NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F056827

Metagenome / Metatranscriptome Family F056827

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F056827
Family Type Metagenome / Metatranscriptome
Number of Sequences 137
Average Sequence Length 58 residues
Representative Sequence LERFILTVEGPNFQELDEIELPRSPADGDPIETKLGTCLVVRTESLDDASQYSGRIVCRL
Number of Associated Samples 115
Number of Associated Scaffolds 137

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 78.10 %
% of genes near scaffold ends (potentially truncated) 32.12 %
% of genes from short scaffolds (< 2000 bps) 89.05 %
Associated GOLD sequencing projects 111
AlphaFold2 3D model prediction Yes
3D model pTM-score0.76

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.270 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(30.657 % of family members)
Environment Ontology (ENVO) Unclassified
(29.927 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(31.387 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 40.91%    Coil/Unstructured: 59.09%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.76
Powered by PDBe Molstar

Structural matches with SCOPe domains

SCOP familySCOP domainRepresentative PDBTM-score
b.53.1.1: Ribosomal protein L25-liked1feua_1feu0.63719
d.113.1.2: IPP isomerase-liked1hzta11hzt0.6207
b.168.1.1: HisI-liked1zpsa11zps0.61814
d.113.1.1: MutT-liked1jkna11jkn0.61492
d.113.1.1: MutT-liked1vcda_1vcd0.61299


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 137 Family Scaffolds
PF00884Sulfatase 9.49
PF11139SfLAP 2.92
PF00230MIP 1.46
PF01663Phosphodiest 1.46
PF03706LPG_synthase_TM 1.46
PF03458Gly_transporter 1.46
PF13186SPASM 0.73
PF06897DUF1269 0.73
PF04020Phage_holin_4_2 0.73

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 137 Family Scaffolds
COG0392Predicted membrane flippase AglD2/YbhN, UPF0104 familyCell wall/membrane/envelope biogenesis [M] 1.46
COG0580Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family)Carbohydrate transport and metabolism [G] 1.46
COG2860Uncharacterized membrane protein YeiHFunction unknown [S] 1.46
COG1950Uncharacterized membrane protein YvlD, DUF360 familyFunction unknown [S] 0.73
COG4803Uncharacterized membrane proteinFunction unknown [S] 0.73


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.27 %
UnclassifiedrootN/A0.73 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000364|INPhiseqgaiiFebDRAFT_104104505All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Couchioplanes → Couchioplanes caeruleus534Open in IMG/M
3300002568|C688J35102_120667708All Organisms → cellular organisms → Bacteria1322Open in IMG/M
3300002568|C688J35102_120835347All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1748Open in IMG/M
3300004081|Ga0063454_101060851All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria658Open in IMG/M
3300004081|Ga0063454_101940085All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300004463|Ga0063356_100262770All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2103Open in IMG/M
3300004479|Ga0062595_100937305All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria735Open in IMG/M
3300004798|Ga0058859_10080434All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria647Open in IMG/M
3300004801|Ga0058860_10111153All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Couchioplanes → Couchioplanes caeruleus692Open in IMG/M
3300005162|Ga0066814_10100413All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14541Open in IMG/M
3300005168|Ga0066809_10094268All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Couchioplanes → Couchioplanes caeruleus725Open in IMG/M
3300005186|Ga0066676_10183464All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1336Open in IMG/M
3300005330|Ga0070690_100120743All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1759Open in IMG/M
3300005332|Ga0066388_107107276Not Available563Open in IMG/M
3300005343|Ga0070687_100285246All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Couchioplanes → Couchioplanes caeruleus1041Open in IMG/M
3300005343|Ga0070687_100320372All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales990Open in IMG/M
3300005365|Ga0070688_100266955All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1224Open in IMG/M
3300005437|Ga0070710_10252290All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Couchioplanes → Couchioplanes caeruleus1134Open in IMG/M
3300005450|Ga0066682_10385320All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium900Open in IMG/M
3300005526|Ga0073909_10002899All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia5072Open in IMG/M
3300005549|Ga0070704_100367733All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1218Open in IMG/M
3300005549|Ga0070704_100490469All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Couchioplanes → Couchioplanes caeruleus1064Open in IMG/M
3300005587|Ga0066654_10099467All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M141402Open in IMG/M
3300005615|Ga0070702_100042155All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales2564Open in IMG/M
