NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F056632

Metagenome / Metatranscriptome Family F056632

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F056632
Family Type Metagenome / Metatranscriptome
Number of Sequences 137
Average Sequence Length 50 residues
Representative Sequence MFFYISGIGATFFKTEEKNFGIFVGDKVLRLLVPFVVAIFVFLIPRLYFGQ
Number of Associated Samples 123
Number of Associated Scaffolds 137

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 24.26 %
% of genes near scaffold ends (potentially truncated) 45.99 %
% of genes from short scaffolds (< 2000 bps) 94.89 %
Associated GOLD sequencing projects 112
AlphaFold2 3D model prediction Yes
3D model pTM-score0.47

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (95.620 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(17.518 % of family members)
Environment Ontology (ENVO) Unclassified
(40.146 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(54.015 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 60.76%    β-sheet: 0.00%    Coil/Unstructured: 39.24%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.47
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.27 %
UnclassifiedrootN/A0.73 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000128|SA_S1_NOR08_45mDRAFT_c10155053All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum661Open in IMG/M
3300001263|BBAY83_10034922All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1665Open in IMG/M
3300001355|JGI20158J14315_10188851All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum596Open in IMG/M
3300001848|RCM47_1171451All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Muricauda → Muricauda ruestringensis578Open in IMG/M
3300003802|Ga0007840_1001510All Organisms → cellular organisms → Bacteria1457Open in IMG/M
3300003860|Ga0031658_1056798All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium JGI 0001002-J12680Open in IMG/M
3300003860|Ga0031658_1072767All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum606Open in IMG/M
3300004124|Ga0066178_10246235All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum519Open in IMG/M
3300004684|Ga0065168_1015596All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1190Open in IMG/M
3300004692|Ga0065171_1037950All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum776Open in IMG/M
3300004769|Ga0007748_11065140All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cyclobacteriaceae → Mariniradius → Mariniradius saccharolyticus568Open in IMG/M
3300004770|Ga0007804_1068307All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum920Open in IMG/M
3300004789|Ga0007752_11092444All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum910Open in IMG/M
3300004790|Ga0007758_10923559All Organisms → cellular organisms → Bacteria801Open in IMG/M
3300006396|Ga0075493_1544354All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1673Open in IMG/M
3300006415|Ga0099654_10555081All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1643Open in IMG/M
3300007200|Ga0103273_1135864All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1279Open in IMG/M
3300007516|Ga0105050_10156844All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1451Open in IMG/M
3300007516|Ga0105050_10898555All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum500Open in IMG/M
3300007523|Ga0105052_10109801All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1893Open in IMG/M
3300007554|Ga0102820_1086783All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum751Open in IMG/M
3300007722|Ga0105051_10099308All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum2279Open in IMG/M
3300007863|Ga0105744_1198280All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum505Open in IMG/M
3300008107|Ga0114340_1169080All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum780Open in IMG/M
3300008952|Ga0115651_1137314All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1744Open in IMG/M
3300009071|Ga0115566_10533217All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani663Open in IMG/M
3300009182|Ga0114959_10521960All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum572Open in IMG/M
3300009422|Ga0114998_10181370All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1005Open in IMG/M
3300009432|Ga0115005_10152513All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1792Open in IMG/M
3300009436|Ga0115008_10288495All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1165Open in IMG/M
3300009441|Ga0115007_10087219All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1976Open in IMG/M
3300009538|Ga0129287_10131093All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1070Open in IMG/M
3300009592|Ga0115101_1047694All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum2256Open in IMG/M
3300009606|Ga0115102_10375825All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum519Open in IMG/M
3300009785|Ga0115001_10464509All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum784Open in IMG/M
3300010885|Ga0133913_11883558All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1492Open in IMG/M
3300010981|Ga0138316_10939381All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum876Open in IMG/M
3300012418|Ga0138261_1163847All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1856Open in IMG/M
3300012714|Ga0157601_1231526All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1340Open in IMG/M
3300012717|Ga0157609_1011123All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum892Open in IMG/M
3300012722|Ga0157630_1076115All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum862Open in IMG/M
3300012767|Ga0138267_1222733All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1745Open in IMG/M
3300012771|Ga0138270_1006270All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum605Open in IMG/M
3300012920|Ga0160423_10966737All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum570Open in IMG/M
3300012954|Ga0163111_12524395All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum523Open in IMG/M
3300012967|Ga0129343_1023337All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum504Open in IMG/M
3300016693|Ga0180038_1112078All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum594Open in IMG/M
3300016740|Ga0182096_1175529All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1416Open in IMG/M
3300017709|Ga0181387_1118328All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum545Open in IMG/M
