NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F057526

Metagenome / Metatranscriptome Family F057526

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F057526
Family Type Metagenome / Metatranscriptome
Number of Sequences 136
Average Sequence Length 44 residues
Representative Sequence GTKVVFRADRYTGVRVNSGGPEIKVENLNGDIRILENHE
Number of Associated Samples 122
Number of Associated Scaffolds 136

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 87.50 %
Associated GOLD sequencing projects 115
AlphaFold2 3D model prediction Yes
3D model pTM-score0.31

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (95.588 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(18.382 % of family members)
Environment Ontology (ENVO) Unclassified
(33.824 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(61.765 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 25.37%    Coil/Unstructured: 74.63%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.31
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 136 Family Scaffolds
PF13345Obsolete Pfam Family 6.62
PF13349DUF4097 5.15
PF08241Methyltransf_11 2.21
PF08541ACP_syn_III_C 2.21
PF04993TfoX_N 1.47
PF11453DUF2950 1.47
PF04255DUF433 0.74
PF04030ALO 0.74
PF01139RtcB 0.74
PF13620CarboxypepD_reg 0.74
PF00557Peptidase_M24 0.74
PF08545ACP_syn_III 0.74
PF08281Sigma70_r4_2 0.74
PF07228SpoIIE 0.74
PF01850PIN 0.74
PF03781FGE-sulfatase 0.74
PF01791DeoC 0.74

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 136 Family Scaffolds
COG3070Transcriptional regulator of competence genes, TfoX/Sxy familyTranscription [K] 1.47
COG0277FAD/FMN-containing lactate dehydrogenase/glycolate oxidaseEnergy production and conversion [C] 0.74
COG1262Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domainPosttranslational modification, protein turnover, chaperones [O] 0.74
COG1690RNA-splicing ligase RtcB, repairs tRNA damageTranslation, ribosomal structure and biogenesis [J] 0.74
COG2442Predicted antitoxin component of a toxin-antitoxin system, DUF433 familyDefense mechanisms [V] 0.74

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms95.59 %
UnclassifiedrootN/A4.41 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000156|NODE_c0544001All Organisms → cellular organisms → Bacteria → Acidobacteria1220Open in IMG/M
3300001471|JGI12712J15308_10135041All Organisms → cellular organisms → Bacteria → Acidobacteria634Open in IMG/M
3300002557|JGI25381J37097_1063418All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium593Open in IMG/M
3300003350|JGI26347J50199_1041443All Organisms → cellular organisms → Bacteria538Open in IMG/M
3300005166|Ga0066674_10220223All Organisms → cellular organisms → Bacteria → Acidobacteria903Open in IMG/M
3300005179|Ga0066684_10047700All Organisms → cellular organisms → Bacteria2438Open in IMG/M
3300005439|Ga0070711_100395377All Organisms → cellular organisms → Bacteria1121Open in IMG/M
3300005446|Ga0066686_10470998All Organisms → cellular organisms → Bacteria → Acidobacteria857Open in IMG/M
3300005458|Ga0070681_10534952All Organisms → cellular organisms → Bacteria → Acidobacteria1085Open in IMG/M
3300005586|Ga0066691_10012985All Organisms → cellular organisms → Bacteria3945Open in IMG/M
3300005591|Ga0070761_10507065All Organisms → cellular organisms → Bacteria → Acidobacteria745Open in IMG/M
3300005602|Ga0070762_11324781All Organisms → cellular organisms → Bacteria → Acidobacteria500Open in IMG/M
3300005610|Ga0070763_10261891All Organisms → cellular organisms → Bacteria940Open in IMG/M
3300005712|Ga0070764_10636933All Organisms → cellular organisms → Bacteria → Acidobacteria653Open in IMG/M
3300005764|Ga0066903_104004969All Organisms → cellular organisms → Bacteria → Acidobacteria790Open in IMG/M
3300006028|Ga0070717_10114848All Organisms → cellular organisms → Bacteria2301Open in IMG/M
3300006046|Ga0066652_100532956All Organisms → cellular organisms → Bacteria → Acidobacteria1096Open in IMG/M
3300006176|Ga0070765_101011494All Organisms → cellular organisms → Bacteria → Acidobacteria786Open in IMG/M
3300006755|Ga0079222_11866341All Organisms → cellular organisms → Bacteria585Open in IMG/M