3300005618|Ga0068864_100982390All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria837Open in IMG/M
3300006046|Ga0066652_100445463All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1190Open in IMG/M
3300006173|Ga0070716_101238468All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Couchioplanes → Couchioplanes caeruleus601Open in IMG/M
3300006175|Ga0070712_101463247All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria597Open in IMG/M
3300006581|Ga0074048_12318839All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Couchioplanes → Couchioplanes caeruleus614Open in IMG/M
3300006581|Ga0074048_12702071All Organisms → cellular organisms → Bacteria → Terrabacteria group566Open in IMG/M
3300006605|Ga0074057_11441483All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria609Open in IMG/M
3300007255|Ga0099791_10242292All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Couchioplanes → Couchioplanes caeruleus854Open in IMG/M
3300009176|Ga0105242_10668181All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1012Open in IMG/M
3300009551|Ga0105238_11654535All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Couchioplanes → Couchioplanes caeruleus671Open in IMG/M
3300009840|Ga0126313_11800634All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Couchioplanes → Couchioplanes caeruleus512Open in IMG/M
3300010036|Ga0126305_10089888All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1825Open in IMG/M
3300010040|Ga0126308_10040939All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2645Open in IMG/M
3300010087|Ga0127492_1098251All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Couchioplanes → Couchioplanes caeruleus502Open in IMG/M
3300010147|Ga0126319_1165210All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Couchioplanes → Couchioplanes caeruleus837Open in IMG/M
3300010154|Ga0127503_10142274All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Couchioplanes → Couchioplanes caeruleus931Open in IMG/M
3300010154|Ga0127503_10223398All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Couchioplanes → Couchioplanes caeruleus773Open in IMG/M
3300010333|Ga0134080_10707602All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14500Open in IMG/M
3300012198|Ga0137364_10034553All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Couchioplanes → Couchioplanes caeruleus3255Open in IMG/M
3300012200|Ga0137382_10159230All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1535Open in IMG/M
3300012200|Ga0137382_10295613All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Couchioplanes → Couchioplanes caeruleus1129Open in IMG/M
3300012685|Ga0137397_10041751All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3281Open in IMG/M
3300012685|Ga0137397_10754073All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Couchioplanes → Couchioplanes caeruleus722Open in IMG/M
3300012937|Ga0162653_100020519All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Couchioplanes → Couchioplanes caeruleus887Open in IMG/M
3300012938|Ga0162651_100047793All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14668Open in IMG/M
3300012941|Ga0162652_100049923All Organisms → cellular organisms → Bacteria → Terrabacteria group679Open in IMG/M
3300012989|Ga0164305_10578791All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Couchioplanes → Couchioplanes caeruleus898Open in IMG/M
3300013308|Ga0157375_11700847All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria747Open in IMG/M
3300014745|Ga0157377_10324139All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1024Open in IMG/M
3300017792|Ga0163161_10692135All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria848Open in IMG/M
3300017997|Ga0184610_1096832All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Couchioplanes → Couchioplanes caeruleus932Open in IMG/M
3300018000|Ga0184604_10304085All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Couchioplanes → Couchioplanes caeruleus563Open in IMG/M
3300018027|Ga0184605_10014467All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3084Open in IMG/M
3300018027|Ga0184605_10026023All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2383Open in IMG/M
3300018051|Ga0184620_10008299All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2278Open in IMG/M
3300018054|Ga0184621_10137311All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella → Kribbella soli878Open in IMG/M
3300018061|Ga0184619_10049258All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1828Open in IMG/M
3300018061|Ga0184619_10072451All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1523Open in IMG/M
3300018061|Ga0184619_10315712All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Couchioplanes → Couchioplanes caeruleus715Open in IMG/M
3300018081|Ga0184625_10182532All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1099Open in IMG/M
3300018433|Ga0066667_10588193All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium927Open in IMG/M
3300018482|Ga0066669_11699712All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium579Open in IMG/M
