361Vadose Zone SoilEIISGEEAVRGMQLLNKKYFPWKQLLAVFAFFSSRERIVFAIRPA*
Ga0137360_1096882323300012361Vadose Zone SoilCGTQLLKKKYFPWKQLLDFFAKFRNRDHTVFVLRPA*
Ga0137361_1061996813300012362Vadose Zone SoilTGEEAARGMQLLNKKYFPWKQLLGFFASFSRRGRTVFVIHPA*
Ga0137361_1071059933300012362Vadose Zone SoilAEAEHGMKLLNKKYMPWKQFLDFFSFFSRNKRVVFLIRPA*
Ga0137390_1111805423300012363Vadose Zone SoilVTGAEAEHGMKLLNKKYMPWKQLLDFFSFFSRNKRVVFLIRPA*
Ga0137395_1072173033300012917Vadose Zone SoilEAAARGMQLLNKKYFPWKQLLGFFASFSRRGRTVFAIRPADVTK*
Ga0137395_1110720723300012917Vadose Zone SoilARGMQLLNRKYFPWKQLLGFFASFSRRGRTVFVIRPA*
Ga0137359_1083824823300012923Vadose Zone SoilEEAEHGMKLLNKKYSPWRQILGFFSLFSRQKRVVFVIRPA*
Ga0137416_1083238823300012927Vadose Zone SoilEARVAILTGEEAARGMRLLNKKYFPWKQMLDFFAMFRRRERTVFAIRPA*
Ga0137404_1005115733300012929Vadose Zone SoilHGMKLLNKKYVPWKQLLDFFASFRRRERIVFAIRPA*
Ga0137407_1069523723300012930Vadose Zone SoilRGMQLLNKKYWPWKQLLDFFASFRRRERIVFAIRPA*
Ga0153916_1127964113300012964Freshwater WetlandsMRLLDRKYVPWKQLLDFFAMFRRRQRIVMAIRPE*
Ga0126369_1295201213300012971Tropical Forest SoilPARAEILSGKEANHGMQLLNRKYLPWKQVLDFFAMFRKRERTVFVIRPV*
Ga0164304_1112500323300012986SoilTGAEAENGMRFLNKKYLPWKQLLDFFASFRRRERIVFVIRPV*
Ga0181537_1124310023300014201BogDATAEIVAKQEAARGMRLLNKKYFPLKQILGFFALFSRQPRLVIALRPG*
Ga0182015_1042586813300014495PalsaRRGKILGEWIDATAQIVTKEEAVRGMRLLNQKYFPLKQILGFFALFSRQPRLVIALRPG*
Ga0182024_1124185813300014501PermafrostGEEAARGMRLLNKKYFPLKQILGFFALFSRGERIVIALRPA*
Ga0137420_140591913300015054Vadose Zone SoilIVTGEEAARGMQLLNRKYFPWKQLLGFFASFSRRERTVFVIRPA*
Ga0167637_101416913300015087Glacier Forefield SoilGTQLLNRKYFPWKQVLGFFAMFSRRERVVMALRPV*
Ga0134112_1049077523300017656Grasslands SoilVTGEEDARGVRLLNNKYFPWKQLLDFFAKFRNRQHTVFVLRPA
Ga0187801_1000922333300017933Freshwater SedimentLSGTKAAHGMEMLNKKYVPWKQLLDFFAMFRKRERTVFAIRPA
Ga0187817_1098594623300017955Freshwater SedimentITGELASQAMRLLNKKYFPLKQILGFFALFSRRERVVMAIRPA
Ga0187781_1022065013300017972Tropical PeatlandAEADHGMQLLNKKYAPWKQLLDFFARFRPRERIVFAIRPA
Ga0187777_1029300213300017974Tropical PeatlandEEAARGMGLITKKYAPWTYLLNFFAKFRRRERVVMAITPA
Ga0187777_1046239623300017974Tropical PeatlandGMELLNRKYFPWKQLLGVAAFFSRRERVVMALRPV
Ga0187823_1019305813300017993Freshwater SedimentAEIITGETASQAMRLLNKKYFPLKQILGFFALFSRRERVVMAIRPA
Ga0066667_1072560023300018433Grasslands SoilVTGEEAARGMQLLNRKYFPWKQLLGFFASFSRRGRTVFVIRPA
Ga0066662_1128169113300018468Grasslands SoilQAQIVTGEEDARGVQLLNKKYFPWKQLLDFFAKFRNRQHTAFVLRPA
Ga0210407_1092219313300020579SoilRAEIITGAEAEHGMKLLNKKYIPWKQLLDFFSFFSHNKRVVFLIRPA
Ga0210407_1122541923300020579SoilDAEHGMQLLNKKYMPWKQLLDFFSIFSRNKRVVFLIRPA