3300006796|Ga0066665_11277980All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae562Open in IMG/M
3300006800|Ga0066660_11545925All Organisms → cellular organisms → Bacteria524Open in IMG/M
3300006804|Ga0079221_11204658All Organisms → cellular organisms → Bacteria588Open in IMG/M
3300006806|Ga0079220_10391791All Organisms → cellular organisms → Bacteria903Open in IMG/M
3300006806|Ga0079220_10479930All Organisms → cellular organisms → Bacteria → Acidobacteria842Open in IMG/M
3300006854|Ga0075425_100810320All Organisms → cellular organisms → Bacteria → Acidobacteria1073Open in IMG/M
3300007076|Ga0075435_102021362All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300007255|Ga0099791_10514904All Organisms → cellular organisms → Bacteria → Acidobacteria582Open in IMG/M
3300009090|Ga0099827_11574413All Organisms → cellular organisms → Bacteria → Acidobacteria572Open in IMG/M
3300010047|Ga0126382_10111950All Organisms → cellular organisms → Bacteria1789Open in IMG/M
3300010048|Ga0126373_10749809Not Available1037Open in IMG/M
3300010303|Ga0134082_10367514All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium611Open in IMG/M
3300010320|Ga0134109_10050214All Organisms → cellular organisms → Bacteria1379Open in IMG/M
3300010321|Ga0134067_10442592All Organisms → cellular organisms → Bacteria → Acidobacteria528Open in IMG/M
3300010336|Ga0134071_10096128All Organisms → cellular organisms → Bacteria → Acidobacteria1402Open in IMG/M
3300010360|Ga0126372_13332822Not Available500Open in IMG/M
3300010361|Ga0126378_10920004All Organisms → cellular organisms → Bacteria → Acidobacteria981Open in IMG/M
3300010361|Ga0126378_11300425All Organisms → cellular organisms → Bacteria → Acidobacteria822Open in IMG/M
3300010362|Ga0126377_11976096All Organisms → cellular organisms → Bacteria → Acidobacteria659Open in IMG/M
3300010376|Ga0126381_100460408All Organisms → cellular organisms → Bacteria1786Open in IMG/M
3300010376|Ga0126381_101791156Not Available886Open in IMG/M
3300010379|Ga0136449_102416754All Organisms → cellular organisms → Bacteria → Acidobacteria757Open in IMG/M
3300010397|Ga0134124_10058700All Organisms → cellular organisms → Bacteria3252Open in IMG/M
3300010398|Ga0126383_10722633Not Available1075Open in IMG/M
3300011120|Ga0150983_16085127All Organisms → cellular organisms → Bacteria → Acidobacteria1115Open in IMG/M
3300011269|Ga0137392_10344771All Organisms → cellular organisms → Bacteria1234Open in IMG/M
3300011270|Ga0137391_10406326All Organisms → cellular organisms → Bacteria → Acidobacteria1163Open in IMG/M
3300012202|Ga0137363_10030744All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3707Open in IMG/M
3300012203|Ga0137399_10074191All Organisms → cellular organisms → Bacteria → Acidobacteria2560Open in IMG/M
3300012205|Ga0137362_10966480All Organisms → cellular organisms → Bacteria → Acidobacteria726Open in IMG/M
3300012207|Ga0137381_10088881All Organisms → cellular organisms → Bacteria2604Open in IMG/M
3300012285|Ga0137370_10364160Not Available871Open in IMG/M
3300012362|Ga0137361_11760813All Organisms → cellular organisms → Bacteria → Acidobacteria538Open in IMG/M
3300012469|Ga0150984_111157557All Organisms → cellular organisms → Bacteria → Acidobacteria1438Open in IMG/M
3300012685|Ga0137397_10232984All Organisms → cellular organisms → Bacteria → Acidobacteria1371Open in IMG/M
3300012918|Ga0137396_10158874All Organisms → cellular organisms → Bacteria1650Open in IMG/M
3300012925|Ga0137419_10093550All Organisms → cellular organisms → Bacteria2064Open in IMG/M
3300014157|Ga0134078_10358929All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium643Open in IMG/M
3300014166|Ga0134079_10314599All Organisms → cellular organisms → Bacteria → Acidobacteria700Open in IMG/M
3300014201|Ga0181537_10946039All Organisms → cellular organisms → Bacteria → Acidobacteria583Open in IMG/M
3300015052|Ga0137411_1261127All Organisms → cellular organisms → Bacteria → Acidobacteria506Open in IMG/M
3300015357|Ga0134072_10169680All Organisms → cellular organisms → Bacteria → Acidobacteria733Open in IMG/M