3300019249|Ga0184648_1315197All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Couchioplanes → Couchioplanes caeruleus561Open in IMG/M
3300019249|Ga0184648_1316067All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Couchioplanes → Couchioplanes caeruleus539Open in IMG/M
3300019254|Ga0184641_1042501All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Couchioplanes → Couchioplanes caeruleus822Open in IMG/M
3300019255|Ga0184643_1380759All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Couchioplanes → Couchioplanes caeruleus958Open in IMG/M
3300019259|Ga0184646_1094662All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Couchioplanes → Couchioplanes caeruleus1145Open in IMG/M
3300019269|Ga0184644_1079013All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Couchioplanes → Couchioplanes caeruleus738Open in IMG/M
3300019269|Ga0184644_1772700All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Couchioplanes → Couchioplanes caeruleus770Open in IMG/M
3300019279|Ga0184642_1207203All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Couchioplanes → Couchioplanes caeruleus918Open in IMG/M
3300019883|Ga0193725_1031107All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1423Open in IMG/M
3300019885|Ga0193747_1119766All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria624Open in IMG/M
3300019999|Ga0193718_1002561All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3864Open in IMG/M
3300020004|Ga0193755_1201457All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14567Open in IMG/M
3300020016|Ga0193696_1003411All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4580Open in IMG/M
3300020022|Ga0193733_1045810All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1235Open in IMG/M
3300020070|Ga0206356_10216725All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Couchioplanes → Couchioplanes caeruleus937Open in IMG/M
3300020080|Ga0206350_10219378All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Couchioplanes → Couchioplanes caeruleus834Open in IMG/M
3300020082|Ga0206353_10880373All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Couchioplanes → Couchioplanes caeruleus533Open in IMG/M
3300021078|Ga0210381_10375783All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Couchioplanes → Couchioplanes caeruleus522Open in IMG/M
3300021151|Ga0179584_1501155All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Couchioplanes → Couchioplanes caeruleus845Open in IMG/M
3300021344|Ga0193719_10280323All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria701Open in IMG/M
3300021363|Ga0193699_10142251All Organisms → cellular organisms → Bacteria985Open in IMG/M
3300021415|Ga0193694_1050492All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Couchioplanes → Couchioplanes caeruleus574Open in IMG/M
3300021510|Ga0222621_1040334All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Couchioplanes → Couchioplanes caeruleus970Open in IMG/M
3300021951|Ga0222624_1316794All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Couchioplanes → Couchioplanes caeruleus846Open in IMG/M
3300022756|Ga0222622_10198548All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1329Open in IMG/M
3300025903|Ga0207680_10662623All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria747Open in IMG/M
3300025914|Ga0207671_10546042All Organisms → cellular organisms → Bacteria924Open in IMG/M
3300025914|Ga0207671_11256646All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Couchioplanes → Couchioplanes caeruleus578Open in IMG/M
3300025926|Ga0207659_10895128All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Couchioplanes → Couchioplanes caeruleus763Open in IMG/M
3300026555|Ga0179593_1156287All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2879Open in IMG/M
3300027401|Ga0208637_1027438All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14642Open in IMG/M
3300027821|Ga0209811_10004266All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4614Open in IMG/M
3300027821|Ga0209811_10004852All Organisms → cellular organisms → Bacteria4331Open in IMG/M
3300028704|Ga0307321_1049154All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Couchioplanes → Couchioplanes caeruleus797Open in IMG/M
3300028768|Ga0307280_10337691All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella → Kribbella soli554Open in IMG/M
3300028787|Ga0307323_10290512All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella → Kribbella soli588Open in IMG/M
3300028802|Ga0307503_10333938All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium772Open in IMG/M
3300028803|Ga0307281_10148427All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Couchioplanes → Couchioplanes caeruleus821Open in IMG/M
3300028807|Ga0307305_10343329All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14677Open in IMG/M
3300028814|Ga0307302_10242320All Organisms → cellular organisms → Bacteria883Open in IMG/M
3300028824|Ga0307310_10334433All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria742Open in IMG/M
3300028828|Ga0307312_10217184All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella → Kribbella soli1231Open in IMG/M