3300017731|Ga0181416_1174509All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum520Open in IMG/M
3300017756|Ga0181382_1134899All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum652Open in IMG/M
3300017818|Ga0181565_10774919All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum604Open in IMG/M
3300017951|Ga0181577_10686937All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum624Open in IMG/M
3300018426|Ga0181566_10436277All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum927Open in IMG/M
3300018692|Ga0192944_1003214All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1631Open in IMG/M
3300018766|Ga0193181_1003093All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1663Open in IMG/M
3300018846|Ga0193253_1011037All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1825Open in IMG/M
3300018846|Ga0193253_1016531All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1610Open in IMG/M
3300018848|Ga0192970_1018051All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1268Open in IMG/M
3300018980|Ga0192961_10038577All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1327Open in IMG/M
3300018980|Ga0192961_10120573All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum799Open in IMG/M
3300019032|Ga0192869_10051317All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1384Open in IMG/M
3300019048|Ga0192981_10014389All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum2241Open in IMG/M
3300019051|Ga0192826_10026886All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1678Open in IMG/M
3300019123|Ga0192980_1100509All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum509Open in IMG/M
3300019261|Ga0182097_1500151All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum654Open in IMG/M
3300020048|Ga0207193_1258452All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1304Open in IMG/M
3300020172|Ga0211729_10463641All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1471Open in IMG/M
3300020172|Ga0211729_11478127All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum608Open in IMG/M
3300020205|Ga0211731_11478453All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1782Open in IMG/M
3300020422|Ga0211702_10062067All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1026Open in IMG/M
3300020603|Ga0194126_10831246All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum523Open in IMG/M
3300021169|Ga0206687_1695654All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum2135Open in IMG/M
3300021342|Ga0206691_1800975All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1282Open in IMG/M
3300021350|Ga0206692_1536787All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum521Open in IMG/M
3300021355|Ga0206690_10678098All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani520Open in IMG/M
3300021902|Ga0063086_1007540All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1677Open in IMG/M
3300021910|Ga0063100_1053950All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1466Open in IMG/M
3300021941|Ga0063102_1123585All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum521Open in IMG/M
3300022752|Ga0214917_10179993All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1071Open in IMG/M
3300022929|Ga0255752_10224888All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum854Open in IMG/M
3300023184|Ga0214919_10635942All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum621Open in IMG/M
3300025340|Ga0208866_1010459All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum593Open in IMG/M
3300025357|Ga0208383_1015731All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum921Open in IMG/M
3300025388|Ga0208503_1036419All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum549Open in IMG/M
3300025466|Ga0208497_1095147All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum548Open in IMG/M
3300025640|Ga0209198_1185752All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani541Open in IMG/M
3300025680|Ga0209306_1025522All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum2060Open in IMG/M
3300025680|Ga0209306_1185423All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum574Open in IMG/M
3300025712|Ga0209305_1198515All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum589Open in IMG/M
3300025869|Ga0209308_10176218All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum964Open in IMG/M
3300025887|Ga0208544_10059239All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1825Open in IMG/M
3300025890|Ga0209631_10064645All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum2273Open in IMG/M
3300025890|Ga0209631_10300346All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani777Open in IMG/M
3300026420|Ga0247581_1026890All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum888Open in IMG/M
3300026466|Ga0247598_1142203All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani578Open in IMG/M
3300026495|Ga0247571_1121070All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum612Open in IMG/M
3300026500|Ga0247592_1033793All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1248Open in IMG/M
3300026503|Ga0247605_1023667All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1528Open in IMG/M
3300027757|Ga0208671_10251676All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum628Open in IMG/M
3300027763|Ga0209088_10376552All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum554Open in IMG/M
3300027771|Ga0209279_10290165All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum504Open in IMG/M
3300027833|Ga0209092_10305921All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum859Open in IMG/M
3300027899|Ga0209668_11017802All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum558Open in IMG/M
3300027976|Ga0209702_10123355All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1178Open in IMG/M
3300027983|Ga0209284_10361483All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum722Open in IMG/M
3300028008|Ga0228674_1238214All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum571Open in IMG/M
3300028137|Ga0256412_1033118All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1719Open in IMG/M
3300028137|Ga0256412_1084214All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1144Open in IMG/M
3300028137|Ga0256412_1232474All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum680Open in IMG/M