3300016294|Ga0182041_10709101All Organisms → cellular organisms → Bacteria → Acidobacteria893Open in IMG/M
3300016341|Ga0182035_11450408All Organisms → cellular organisms → Bacteria → Acidobacteria617Open in IMG/M
3300016404|Ga0182037_10897285All Organisms → cellular organisms → Bacteria → Acidobacteria768Open in IMG/M
3300016445|Ga0182038_10411027All Organisms → cellular organisms → Bacteria → Acidobacteria1137Open in IMG/M
3300018085|Ga0187772_11002562All Organisms → cellular organisms → Bacteria → Acidobacteria610Open in IMG/M
3300020199|Ga0179592_10441401All Organisms → cellular organisms → Bacteria → Acidobacteria563Open in IMG/M
3300020579|Ga0210407_10266993All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus1334Open in IMG/M
3300020583|Ga0210401_11447297All Organisms → cellular organisms → Bacteria → Acidobacteria544Open in IMG/M
3300021168|Ga0210406_10112283All Organisms → cellular organisms → Bacteria2309Open in IMG/M
3300021168|Ga0210406_10366328All Organisms → cellular organisms → Bacteria → Acidobacteria1160Open in IMG/M
3300021170|Ga0210400_10873214All Organisms → cellular organisms → Bacteria → Acidobacteria735Open in IMG/M
3300021178|Ga0210408_10678567All Organisms → cellular organisms → Bacteria → Acidobacteria812Open in IMG/M
3300021180|Ga0210396_11589653All Organisms → cellular organisms → Bacteria → Acidobacteria534Open in IMG/M
3300021402|Ga0210385_10963616All Organisms → cellular organisms → Bacteria → Acidobacteria655Open in IMG/M
3300021402|Ga0210385_11424369All Organisms → cellular organisms → Bacteria → Acidobacteria530Open in IMG/M
3300021404|Ga0210389_10065511All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2785Open in IMG/M
3300021405|Ga0210387_10103852All Organisms → cellular organisms → Bacteria2380Open in IMG/M
3300021406|Ga0210386_11711979All Organisms → cellular organisms → Bacteria → Acidobacteria519Open in IMG/M
3300021420|Ga0210394_11716562All Organisms → cellular organisms → Bacteria → Acidobacteria525Open in IMG/M
3300021474|Ga0210390_11444818All Organisms → cellular organisms → Bacteria → Acidobacteria546Open in IMG/M
3300021478|Ga0210402_11258029All Organisms → cellular organisms → Bacteria → Acidobacteria667Open in IMG/M
3300021479|Ga0210410_11655580All Organisms → cellular organisms → Bacteria → Acidobacteria533Open in IMG/M
3300021560|Ga0126371_12801713All Organisms → cellular organisms → Bacteria → Acidobacteria591Open in IMG/M
3300022721|Ga0242666_1021887All Organisms → cellular organisms → Bacteria → Acidobacteria1206Open in IMG/M
3300024283|Ga0247670_1098637All Organisms → cellular organisms → Bacteria → Acidobacteria539Open in IMG/M
3300025912|Ga0207707_10462374All Organisms → cellular organisms → Bacteria → Acidobacteria1085Open in IMG/M
3300026221|Ga0209848_1021766All Organisms → cellular organisms → Bacteria → Acidobacteria1247Open in IMG/M
3300026296|Ga0209235_1254946All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium541Open in IMG/M
3300026312|Ga0209153_1294508All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium519Open in IMG/M
3300026315|Ga0209686_1135966All Organisms → cellular organisms → Bacteria → Acidobacteria783Open in IMG/M
3300026323|Ga0209472_1006698All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae6066Open in IMG/M
3300026333|Ga0209158_1196031All Organisms → cellular organisms → Bacteria → Acidobacteria709Open in IMG/M
3300026334|Ga0209377_1220763All Organisms → cellular organisms → Bacteria → Acidobacteria625Open in IMG/M
3300026335|Ga0209804_1111754All Organisms → cellular organisms → Bacteria → Acidobacteria1247Open in IMG/M
3300026508|Ga0257161_1102997All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium595Open in IMG/M
3300026530|Ga0209807_1105457All Organisms → cellular organisms → Bacteria → Acidobacteria1205Open in IMG/M
3300026557|Ga0179587_10235795All Organisms → cellular organisms → Bacteria → Acidobacteria1168Open in IMG/M
3300027671|Ga0209588_1127672All Organisms → cellular organisms → Bacteria → Acidobacteria812Open in IMG/M
3300027867|Ga0209167_10835843All Organisms → cellular organisms → Bacteria → Acidobacteria501Open in IMG/M