3300028828|Ga0307312_10520755All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria785Open in IMG/M
3300028878|Ga0307278_10084334All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1431Open in IMG/M
3300028884|Ga0307308_10239307All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria870Open in IMG/M
3300030831|Ga0308152_102220All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Couchioplanes → Couchioplanes caeruleus930Open in IMG/M
3300030831|Ga0308152_104716All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Couchioplanes → Couchioplanes caeruleus737Open in IMG/M
3300030986|Ga0308154_105527All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Couchioplanes → Couchioplanes caeruleus748Open in IMG/M
3300030989|Ga0308196_1016227All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Couchioplanes → Couchioplanes caeruleus829Open in IMG/M
3300031097|Ga0308188_1009058All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Couchioplanes → Couchioplanes caeruleus828Open in IMG/M
3300031099|Ga0308181_1052350All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Couchioplanes → Couchioplanes caeruleus778Open in IMG/M
3300031100|Ga0308180_1008495All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Couchioplanes → Couchioplanes caeruleus865Open in IMG/M
3300031184|Ga0307499_10128619All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Couchioplanes → Couchioplanes caeruleus723Open in IMG/M
3300031226|Ga0307497_10007454All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2997Open in IMG/M
3300031231|Ga0170824_125564799All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Couchioplanes → Couchioplanes caeruleus874Open in IMG/M
3300031421|Ga0308194_10110971All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Couchioplanes → Couchioplanes caeruleus802Open in IMG/M
3300031423|Ga0308177_1009102All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Couchioplanes → Couchioplanes caeruleus736Open in IMG/M
3300031423|Ga0308177_1011263All Organisms → cellular organisms → Bacteria → Terrabacteria group691Open in IMG/M
3300031424|Ga0308179_1017709All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Couchioplanes → Couchioplanes caeruleus758Open in IMG/M
3300031446|Ga0170820_15054287All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14512Open in IMG/M
3300031446|Ga0170820_15600198All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Couchioplanes → Couchioplanes caeruleus700Open in IMG/M
3300031469|Ga0170819_17920032All Organisms → cellular organisms → Bacteria → Terrabacteria group631Open in IMG/M
3300031474|Ga0170818_115313370All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Couchioplanes → Couchioplanes caeruleus937Open in IMG/M
3300031720|Ga0307469_11939844All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria571Open in IMG/M
3300034447|Ga0370544_11576All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Couchioplanes → Couchioplanes caeruleus660Open in IMG/M
3300034643|Ga0370545_040397All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Couchioplanes → Couchioplanes caeruleus874Open in IMG/M
3300034643|Ga0370545_052125All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium798Open in IMG/M
3300034643|Ga0370545_054969All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Couchioplanes → Couchioplanes caeruleus784Open in IMG/M
3300034643|Ga0370545_112943All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Couchioplanes → Couchioplanes caeruleus602Open in IMG/M
3300034680|Ga0370541_032934All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Couchioplanes → Couchioplanes caeruleus630Open in IMG/M
3300034681|Ga0370546_017385All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Couchioplanes → Couchioplanes caeruleus922Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil30.66%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment7.30%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment7.30%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.84%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.38%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.38%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.65%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil3.65%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil2.92%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere2.92%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil2.19%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil2.19%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil2.19%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere2.19%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil2.19%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.19%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.46%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.46%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.46%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated1.46%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.46%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.73%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.73%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.73%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.73%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.73%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.73%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.73%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.73%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.73%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004798Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300004801Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300005162Soil and rhizosphere microbial communities from Laval, Canada - mgLABEnvironmentalOpen in IMG/M