Ga0210399_1021848233300020581SoilLGEWAEASVEIVTGDESARAMGLLNKKYFPWKQILGFFALFSRRERIVMAIRPA
Ga0210399_1092858323300020581SoilAMGLLNKKYFPWKQILGFFALFSRRERIVMAIRPA
Ga0210395_1100888313300020582SoilIVSGEEAARGTQLLNKKYFPWKQLLGFFASFSRRERIVFALHPA
Ga0210404_1065235513300021088SoilDAEHGMQLLNKKYMPWKQLLDFFSIFSRNKRIVFLIRPG
Ga0210406_1018324813300021168SoilSDAKAEIITGDIASQAMKLLNKKYFPLKQILSFFAFFSRRERVVMAIRPA
Ga0210406_1023283833300021168SoilEIVTGAEAEHGMKLLNKKYIPWKQLLDFFSFFSRNKRVMFLIRPA
Ga0210400_1020247613300021170SoilRAEILTGDEAARGMQLLNKKYFPLKQILGFFAAFSRRERTVFALLPA
Ga0210400_1143035213300021170SoilADAKGEIVTGEVASQAMRLLNKKYFPLKQILGFFALFSRRERVVMAIRPA
Ga0210405_1062127313300021171SoilEWAEASAEILTGDESARAMGLLNKKYFPWKQILGFFALFSRRERIVMAIRPV
Ga0210393_1038183313300021401SoilEANAEIVTGETASQAMKLLNKKYFPLKQLLGFFALFSRRERIVMAIRPA
Ga0210387_1005342213300021405SoilGMGLLNKKYFPWKQVLGFFALFSRRPRIVIALHPA
Ga0210394_1080133823300021420SoilETASQAMRLLNKKYFPLKQILSFFAFFSRRERVVMAIRPA
Ga0210394_1122567913300021420SoilIVTGADASYGTQLLNQKYFPWKQILAFFASFSRRGRTVFVLRPASGN
Ga0187846_1030905423300021476BiofilmAHGMALLNKKYVPWKQLLDFFARFRSRERTVFLIQPS
Ga0210402_1114288713300021478SoilTEIVMGDEAGYGMKLLNKKYFPWKQLLAFFAWFSRRGRTVMAIRPT
Ga0210402_1135855623300021478SoilGMRLLNGKYVPWKQLLDFFSKFKRRGRVVFAIHPV
Ga0210410_1015474233300021479SoilRGMRLLNKKYFPLKQILGFFALFSRRARVVIAIRPA
Ga0210410_1105771423300021479SoilGMRLLNGKYVPWKQLLDFFSKFKRRGRVVFAIRPV
Ga0210410_1179613623300021479SoilGNVLGEWVDAHAEMVTGTEAAHGMKLLNKKYFPLKQILGFFASFSHRERIVFAIRPA
Ga0213853_1072969023300021861WatershedsEEAEHGTKLLNKKYFPWKQILAFFASFSRRGRTVMAIRPT
Ga0242660_118470513300022531SoilEEAARGMRLLNKKYFPWRQMLDFFAMFRRRERTVFAIRPA
Ga0247666_109782813300024323SoilATTVSGEEAARGMKLLNKKYFPWRQILGFFSMFSRSKRVVFVIRPA
Ga0137417_148325133300024330Vadose Zone SoilTSEEAARGMRLLNKKYFPWKQMLNFFAMFRRRERTVFAIRPV
Ga0209839_1003535813300026294SoilQGVRLLNKKYFPWKQILAFFALFSRQPRIVIALTPA
Ga0209839_1027177623300026294SoilKAEVVSGEEATQGLRLLDKKYFPWKQIMNFFAMFRRQGRDVLSIRLP
Ga0209153_111029313300026312SoilQHGMQLLNKKYVPWKQLLDFFAMFRKHERVVFLIRPA
Ga0209802_130232713300026328SoilGMKLLNKKYAPWKQLLDFFAKFRKRERTVFVIQPV
Ga0209473_107644223300026330SoilSGTEAAHGMQLLNKKYLPWKQLLDFFAMFRKRERTVFVIRPA
Ga0257157_103108133300026496SoilLTGEEAARGMRLLNKKYFPWKQMLDFFAMFRRRERTVFAIRPA
Ga0209806_118566923300026529SoilGEEDARGVQLLNKKYFPWKQLLDFFAKFRNRQHTVFVLRSA
Ga0209376_120849823300026540SoilEAHHGMQLLNKKYFPWKQLLDFFAMFRKRGRTVFMIRPAL
Ga0209648_1042640313300026551Grasslands SoilEAEHGMQLLNKKYVPWKQLLDFFARFRKRERTVFAIRPA
Ga0208365_102531713300027070Forest SoilQAEIVTGEEAARGMRLLNKRYFPLKQLLGFFALFSRRPRIVIALHPA