3300027879|Ga0209169_10456561All Organisms → cellular organisms → Bacteria → Acidobacteria671Open in IMG/M
3300027884|Ga0209275_10023366All Organisms → cellular organisms → Bacteria2788Open in IMG/M
3300027884|Ga0209275_10103739All Organisms → cellular organisms → Bacteria → Acidobacteria1459Open in IMG/M
3300028577|Ga0265318_10233393All Organisms → cellular organisms → Bacteria → Acidobacteria672Open in IMG/M
3300029636|Ga0222749_10405485All Organisms → cellular organisms → Bacteria → Acidobacteria723Open in IMG/M
3300031128|Ga0170823_16002151Not Available673Open in IMG/M
3300031247|Ga0265340_10402902All Organisms → cellular organisms → Bacteria → Acidobacteria603Open in IMG/M
3300031573|Ga0310915_10662524All Organisms → cellular organisms → Bacteria → Acidobacteria738Open in IMG/M
3300031708|Ga0310686_117577451All Organisms → cellular organisms → Bacteria → Acidobacteria832Open in IMG/M
3300031715|Ga0307476_11178826All Organisms → cellular organisms → Bacteria → Acidobacteria561Open in IMG/M
3300031718|Ga0307474_10579735All Organisms → cellular organisms → Bacteria → Acidobacteria883Open in IMG/M
3300031718|Ga0307474_11499251All Organisms → cellular organisms → Bacteria → Acidobacteria531Open in IMG/M
3300031720|Ga0307469_10549735All Organisms → cellular organisms → Bacteria → Acidobacteria1022Open in IMG/M
3300031720|Ga0307469_11089812All Organisms → cellular organisms → Bacteria → Acidobacteria750Open in IMG/M
3300031753|Ga0307477_10511455All Organisms → cellular organisms → Bacteria → Acidobacteria815Open in IMG/M
3300031754|Ga0307475_10631699All Organisms → cellular organisms → Bacteria → Acidobacteria856Open in IMG/M
3300031754|Ga0307475_10726254All Organisms → cellular organisms → Bacteria → Acidobacteria791Open in IMG/M
3300031780|Ga0318508_1195529All Organisms → cellular organisms → Bacteria → Acidobacteria579Open in IMG/M
3300031820|Ga0307473_10070795All Organisms → cellular organisms → Bacteria1748Open in IMG/M
3300031823|Ga0307478_10024733All Organisms → cellular organisms → Bacteria4274Open in IMG/M
3300031823|Ga0307478_10083851All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2438Open in IMG/M
3300031823|Ga0307478_11096576All Organisms → cellular organisms → Bacteria → Acidobacteria664Open in IMG/M
3300031890|Ga0306925_10903753All Organisms → cellular organisms → Bacteria → Acidobacteria908Open in IMG/M
3300031946|Ga0310910_10677553All Organisms → cellular organisms → Bacteria → Acidobacteria816Open in IMG/M
3300031954|Ga0306926_10052611All Organisms → cellular organisms → Bacteria4877Open in IMG/M
3300031954|Ga0306926_13033082All Organisms → cellular organisms → Bacteria → Acidobacteria500Open in IMG/M
3300031962|Ga0307479_11108771All Organisms → cellular organisms → Bacteria → Acidobacteria757Open in IMG/M
3300031962|Ga0307479_11467568All Organisms → cellular organisms → Bacteria → Acidobacteria640Open in IMG/M
3300031962|Ga0307479_11787667All Organisms → cellular organisms → Bacteria → Acidobacteria567Open in IMG/M
3300032059|Ga0318533_10321319All Organisms → cellular organisms → Bacteria → Acidobacteria1125Open in IMG/M
3300032068|Ga0318553_10152456All Organisms → cellular organisms → Bacteria1197Open in IMG/M
3300032076|Ga0306924_11602885All Organisms → cellular organisms → Bacteria → Acidobacteria686Open in IMG/M
3300032261|Ga0306920_103819729All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium550Open in IMG/M
3300032954|Ga0335083_10969303All Organisms → cellular organisms → Bacteria → Acidobacteria671Open in IMG/M
3300033158|Ga0335077_10046599All Organisms → cellular organisms → Bacteria5298Open in IMG/M