3300005168Soil and rhizosphere microbial communities from Laval, Canada - mgLPCEnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005450Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131EnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006581Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006605Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010036Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26EnvironmentalOpen in IMG/M
3300010040Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55EnvironmentalOpen in IMG/M
3300010087Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_0_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010147Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010154Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012937Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t5i015EnvironmentalOpen in IMG/M
3300012938Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t2i015EnvironmentalOpen in IMG/M
3300012941Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t4i015EnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300017997Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coexEnvironmentalOpen in IMG/M
3300018000Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coexEnvironmentalOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018051Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1EnvironmentalOpen in IMG/M
3300018054Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1EnvironmentalOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019249Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019254Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019255Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019259Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019269Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019279Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019883Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2EnvironmentalOpen in IMG/M
3300019885Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2EnvironmentalOpen in IMG/M
3300019999Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a1EnvironmentalOpen in IMG/M
3300020004Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2EnvironmentalOpen in IMG/M
3300020016Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1EnvironmentalOpen in IMG/M
3300020022Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2EnvironmentalOpen in IMG/M
3300020070Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020080Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020082Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300021078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redoEnvironmentalOpen in IMG/M
3300021151Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_06_16RNAfungal (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300021363Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2EnvironmentalOpen in IMG/M
3300021415Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s1EnvironmentalOpen in IMG/M
3300021510Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coexEnvironmentalOpen in IMG/M
3300021951Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026555Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300027401Soil and rhizosphere microbial communities from Laval, Canada - mgLAC (SPAdes)EnvironmentalOpen in IMG/M
3300027821Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028704Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_379EnvironmentalOpen in IMG/M
3300028768Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119EnvironmentalOpen in IMG/M
3300028787Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381EnvironmentalOpen in IMG/M
3300028802Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_SEnvironmentalOpen in IMG/M