Ga0208092_10813413300027074Forest SoilDADRGMQLLNRKYVPWKQLLDFFARFRPRARTVFFIHPA
Ga0209588_108641713300027671Vadose Zone SoilEIVTGAEAEKGMQLLNKKYVPWKQMLDFFASFRRRERIVFAIRPA
Ga0209446_103199713300027698Bog Forest SoilEFVEARAEILSGDVAAHGMQLLNRKYFPWKQILGFFALFSRRERLVMALRPASLS
Ga0209177_1026205333300027775Agricultural SoilILSGTEAEHGMQLLNKKYLPWKQLLDFFAMFRKRERTVFVIRPA
Ga0209180_1043259713300027846Vadose Zone SoilGMGLLNKKYIPWKQLLDFFSSFSRHTRVVFAIRPA
Ga0209166_1048246813300027857Surface SoilEAQLGLRLLNRKYFPWKQLLNFFALFSRQARIVFAIRPA
Ga0209701_1058154223300027862Vadose Zone SoilSGQEADHGMKLLNKKYFPWKQLLGFFASFSRRERIVFVLRPA
Ga0209624_1023682013300027895Forest SoilTKEEAVRGMRLLNKRYFPLKQILGFFALFSRQPRLVIALRPG
Ga0265354_102752413300028016RhizosphereAEIVTGEVASQGLKLLNKKYFPLKQILGFFALFSRRERVVMSIRPAQ
Ga0265349_100031663300028037SoilEFVDAKAEIVTGEVASQGLKLLNKKYFPLKQILGFFALFSRRERIVMSIRPA
Ga0209526_1082275013300028047Forest SoilGMRLLNKKYFPWKQLLGFFALFSRRERIVIALHRA
Ga0137415_1069062643300028536Vadose Zone SoilGMKLLNKKYLPWKQLLDFFSFFSRNKRVVFLIRPA
Ga0308309_1191515013300028906SoilRAMKLLNKKYFPLKQILGFFALFSRRERIVMAIRPA
Ga0265750_105355723300030813SoilEIVTGEVASQGLKLLNKKYFPLKQILGFFALFSRRERVVMSIRPAQ
Ga0265770_101136623300030878SoilLGEFVDAKAEIVTGEVASQGLKLLNKKYFPLKQILGFFALFSRRERIVMSIRPA
Ga0265765_100054913300030879SoilDAKAEIVTGEVASQGLKLLNKKYFPLKQILGFFALFSRRERIVMSIRPA
Ga0310686_11800237523300031708SoilVDAKAEIVTGEVASQGLKLLNKKYFPLKQILGFFALFSRRERIVMSIRPA
Ga0307476_1140161013300031715Hardwood Forest SoilQAMKLLNKKYFPLKQILSFFALFSRRERIVMAIRPA
Ga0307475_1038274513300031754Hardwood Forest SoilWAPARAEILTGSEAKHGMQLLNKKYFPWKELLDFFAMFGKRQGTVFMLRPGQGM
Ga0307475_1066001813300031754Hardwood Forest SoilEAEHGMTLLNKKYFPWKQLLAFFSLFSRAKRVVFLIRPA
Ga0307475_1110416113300031754Hardwood Forest SoilRAEIVTGEEDACGTQLLKKKYFPWKQLLDFFAKFRNRDHTVFVLRPA
Ga0307475_1137241713300031754Hardwood Forest SoilGAEAEHGMKLLNKKYMPWKQLLDFFSFFSRNKRVVFLIRPE
Ga0307473_1045977513300031820Hardwood Forest SoilRAEIVTGGEAEHGMKLLNKKYVPWKQMLDFFASFRRRERIVFAMRPA
Ga0307478_1157298623300031823Hardwood Forest SoilVTGAEAEHGMTLLNKKYFPWKQLLAFFSLFSRAKRVVFLIRPA
Ga0307479_1130062223300031962Hardwood Forest SoilHGMTLLNKKYMPWKQLLDFFSIFSRNKRIVFLIRPG
Ga0308176_1071223433300031996SoilRIVTGEEAARGMRLLDRKYFPWKQMLRAFALFGRRRERVAIAIRPG
Ga0307472_10101951913300032205Hardwood Forest SoilSDTEAAHGMQLLNKKYLPWKQLLDFFAMFRKRERTVFVIRPS
Ga0335081_1264029423300032892SoilAARGMRLLNAKYAPWKQLLDFFSRFKPRGRVVFVIHPA
Ga0316628_10329332723300033513SoilVGALGMGLLNKKYFPWKHFLGLFALLSRRERVVMRIRPA

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.