3300033480|Ga0316620_10325369All Organisms → cellular organisms → Bacteria1358Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil18.38%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil12.50%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil11.03%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil9.56%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil7.35%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil6.62%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil5.88%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil5.15%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.94%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.21%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.47%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.47%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.47%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.47%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.47%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere1.47%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.74%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.74%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.74%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.74%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.74%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.74%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.74%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.74%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil0.74%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.74%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.74%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.74%
Sugar Cane Bagasse Incubating BioreactorEngineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor0.74%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000156Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobicEngineeredOpen in IMG/M
3300001471Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2EnvironmentalOpen in IMG/M
3300002557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cmEnvironmentalOpen in IMG/M
3300003350Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3EnvironmentalOpen in IMG/M
3300005166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123EnvironmentalOpen in IMG/M
3300005179Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133EnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005446Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135EnvironmentalOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005586Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010303Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015EnvironmentalOpen in IMG/M
3300010320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015EnvironmentalOpen in IMG/M
3300010321Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015EnvironmentalOpen in IMG/M
3300010336Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014157Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300014201Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaGEnvironmentalOpen in IMG/M
3300015052Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015357Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300020199Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022721Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300024283Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK11EnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026221Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-062 (SPAdes)EnvironmentalOpen in IMG/M
3300026296Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026312Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes)EnvironmentalOpen in IMG/M
3300026315Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes)EnvironmentalOpen in IMG/M
3300026323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes)EnvironmentalOpen in IMG/M
3300026333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes)EnvironmentalOpen in IMG/M
3300026334Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes)EnvironmentalOpen in IMG/M
3300026335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes)EnvironmentalOpen in IMG/M
3300026508Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-AEnvironmentalOpen in IMG/M
3300026530Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes)EnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300027671Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes)EnvironmentalOpen in IMG/M