3300028803Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300030831Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_141 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030986Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_143 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030989Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_197 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031097Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_183 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031099Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_152 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031100Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_151 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031184Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_SEnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031421Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031423Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_148 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031424Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_150 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031469Fir Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300034447Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_119 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034643Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_120 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034680Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_116 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034681Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_121 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
INPhiseqgaiiFebDRAFT_10410450523300000364SoilLERFILTVEGPTFQELDEIELQRSPADGDPIETNLGTCLVVRTEPLDDSSQYSGRI
C688J35102_12066770833300002568SoilLARFILTVEGPNFEEVDEIELPRSPVDGDPIETKLGTCLVIRTESLDEASQYSGRIVCRLPG*
C688J35102_12083534733300002568SoilLQRFILTLEGRDFEEVDEIELPRSPVEGDPIETNLGTCVVVRTEKVAEASQFSGRIVCRMP*
Ga0063454_10106085123300004081SoilLERFILTVEGPNFQEVDEIELPRSPVDGDPIETKLGTCLVVRTESLDEASQFSGRIVCRLP*
Ga0063454_10194008523300004081SoilVQRFIVTVEGRGFEELDEIELPRPPADGDPIETNLGTCLVVRTEAADAASAYSGRIVCRLP*
Ga0063356_10026277013300004463Arabidopsis Thaliana RhizosphereLQRFILTVEGSSFEEIDEIELPRLPGDGDPIETKLGTCLVVRTEALDDASQYSGRIVCRLP*
Ga0062595_10093730513300004479SoilLERFILTVEGPNFQELDEIELPRSPADGDPIETDLGTCLVVRTEPLDDSSQYSGRIVCRLP*
Ga0058859_1008043423300004798Host-AssociatedLERFILTVEGPNFQELDEIELPRSPVEGDPIETDLGTCLVVRTEPLNDSSQYSGRIVCRLP*
Ga0058860_1011115313300004801Host-AssociatedLERFILTVEGPNFQELDEIELPRSPADGDPIETNLGTCLVVRTEPLDDSSQYSGRIVCRLP*
Ga0066814_1010041313300005162SoilLKRFVVTVEGPNLEDIEEIELPSLPQEGDPIETRFGTCVVVRTESVTDGSGHEGRIVCRMP*
Ga0066809_1009426813300005168SoilLKRFVVTVEGPNLEDIEEIELPSLPQEGDPIETRFGTCVVVRTESVADGSGHDGRIVCRMP*
Ga0066676_1018346423300005186SoilVPRFILTVEGPNLEDLDEIELPRLPLEGDPVSTRFGMCLVTSTESLNNGGEFAGRIVCRMP*
Ga0070690_10012074323300005330Switchgrass RhizosphereLERFILTVEGPNFQELDEIELPRSPVEGDPIETDLGTCLVVRTEPLDDSSQYSGRIVCRLP*
Ga0066388_10710727613300005332Tropical Forest SoilMKRFIVTVEGSNLTDIEEIELPALPSEGDPIETRFGTCVVVSTEVLSGPSVHQGKIVCRMP*
Ga0070687_10028524613300005343Switchgrass RhizosphereLERFILTVEGPNFQELDEIELPRSPVEGDPIETDLGTCLVVRTEPLDDSSQYSGRI
Ga0070687_10032037233300005343Switchgrass RhizosphereFQELDEIELPRSPADGDPIETNLGTCLVVRTEPLDDSSQYSGRIVCRLP*
Ga0070688_10026695513300005365Switchgrass RhizosphereLERFILTVEGPNFQELDEIELPRSPVEGDPIETDLGTCLVVRTEPLDDSSQYSGRIV
Ga0070710_1025229013300005437Corn, Switchgrass And Miscanthus RhizosphereLERFILTVEGPNFQELDEIELPRSPVEGDPIETDLGTCLVVRTEPLDDSSQYSGRIVC
Ga0066682_1038532013300005450SoilLPRFILTVEGPNLEDLDEIELPRLPLEGDPVSTRFGMCLVTSTESLNNGGEFAGRIVCRMP*
Ga0073909_1000289953300005526Surface SoilLKRFVVTVEGPNLEDLEEIELPRLPQEGDPIETRFGTCVVVRTEAVVDASGHEGRIVCRMP*
Ga0070704_10036773313300005549Corn, Switchgrass And Miscanthus RhizosphereGPNFQELDEIELPRSPVEGDPIETDLGTCLVVRTEPLDDSSQYSGRIVCRLP*
Ga0070704_10049046933300005549Corn, Switchgrass And Miscanthus RhizosphereLERFILTVEGPNFQELDEIELPRSPVEGDPIETDLGTCLVVRTEPLDD
Ga0066654_1009946723300005587SoilVQRFIVTVEGPGFQELDEIELPRPPADGDPIETNLGTCLVIRTEAADAASAYSGRILCRLP*
Ga0070702_10004215513300005615Corn, Switchgrass And Miscanthus RhizosphereGPNFQELDEIELPRSPVEGDPIETDLGTCLVVRTEPLNDSSQYSGRIVCRLP*
Ga0068864_10098239023300005618Switchgrass RhizosphereLERFILTVEGPNFQELDEIELPRSPVEGDPIETDLGTCLVVRTEPLHDSSQYSGRIVCRLP*
Ga0066652_10044546313300006046SoilAELPRFILTVEGPNLEDLDEIELPRLPLEGDPVSTRFGMCLVTSTESLNNGGEFAGRIVCRMP*
Ga0070716_10123846823300006173Corn, Switchgrass And Miscanthus RhizosphereLERFILTVEGPNFQELDEIELPRSPADGDPIETNLGTCLVVRTEPLDDSSQYSGRIV
Ga0070712_10146324713300006175Corn, Switchgrass And Miscanthus RhizosphereLARFILTVEGSNFQELDEIELPRPPADGDPIETNLGTCLVLRTEPLDDSSQYSGRIVCRLP*
Ga0074048_1231883913300006581SoilLQQFILTVEGPGFEDLEKIELPKAPVDGDAIETQLGTCVVIRTEPMADDSQYAGRIVCRMP*
Ga0074048_1270207123300006581SoilLERFILTVEGPNFQELDEIELPRSPADGDPIETNLGTCLVVRTEPLDDTSQYSGRIVCRLP*
Ga0074057_1144148323300006605SoilLERFILTVEGPNFQEVDEIELPRSPADGDPIETNLGTCLVVRTEPLDDSSQYSGRIVCRLP*
Ga0099791_1024229223300007255Vadose Zone SoilLQQFILTVEGPNFEDLDEIELPRLPQEGDPIETRFGTCLVVRTESATESSGYDGRIVCRLP*
Ga0105242_1066818133300009176Miscanthus RhizospherePNFQELDEIELPRSPVEGDPIETDLGTCLVVRTEPLDDSSQYSGRIVCRLP*
Ga0105238_1165453513300009551Corn RhizosphereLERFILTVEGPNFQELDEIELPKSPVEGDPIETDLGTCLVVRTEPLNDSSQYSGRIVCRLP*
Ga0126313_1180063423300009840Serpentine SoilMQFILTVEGPNMEDIESIELPRLPLAGEPIETNFGTCIVVSTTQSAAGGQYDGTIVC
Ga0126305_1008988823300010036Serpentine SoilMQFILTVEGPNLEDVESIELPQLPVAGEPIETNFGRCIVVSTAPAAAGSQYDGTIVCRMP
Ga0126308_1004093923300010040Serpentine SoilMQFILTVEGPNLEDVESIELPQLPLAGEPIETNFGRCIVVSTAPAAAGSQYDGTIVCRMP