3300027867Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027879Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300028577Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaGHost-AssociatedOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031128Oak Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031247Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaGHost-AssociatedOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031780Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033480Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_BEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
NODE_054400113300000156Sugar Cane Bagasse Incubating BioreactorPVSAEHRGNKFVFRTDRFTGGRVGNGGPEIKAENLNGDIRVLERHE*
JGI12712J15308_1013504113300001471Forest SoilAPTREEHGGKVVFRADRFTAARISNGGPEIKIENLNGDIRILENHE*
JGI25381J37097_106341823300002557Grasslands SoilEEHHGAKVVFHADRYTGVRVNSGGPEIKVENLNGEIRILENHE*
JGI26347J50199_104144323300003350Bog Forest SoilHAIEAEHKGGKVVYRADRYTSARVNAGGPEIQIENLNGDIRILENHE*
Ga0066674_1022022323300005166SoilHHGAKVVFHADRYTSVRVNSGGPEIKVENLNGEIRILENHE*
Ga0066684_1004770043300005179SoilQEEHHGAKVVFHADRYTGVRINSGGPEIKVENLNGDIRILENHE*
Ga0070711_10039537713300005439Corn, Switchgrass And Miscanthus RhizosphereGTKFVFRSDRFTGGRVGSGGPEIKAENLNGDIRILERHE*
Ga0066686_1047099823300005446SoilRAIQEEHHGAKVVFHADRYTGVRVNSGGPEIKVENLNGEIRILENHE*
Ga0070681_1053495213300005458Corn RhizosphereGGKVVYRADRFTGARVNAGGPEIQIENLNGDIRILENHE*
Ga0066691_1001298573300005586SoilIQEEHHGAKVVFHADRYTGVRVNSGGPEIKVENLNGEIRILENHE*
Ga0070761_1050706523300005591SoilEHHGGKVVFHADRFTAARVSNGGPEIKIENLNGDIRILENHE*
Ga0070762_1132478123300005602SoilTTAPLHAPQEEHRGNKVVYHTDRFTAGRVSAGGPEIKIENLNGDIRILENHE*
Ga0070763_1026189123300005610SoilQEEHHGGKVVFRADRFTAARVSGGGPEIKIENLNGDIRILENHE*
Ga0070764_1063693323300005712SoilGGKVVFRADRFTAARISNGGPEIKIENLNGDIRILENHE*
Ga0066903_10400496913300005764Tropical Forest SoilRAVQEEHRGAKVVFHADRYTGVRVSSGGPEIKVENLNGDIRILENHE*
Ga0070717_1011484833300006028Corn, Switchgrass And Miscanthus RhizosphereFVFRSDRFTGGRVGSGGPEIKAENLNGDIRILERHE*
Ga0066652_10053295623300006046SoilKVVFHADRYTGVRVNSGGPEIKVENLNGEIRILENHE*
Ga0070765_10101149423300006176SoilMPLHAVQEEHHGGKVVYHADRFTAARVSAGGPEIKIENLNGDIRILENHE*
Ga0079222_1186634113300006755Agricultural SoilNGKLILRADRYTGGRVGNGGPEIRVENFNGDIRVLERHD*
Ga0066665_1127798023300006796SoilPVTALPVHALLEEHHGAKVIFRADRYTGVRVNSGGPEIQVENLNGDIRILENHE*
Ga0066660_1154592523300006800SoilRPPEEQRTSGKFVFRADRFTGGRVAAGGSEIKIETLNGDIHIRERHD*
Ga0079221_1120465813300006804Agricultural SoilKFVFRSDRFTGGRIGSGGPEIKAENLNGDIRILERHE*
Ga0079220_1039179123300006806Agricultural SoilPVHSIQEEKRGGRVVFRADRFTSARVNAGGPEIQIENLNGDIRILENHE*
Ga0079220_1047993013300006806Agricultural SoilQGAKVVFHADRYSGVRVSSGGPEIKVENLNGEIRILENHE*
Ga0075425_10081032033300006854Populus RhizosphereGAKVVFHADRYTGVRVNSGGPEIKVENLNGEIRILANHE*
Ga0075435_10202136213300007076Populus RhizosphereEEHHGAKVTFHADRYTGVRVGSGGPEIKVENLNGDIRILEHHE*
Ga0099791_1051490413300007255Vadose Zone SoilHHGSKVIFRADRYTGARINAGGPQIEVQNLNGDIRILENHE*
Ga0099827_1157441313300009090Vadose Zone SoilKVVFRADRYTGARIASGGPQIKVENLNGDIRILENHE*
Ga0126382_1011195033300010047Tropical Forest SoilGGKFVFRADRYTGVRVSSGGPEIKVENLNGDIRILENHE*
Ga0126373_1074980913300010048Tropical Forest SoilHDGKFVFRTSRFTGGRVGSGGLEIKADNLNGDIRVLERHE*
Ga0134082_1036751423300010303Grasslands SoilIQEEHHGAKVVFHADRYTSVRVNSGGPEIKVENLNGEIRILENHE*
Ga0134109_1005021433300010320Grasslands SoilGAKVVYRADRYTGVRIGTGGPEIKVENLNGDIRILENHE*
Ga0134067_1044259213300010321Grasslands SoilIQEEHHGAKVIFRADRFAGARVSSGGPQIKVENLNGDIRILENHE*
Ga0134071_1009612813300010336Grasslands SoilHHGAKVVFHADRYTGVRVNSGGPEIKVENLNGEIRILENHE*
Ga0126372_1333282213300010360Tropical Forest SoilKFIYKSDRYTGLRVGAGGLEIKADNLNGDIRVLERQ*
Ga0126378_1092000413300010361Tropical Forest SoilALPVHAIQEEHHGTKVVFRADRYTGVRVNSGGPEIKVENLNGDIRILENHE*
Ga0126378_1130042513300010361Tropical Forest SoilKFIYHSDRYTGGRVGAGGMEIKADNLNGDIRVLERHE*
Ga0126377_1197609623300010362Tropical Forest SoilHALQEDHRGGKTIFRADRFTGARVNAGGPEIKVENLNGDIRILENHE*
Ga0126381_10046040833300010376Tropical Forest SoilPVAALPVRPMQEEHHGAKVVYRADRYTGVRIGTGGPEIKVQNLNGDIRILENHE*
Ga0126381_10179115613300010376Tropical Forest SoilSGKFVFRADRFTGGRVAAGGPEIKIETLNGDIHIRERHD*
Ga0136449_10241675423300010379Peatlands SoilVVFRADRYTGGRIGSGGPEIKVANLNGDIRILENHV*
Ga0134124_1005870063300010397Terrestrial SoilVFRSDRYTGGRIGSGGPEIKAENLNGDIRVLERHE*
Ga0126383_1072263323300010398Tropical Forest SoilIYHSDRYTGGRVGAGGMEIKADNLNGDIRVLERHE*
Ga0150983_1608512713300011120Forest SoilMKEEHRSGKVIFRADRYTGARVNSGGPEIKVENLNGDIRILENHE*
Ga0137392_1034477113300011269Vadose Zone SoilIFRADRYTGARINAGGPQIKVENLNGDIRILENHE*
Ga0137391_1040632623300011270Vadose Zone SoilMQQERHGSKVVFRADRYTGARIASGGPQIKVENLNGDIRILENHE*
Ga0137363_1003074413300012202Vadose Zone SoilVHAIQEERRGGKMVYRADRFTGARVNGGGPEIQIENLNGDIRILENHE*
Ga0137399_1007419113300012203Vadose Zone SoilEEHHGSKVIFRADRYTGARINAGGPQIKVENLNGDIRILEDHE*
Ga0137362_1096648023300012205Vadose Zone SoilVQGMQEERHGNKVIFRADRYTGARINAGGPQIKVGNLNGDIRILENHE*
Ga0137381_1008888113300012207Vadose Zone SoilHGAKVVFHADRYTGVRVNSGGPEIKVENLNGEIRILENHE*
Ga0137370_1036416013300012285Vadose Zone SoilFVFRSDRFTNARVGVGGPEIMIDTLNGDIRVLQRHAAL*
Ga0137361_1176081323300012362Vadose Zone SoilPVQGMQEEHHGSKVIFRADRYTGARINAGGPQIKIENLNGDIRILENHE*
Ga0150984_11115755733300012469Avena Fatua RhizosphereALPAHALQEDHRDGKTIFRADRFTGARVNSGGPEIKIENLNGDIRILENHE*
Ga0137397_1023298413300012685Vadose Zone SoilVRAIQEEHHGAKVVFHADRYTGVRVNSGGPEIKVENLNGEIRILENHE*
Ga0137396_1015887433300012918Vadose Zone SoilQEEHHGSKVIFRADRYTGARINAGGPQIKVENLNGDIRILENHE*
Ga0137419_1009355053300012925Vadose Zone SoilKVIFRADRYTGARINAGGPQIKVENLNGDIRILENHE*
Ga0134078_1035892923300014157Grasslands SoilVFHADRYTGVRVNSGGPEIKVENLNGEIRILENHE*
Ga0134079_1031459913300014166Grasslands SoilKVVFHADRYTGVRINSGGPEIKVENLNGDIRILENHE*
Ga0181537_1094603913300014201BogHRGGKVVFHADRFTAARVSSGGPEIKIENLNGDIRILENHE*
Ga0137411_126112713300015052Vadose Zone SoilDSAAGAGNVKEEHHGAKVIFRADRYTGARVNAGGPQIKVENLNGDIRILENHE*
Ga0134072_1016968023300015357Grasslands SoilPVRAVQEEHHGAKVVFHADRYTGVRINSGGPEIKVENLNGDIRILENHE*
Ga0182041_1070910113300016294SoilALPVRAIQEEHHGAKVVFHADRYTSVRVNSGGPEIKVENLNGEIRILENHE
Ga0182035_1145040813300016341SoilDGKLVFRTDGFTGGRVGAGGPEIKVENLNGDIRVLERHA
Ga0182037_1089728513300016404SoilIEEEHHGAKVVFRADRYTGVRVNSGGPEIKVENLNGDIRILENHE
Ga0182038_1041102713300016445SoilPQRAIQEEHHGAKVIFRADRYTGARVNSGGPEIKIENLNGDICILENHE
Ga0187772_1100256213300018085Tropical PeatlandVIYRADRYTEARVNAGGPQIQVENLNGDIRILENHE
Ga0179592_1044140123300020199Vadose Zone SoilLPVQGMQEEHHGAKVVFRADRYTGARINAGGPQIKVENLNGDIRILESHE
Ga0210407_1026699313300020579SoilGGKMVYRADRFTEARVNSGGPEIQIENLNGDIRILENHE
Ga0210401_1144729723300020583SoilQGMQEERHGTKVIFRADRYTGARINAGGPQIKVENLNGDIRILENHE
Ga0210406_1011228353300021168SoilKVVYRADRFTGARVNAGGPEIQVENLNGDIRILENHE
Ga0210406_1036632813300021168SoilHHGSKVIFRADRYTGARINAGGPQIKVENLNGDIRILENHD
Ga0210400_1087321423300021170SoilDFPVTALPAQGMQEEHHGSKVIFRADRYTGARIHSGGPQIKVENLNGDIRILENHE
Ga0210408_1067856713300021178SoilAIQEEHHGAKVVFHADRYTGVRVNSGGPEIKVETLNGEIRILENHE
Ga0210396_1158965313300021180SoilEHHGGKVVYHADRFTAARVSAGGPEIKIENLNGDIRILENHE
Ga0210385_1096361623300021402SoilGKVVFRADRFTAARISNGGPEIKIENLNGDIRILENHE
Ga0210385_1142436913300021402SoilVTTMPLHAVQEEHHGGKVVYHADRFTAARVSAGGPEIKIENLNGDIRILENHE
Ga0210389_1006551113300021404SoilQEERRGGKMVYRADRFTGARVNGGGPEIQIENLNGDIRILENND
Ga0210387_1010385243300021405SoilMVYRADRFTGARVNAGGPEIQIENLNGDIRILENHE
Ga0210386_1171197923300021406SoilVVFRADRFTAARISNGGPEIKIENLNGDIRILENHE
Ga0210394_1171656223300021420SoilIEAEHKGGKVVYRADRYTSARVNAGGPEIQIENLNGDIRILENHE
Ga0210390_1144481813300021474SoilVTALPLHPIQSEHKGAKVVYRADRFTEARVNAGGPEIQIENLNGDIRILENHE
Ga0210402_1125802913300021478SoilVVYRADRFTEARVNSGGPEIQIENLNGDIRILENHE
Ga0210410_1165558023300021479SoilRGGKVVYRANRFTEARVNSGGPEIQIENLNGDIRILENHE
Ga0126371_1280171313300021560Tropical Forest SoilVVFRADRYTGARVSSGGPEIRIENLNGDIRILENHE
Ga0242666_102188733300022721SoilSPVHAIQEERRGGKMVYRANRFAEARVNSGGPEIQIENLNGDIRILENHE
Ga0247670_109863723300024283SoilHAIQQERRGGKVVYRADRFTGARVNAGGPEIQIENLNGDIRILENHE
Ga0207707_1046237423300025912Corn RhizosphereGGKVVYRADRFTGARVNAGGPEIQIENLNGDIRILENHE
Ga0209848_102176623300026221Permafrost SoilNGKFVFRSDRFTGGRIGSGGPEIKAENLNGDIRILERHN