Ga0127492_109825123300010087Grasslands SoilLQQFILTVEGSNFEELDEIELPQLPQAGDPIETKLGTCLVVRTESAAEGSNYD
Ga0126319_116521013300010147SoilLARFILTVEGPNFQEVDEIELPRSPVDGDPIETKLGTCLVVRTESLDDASQYSGRIVCR
Ga0127503_1014227413300010154SoilLKRFIVTVEGPNLEDLEEIELPSLPQEGDPIETRFGTCVVVRTESVADVSGHEGRIVCRMP*
Ga0127503_1022339823300010154SoilLKRFILTVEGPNLEDLEEIELPSLPLEGEPIETRFGTCVVVRTESVADGSGHDGKIICRMP*
Ga0134080_1070760213300010333Grasslands SoilLQQFILTVEGSNFEELDEIELPRLPQEGDPIETKLGTCLVVRTESAAEGSNYDGRIVCRLP*
Ga0137364_1003455323300012198Vadose Zone SoilLQQFILTVEGSNFEELDEIELPQLPQAGDPIETNLGTCIVVRTESAAEGSNYDGRIVCRLP*
Ga0137382_1015923023300012200Vadose Zone SoilLKQFILTVEGPNLEDLEEIELPSLPLEGDPIETRFGTCVVVRTEAVADGSGHDGKIICRMP*
Ga0137382_1029561313300012200Vadose Zone SoilLKRFILTVEGPSFQEVDVIELPRSPADDDPIETKLGTCLVVRTESLDDASQYSGRIVCRLP*
Ga0137397_1004175113300012685Vadose Zone SoilLQQFILTVEGPNFEEVDEIELPRRPVDGDPIETKLGTCLVVRTESLDDASQYSGRIVCRLP*
Ga0137397_1075407323300012685Vadose Zone SoilLKQFILTVEGPNLEDLEEIELPSLPLEGDPIETRFGTCVVVRTEPVTDGSGHDGKIICRMP*
Ga0162653_10002051913300012937SoilLERFILTVEGPNFQELDEIELPRSPADGDPIETKLGTCLVVRTESLDDASQYSGRIVCRLP*
Ga0162651_10004779313300012938SoilLQQFILMVEGGSFEELDEIELPRLPQEGDPIETNLGTCLVVRTEPAAEGSNYDGRIVCRLP*
Ga0162652_10004992323300012941SoilLQQFILTVEGANFEELDEIELPSLPREGDPIETNLGTCLVVRTEPAAEGSNYDGRIVCRLP*
Ga0164305_1057879113300012989SoilLKRFVVTVEGPNLEDIEEIELPSLPQEGDPIETRFGTCVVVRTEAVVDASGHEGRIVCRMP*
Ga0157375_1170084723300013308Miscanthus RhizosphereLERFILTVEGPNFQELDEIELPRSPVEGDPIETDLGTCLVVWTEPLNDSSQYSGRIVCRLP*
Ga0157377_1032413933300014745Miscanthus RhizosphereLERFILTVEGPTFQELDEIELPRSPVEGDPIETDLGTCLVVRAEPLDDSSQYSGRIVCRLP*
Ga0163161_1069213523300017792Switchgrass RhizosphereLERFILTVEGPNFQELDEIELPRSPVEGDPIETDLGTCLVVRTEPLNDSSQYSGRIVCRL
Ga0184610_109683223300017997Groundwater SedimentLARFILTVEGPNFHELDEIELPRSPADGDPIETNLGTCLVVRTEPLDDSSQYSGRIVCRM
Ga0184604_1030408513300018000Groundwater SedimentLARFILTVEGPNFHELDEIELPRSPADGDPIETNLGTCLVVRTEPLDDSSQYSG
Ga0184605_1001446713300018027Groundwater SedimentLKQFILTVEGPNLEDLEEIELPSLPLEGDPIETRFGTCVVVRTEAVADGSGHDGRIVCRM
Ga0184605_1002602343300018027Groundwater SedimentLQQFILTVEGANFEELDEIELPRLPQEGDPIETKLGTCLVVRTESAAEGSNYDGRIVCRL
Ga0184620_1000829943300018051Groundwater SedimentLARFILTVEGPNFHELDEIELPRSPAAGDPIETNLGTCLVVRTEPLDDSSQYSGRIVCRM
Ga0184621_1013731123300018054Groundwater SedimentLQQFILTVEGPGFEELDEIELPRLPQEGDPIETKLGTCLVVRTETAADGSNYDGRIVCRL
Ga0184619_1004925813300018061Groundwater SedimentFEELDEIELPRLPQEGDPIETKLGTCLVVRTESAAEGSNYDGRIVCRLP
Ga0184619_1007245113300018061Groundwater SedimentLKQFILTVEGPNLEDLEEIELPSLPLEGDPIETRFGTCIVVRTEPVADGSGHDGRIVCRM
Ga0184619_1031571223300018061Groundwater SedimentLQQFILTVEGPNFEELDEIELPRLPQEGDPIETKLGTCLVVRTESAAEGSNYDGRIVCRL
Ga0184625_1018253233300018081Groundwater SedimentLERFILTVEGPNFQELDEIELPRSPADGDPIETNLGTCLVIRTESLDDASQYSGRIVCRL
Ga0066667_1058819313300018433Grasslands SoilLPRFILTVEGPNLEDLDEIELPRLPLEGDPVSTRFGMCLVTSTESLNNGGEFAGRIVCRM
Ga0066669_1169971223300018482Grasslands SoilPRFILTVEGPNLEDLDEIELPRLPLEGDPVSTRFGMCLVTSTESLNNGGEFAGRIVCRMP
Ga0184648_131519713300019249Groundwater SedimentLKQFILTVEGPNLEDLEEIELPSLPQEGDPIETRFGTCVVVRTESVADGS
Ga0184648_131606713300019249Groundwater SedimentLKQFILTVEGPNLEDLEEIELPGLPQEGDPIETRFGTCVVVRTESVADGS
Ga0184641_104250123300019254Groundwater SedimentLARFILTVEGPNFHELDEIELPRSPADGDPIETNLGTCLVVRTEPLDD
Ga0184643_138075913300019255Groundwater SedimentLKQFILTVEVPNLEDLEEIELPSLPLEGDPIETRFGTCIVVRTEPVADGSGHDGRIVCRM
Ga0184646_109466233300019259Groundwater SedimentLARFILTVEGPNFHELDEIELPRSPADGEPIETNLGTCLVVRTEPLDDSSQYSGRIVCRM
Ga0184644_107901313300019269Groundwater SedimentLQQFILTVEGANFEELDEIELPSLPREGDPIETNLGTCLVVRTEPAAEGSNYDGRIVCRL
Ga0184644_177270023300019269Groundwater SedimentLKRFVVTVEGPNLEDIEEIELPSLPQEGDPIETRFGTCVVVRTESVADGSGHEGRIVCRM
Ga0184642_120720323300019279Groundwater SedimentLARFILTVEGPNFHELDEIELPRSPADGDPIETNLGTCLVVRTESLDDASQYSGRIVCRL
Ga0193725_103110733300019883SoilLKRFVVTVEGPNLEDLEEIELPSLPQEGDPIETRFGTCVVVRTESVADGSGHEGRIVCRM
Ga0193747_111976623300019885SoilLARFILTVEGSSFQEIDEIELPRSPADGDPIETNLGTCVVVRTESLDDASQYSGRIVCRL
Ga0193718_100256113300019999SoilLARFILTVEGPNFHELDEIELPRSPADGDPIETNLGTCLVVRTEPLDDS
Ga0193755_120145723300020004SoilLARFILTVEGPNFQEVDEIELPRSPVDGDPIETKLGTCLVVRTESLDDASQYSGRIVCRL
Ga0193696_100341143300020016SoilLKRFVVTVEGPNLEDIEEIELPSLPQEGDPIETRFGTCVVVRTESVVDGSGHEGRIVCRM
Ga0193733_104581033300020022SoilILTVEGPNFHELDEIELPRSPADGDPIETNLGTCLVVRTEPLDDSSQYSGRIVCRMP
Ga0206356_1021672523300020070Corn, Switchgrass And Miscanthus RhizosphereLERFILTVEGPNFQELDEIELPRSPVEGDPIETDLGTCLVVWTEPLNDSSQYSGRIVCRL
Ga0206350_1021937823300020080Corn, Switchgrass And Miscanthus RhizosphereLERFILTVEGPNFQELDEIELPRSPVEGDPIETDLGTCLVVRTEPLHDSSQYSGRIVCRL
Ga0206353_1088037323300020082Corn, Switchgrass And Miscanthus RhizosphereLERFILTVEGPNFQELDEIELPRSPVEGDPIETDLGTCLVVRTEPLNDS
Ga0210381_1037578323300021078Groundwater SedimentLERFILTVEGPNFQELDEIELPRSPADGDPIETNLGTCLVVRTEPLDDS
Ga0179584_150115523300021151Vadose Zone SoilMQQFILTVEGPNLEDLEAIELPNLPLEGEPIETRFGTCVVVRTESMPAGAEYDGRIVCRM
Ga0193719_1028032313300021344SoilLERFILTVEGPSFQEVDEIELPRSPADGDPIETKLGTCLVVRTESLDDASQYSGRIVCRL
Ga0193699_1014225133300021363SoilLARFILTVEGPNFQELDEIELPRSPADGDPIETNLGTCLVVRTEPLDDASQYSGRIVCRL
Ga0193694_105049223300021415SoilLARFILTVEGPNFQEIDEIELPRSPVDGDPIETKLGTCLVVRTESLDDASQYSGRIVCRL
Ga0222621_104033423300021510Groundwater SedimentLARFILTVEGPNFHELDEIELPRSPADGDPIETNLGTCLVVRTEPLDDSSQYSGRIV
Ga0222624_131679413300021951Groundwater SedimentLERFILTVEGPNFQELDEIELPRSPADGDPIETNLGTCLVVRTEPLDDSTQYSGRIVCRL
Ga0222622_1019854833300022756Groundwater SedimentLERFILTVEGPSFQEVDEIELPRSPADGDPIETKLGTCLVVRTESLDDASQYSGRIVCR
Ga0207680_1066262313300025903Switchgrass RhizosphereEGPNFQELDEIELPRSPVEGDPIETDLGTCLVVRTEPLDDSSQYSGRIVCRLP
Ga0207671_1054604233300025914Corn RhizosphereILTVEGPNFQELDEIELPRSPVEGDPIETDLGTCLVVRTEPLNDSSQYSGRIVCRLP
Ga0207671_1125664613300025914Corn RhizosphereLERFILTVEGPNFQELDEIELPRSPVEGDPIETDLGTCLVVRTEPLDDSSQ
Ga0207659_1089512823300025926Miscanthus RhizosphereLERFILTVEGPNFQELDEIELPRSPVEGDPIETDLGTCLVVRTEPLDDSS
Ga0179593_115628753300026555Vadose Zone SoilLKRFILTVEGPSFQEVDEIELPRSPADGDPIETKLGTCLVVRTESLDDASQYSGRIVCRL
Ga0208637_102743823300027401SoilLKRFVVTVEGPNLEDIEEIELPSLPQEGDPIETRFGTCVVVRTESVTDGSGHEGRIVCRM
Ga0209811_1000426653300027821Surface SoilERFILTVEGPNFQELDEIELPRSPADGDPIETNLGTCLVVRTEPLDDSSQYSGRIVCRLP
Ga0209811_1000485243300027821Surface SoilLKRFVVTVEGPNLEDLEEIELPRLPQEGDPIETRFGTCVVVRTEAVVDASGHEGRIVCRM
Ga0307321_104915423300028704SoilLARFILTVEGPNFHELDEIELPRSPADGDPIETNLGTCLVVRTEPLDDSS
Ga0307280_1033769123300028768SoilKQFILTVEGPNLEDLEEIELPSLPLEGDPIETRFGTCVVVRTEAVADGSGHDGRIVCRMP
Ga0307323_1029051213300028787SoilLQQFILQVEGANFEELDEIELPRLPQEGDPIETKIGTCLVVRTEAAAEGSNYDGRIVCRL
Ga0307503_1033393823300028802SoilLKRFVVTVEGPNLEDIEEIELPSLPQEGDPIETRFGTCVVVRTESVADGSGHDGRIVCRM
Ga0307281_1014842713300028803SoilLKQFILTVEGPNLEDLEEIELPSLPQEGDPIETRFGTCVVVRTESVADGSGHDGKIICRM
Ga0307305_1034332923300028807SoilLQQFILQVEGANFEELDEIELPRLPQEGDPIETKIGTCLVVRTESAAEGSNYDGRIVCRL
Ga0307302_1024232033300028814SoilLERFILTVEGPNFQELDEIELPRSPADGDPIETKLGTCLVIRTESLDDASQYSGRIVCRL
Ga0307310_1033443313300028824SoilLQQFILQVEGANFEELDEIELPRLPREGDPIETKIGTCLVVRTEAAAEGSNYDGRIVCRL
Ga0307312_1021718413300028828SoilMKQFILTVEGPNLEDLEEIELPSLPLEGDPIETRFGTCIVVRTEPVADGSGHDGRIVCRM
Ga0307312_1052075523300028828SoilLKQFILTVEGPNLEDLEEIELPSLPQEGDPIETRFGTCVVVRTESVADDSGHDGKIICRM
Ga0307278_1008433433300028878SoilLKQFIVTVEGPNLEDLEEIELPSLPQEGDPIETRFGTCVVVRTESVADGSGHDGRIVCRM
Ga0307308_1023930723300028884SoilLQQFILTVEGANFEELDEIELPRLPQEGDPIETKIGTCLVVRTEAAAEGSNYDGRIVCRL
Ga0308152_10222013300030831SoilLARFILTVEGPNFHELDEIELPRSPADGDPIETNLGTCLVVRTEPLDDSSQYSGRIVCRL
Ga0308152_10471613300030831SoilLQQFILTVEGPNFEELDEIELPRLPKEGDPIETKLGTCLVVRTESAAEGSNYDG
Ga0308154_10552713300030986SoilLERFILTVEGPSFQEVDEIELPRSPADGDPIETKLGTCLVVRTESLDDASQYSGRIVC
Ga0308196_101622713300030989SoilLERFILTVEGPSFQEVDEIELPRSPADGDPIETKLGTCLVVRTESLDDASQYSGRIVCRG
Ga0308188_100905813300031097SoilLERFILTVEGPSFQEVDEIELPRSPADGDPIETKLGTCLVVRTESLDDA
Ga0308181_105235023300031099SoilLQQFILTVEGPNFEELDEIELPRLPQEGDPIETKLGTCLVVRTETAADGSNYDGRI
Ga0308180_100849513300031100SoilLERFILTVEGPNFQELDEIELPRSPADGDPIETKLGTCLVVRTESLDDASQYSGRIVCRL
Ga0307499_1012861923300031184SoilLKRFVVTVEGPNLEDLEEIELPSLPQEGDPIETRFGTCVVVRTESVTDGSGHEGRIVCRM
Ga0307497_1000745413300031226SoilKRFVVTVEGPNLEDLEEIELPSLPQEGDPIETRFGTCVVVRTESVTDGSGHEGRIVCRMP
Ga0170824_12556479923300031231Forest SoilLKRFVVTVEGPNLEDLEEIELPSLPQEGDPIETRFGTCVVVRTEAVADGSRHDGRIVCRM
Ga0308194_1011097113300031421SoilLQQFILTVEGANFEELDEIELPRLPQEGDPIETKIGTCLVVRTESAAEGSNYDGRIVCRL
Ga0308177_100910223300031423SoilLQQFILTVEGPNFEELDEIELPRLPQEGDPIETKLGTCLVVRTESAAEGSNYDGRIVC
Ga0308177_101126323300031423SoilLQQFILQVEGANFEELDEIELPRLPQEGDPIETNLGTCLVVRTEPAAEGSNYDGRIVCRL
Ga0308179_101770913300031424SoilLERFILTVEGPNFQELDEIELPRSPADGDPIETNLGTCLVVRTEPLDDSSQYSGR
Ga0170820_1505428723300031446Forest SoilLERFILTVEGSNFQELDEIELPRPPADGDPIETDLGTCLVLRTESLDDSSQYSGRIVCRL
Ga0170820_1560019823300031446Forest SoilLARFILTVEGSNFQELDEIELPRPPADGDPIETDLGTCLVLRTEQLDDSSQYSGRIVCRL
Ga0170819_1792003213300031469Forest SoilLQRFILTVEGPGFEELDEIELPRLPPEGDPIETKFGTCLIVRAEGATDGSNYDGRIVCRL
Ga0170818_11531337013300031474Forest SoilLARFILTVEGSNFQELDEIELPRPPADGDPIETNLGTCLVLRTEPLDDSSQYSGRIVCRL
Ga0307469_1193984413300031720Hardwood Forest SoilLERFILTVEGPNFQELDEIELPRSPADGDPIETNLGTCLVVRTEPLDDSSQYSGRIVWRL
Ga0370544_11576_37_2223300034447SoilLQQFILTVEGPNFEELDEIELPRLPQEGDPIETKIGTCLVVRTESAAEGSNYDGRIVCRL
Ga0370545_040397_6_1913300034643SoilLARFILTVEGSNFQELDEIELPRPPADGDPIETNVGTCLVLRTEPLDDSSQYSGRIVCRL
Ga0370545_052125_601_7863300034643SoilLKQFILTVEGPNLEDLEEIELPSLPQEGDPIVTRFGTCVVVRTESVADGSGHDGKIICRM
Ga0370545_054969_630_7823300034643SoilMKQFILTVEGPNLEDLEEIELPSLPQEGDPIETRFGTCVVVRTESVADGSG
Ga0370545_112943_2_1843300034643SoilLKRFVVTVEGPNLEDIEEIELPSLPQEGDPIETRFGTCVVVRTESVSDGSGHDGRIVCRM
Ga0370541_032934_467_6283300034680SoilLKQFILTVEGPNLEDLEEIELPSLPLEGDPIETRFGTCVVVRTEAVADGSGHDG
Ga0370546_017385_57_2423300034681SoilLERFILTVEGPSFQEVDEIELPRSPADGDPIETNLGTCLVVRTEPLDDSSQYSGRIVCRM


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.