Ga0209235_125494623300026296Grasslands SoilIQEEHHGAKVVFHADRYTGVRVNSGGPEIKVENLNGEIRILENHE
Ga0209153_129450813300026312SoilQEEHHGAKVVFHADRYTGVRINSGGPEIKVENLNGDIRILENHE
Ga0209686_113596613300026315SoilVRAMQEEHHGAKVVYRADRYTGVRIGTGGPEIKVENLNGDIRILENHE
Ga0209472_1006698103300026323SoilKVVFHADRYTNVRVNSGGPEIKVENLNGEIRILENHE
Ga0209158_119603123300026333SoilAIQEEHHAAKVVFHADRYTGVRVNSGGPEIKVENLNGEIRILKS
Ga0209377_122076323300026334SoilEKRGNKFVFRADRYTGVRIGSGGPEIRAENLNGDIRVLERHE
Ga0209804_111175413300026335SoilALPVRAIQEEHHAAKVVFHADRYTGVRVNSGGPEIKVENLNGEIRILENHE
Ga0257161_110299723300026508SoilTALPVRAIQEEHHGAKVVFHADRYTGVRVNSGGPEIKVETLNGEIRILENHE
Ga0209807_110545723300026530SoilAKVVFHADRYTGVRVNSGGPEIKVENLNGEIGILENHE
Ga0179587_1023579513300026557Vadose Zone SoilHGTKFVFRSDRFTGGRIGSGGPEIKAENLNGDIRVLERHE
Ga0209588_112767223300027671Vadose Zone SoilVIFRADRYTGARINAGGPQIKVENLNGDIRILENHE
Ga0209167_1083584313300027867Surface SoilTLPVHGIQEERRGGKVVYRADRFTGARVNAGGPEIQIENLNGDIRILENHE
Ga0209169_1045656123300027879SoilEEHGGKVVFRADRFTAARISNGGPEIKIENLNGDIRILENHE
Ga0209275_1002336643300027884SoilHAIQEERRGGKMVYRADRFTAARVNAGGPEIQIENLNGDIRILENHE
Ga0209275_1010373923300027884SoilIQEERRGGKMVYRADRFTGARVNAGGPEIQVENLNGDIRILENHE
Ga0265318_1023339313300028577RhizosphereFPVTALPLHPIQSEHKGAKVVYRADRFTEARVNAGGPEIQIENLNGDIRILENHE
Ga0222749_1040548513300029636SoilMPLHAVQEEHHGGKVVYHADRFTAARVSAGGPEIKIENLNGDIRILENHE
Ga0170823_1600215123300031128Forest SoilSLPVRSMKEEHEGTRVIFRADRSSGARVGSGGPEISAENLNGNIRILENHE
Ga0265340_1040290223300031247RhizosphereVTTLPLHGIQEERRGGKVVYRADRFTGARVNAGGPEIQIENLNGDIRILENHE
Ga0310915_1066252423300031573SoilGAKVIFRADRYTGARVNSGGPEIKIENLNGDIRILENHE
Ga0310686_11757745123300031708SoilPVTEERHAGKVVYRSDRFTAARVSAGGPEIKIENLNGDIRILENHE
Ga0307476_1117882623300031715Hardwood Forest SoilVVYHADRFTAARVSAGGPEIKIENLNGDIRILENHE
Ga0307474_1057973513300031718Hardwood Forest SoilPTKEEHGGKVVFRADRFTAARISNGGPEIKIENLNGDIRILENHE
Ga0307474_1149925123300031718Hardwood Forest SoilGRFVFHADRYSGGRVAAGGPEIQVETLNGDIHIRERHD
Ga0307469_1054973513300031720Hardwood Forest SoilALPVRAIQEEHHGAKVVFHADRYTGVRVNSGGPEIKVENLNGEIRILENHE
Ga0307469_1108981213300031720Hardwood Forest SoilHAIQEERRGGKMVYRADRFTSARVNAGGPEIQIENLNGDIRILENHE
Ga0307477_1051145523300031753Hardwood Forest SoilQGMQEEHHGSKVIFRADRYTGARINAGGPQIKVENLNGDIRILENHE
Ga0307475_1063169913300031754Hardwood Forest SoilKVVFHADRYTGVRVNSGGPEIKVENLNGEIRILENHE
Ga0307475_1072625423300031754Hardwood Forest SoilGKVVYHADRFTAGRVSAGGPEIKIENLNGDIRILENHE
Ga0318508_119552913300031780SoilHAIQEEHHGTKVVFRADRYTSVRVNSGGPEIKVENLNGDIRILENHE
Ga0307473_1007079513300031820Hardwood Forest SoilEEHRGSKVIFRADRYTGARINAGGPQIKVENLNGDIRILENHE
Ga0307478_1002473363300031823Hardwood Forest SoilGGKVVYHADRFTAARVSAGGPEIKIENLNGDIRILENHE
Ga0307478_1008385153300031823Hardwood Forest SoilGSKVIFRADRYTGARINAGGPQIKVENLNGDIRILENHE
Ga0307478_1109657613300031823Hardwood Forest SoilVTTSPVHAIQEERRGGKMVYRADRFTGARVNSGGPEIQIENLNGDIRILENHE
Ga0306925_1090375313300031890SoilTALPVRAIQEEHHGGKVVFHADRYTGVRVNSGGPEIRVENLNGEIRILENHE
Ga0310910_1067755323300031946SoilLPQRAIQEEHHGAKVIFRADRYTGARVNSGGPEIKIENLNGDICILENHE
Ga0306926_1005261143300031954SoilTALPQRAIQEEHHGAKVIFRADRYTGARVNSGGPEIKIENLNGDIRILENHE
Ga0306926_1303308213300031954SoilGTKVVFRADRYTGVRVNSGGPEIKVENLNGDIRILENHE
Ga0307479_1110877113300031962Hardwood Forest SoilGKVIFRADRYTGARVNSGGPEIKVENLNGDIRILENHD
Ga0307479_1146756823300031962Hardwood Forest SoilQEEHHGGKVVYHADRFTAARVSAGGPEIKIENLNGDIRILENHE
Ga0307479_1178766713300031962Hardwood Forest SoilIFKADRYTGARVNAGGPQIKVENLNGDIRILENHE
Ga0318533_1032131923300032059SoilAIQEEHLGTKVVFRADRYTGVRVNSGGPEIKVENLNGDIRILENHE
Ga0318553_1015245633300032068SoilHGAKVVYRADRYTGVRIGTGGPEIKVQNLNGDIRILENHE
Ga0306924_1160288513300032076SoilERRDGKFIYHSDRYTGGRVGAGGMEIKADNLNGDIRVLERHE
Ga0306920_10381972923300032261SoilDFPVTALPVRAIQEEHHGAKVVFHADHYTGVRVNSGGPEIKVENLNGEIRILENHD
Ga0335083_1096930323300032954SoilVSEEHKGGKLILRADRSTGARIGSGGPEIKVENLNGDIRILENNE
Ga0335077_1004659943300033158SoilREVTPEHRGAKLILRADRTMGVRVGAGGPEIEVENLNGEIRILQSHE
Ga0316620_1032536933300033480SoilGGKVVYRADRFTGARVNAGGPEIQIENLNGDIRILENHD

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.