3300028250|Ga0247560_104534All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum981Open in IMG/M
3300028282|Ga0256413_1062561All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1315Open in IMG/M
3300028282|Ga0256413_1147784All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum852Open in IMG/M
3300028282|Ga0256413_1299214All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum567Open in IMG/M
3300028575|Ga0304731_10514002All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum876Open in IMG/M
3300030699|Ga0307398_10091291All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1466Open in IMG/M
3300030702|Ga0307399_10594304All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum546Open in IMG/M
3300030709|Ga0307400_10663773All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum650Open in IMG/M
3300031522|Ga0307388_10130862All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1428Open in IMG/M
3300031522|Ga0307388_10433299All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum857Open in IMG/M
3300031579|Ga0308134_1096877All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum673Open in IMG/M
3300031710|Ga0307386_10812087All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum505Open in IMG/M
3300031739|Ga0307383_10060715All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1554Open in IMG/M
3300031739|Ga0307383_10139895All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1107Open in IMG/M
3300031739|Ga0307383_10726954All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum507Open in IMG/M
3300031742|Ga0307395_10529623All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum516Open in IMG/M
3300031784|Ga0315899_11745260All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum509Open in IMG/M
3300032092|Ga0315905_11462505All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum539Open in IMG/M
3300032462|Ga0335396_10706464All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum617Open in IMG/M
3300032517|Ga0314688_10192466All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1035Open in IMG/M
3300032521|Ga0314680_10960698All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum535Open in IMG/M
3300032707|Ga0314687_10082905All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1429Open in IMG/M
3300032752|Ga0314700_10611773All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum576Open in IMG/M
3300033572|Ga0307390_11039508All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum520Open in IMG/M
3300034022|Ga0335005_0099045All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1901Open in IMG/M
3300034107|Ga0335037_0729159All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani515Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine17.52%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine10.95%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater9.49%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater5.84%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater5.84%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater5.11%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh4.38%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine4.38%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake2.92%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake2.92%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater2.92%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater2.92%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment2.19%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater2.19%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous2.19%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine2.19%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater2.19%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake1.46%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater1.46%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater1.46%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine1.46%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine1.46%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton0.73%
LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake0.73%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment0.73%
Marine PlanktonEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton0.73%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.73%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.73%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine0.73%
Beach Aquifer PorewaterEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Beach Aquifer Porewater0.73%
Macroalgal SurfaceHost-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface0.73%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000128Marine microbial communities from chronically polluted sediments in Adventfjord, Norway : sample - Svalbard Archipelago station 1 sample NOR 08_45mEnvironmentalOpen in IMG/M
3300001263Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY83Host-AssociatedOpen in IMG/M
3300001355Pelagic Microbial community sample from North Sea - COGITO 998_met_08EnvironmentalOpen in IMG/M
3300001848Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM47, ROCA_DNA265_0.2um_TAP-S_3aEnvironmentalOpen in IMG/M
3300003802Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE29Oct07EnvironmentalOpen in IMG/M
3300003860Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PLEnvironmentalOpen in IMG/M
3300004124Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (version 2)EnvironmentalOpen in IMG/M
3300004684Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE23Jun09 (version 2)EnvironmentalOpen in IMG/M
3300004692Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jun07 (version 2)EnvironmentalOpen in IMG/M
3300004769Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004770Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Aug07EnvironmentalOpen in IMG/M
3300004789Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004790Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006396Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006415Algae and Fungi communities from freshwater lake (pre-blooming) in Auvergne, France - collected by filtering lake water, a 'reference genome' of the lake communityEnvironmentalOpen in IMG/M
3300007200Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Monthly Sampling-Site B) 9 sequencing projectsEnvironmentalOpen in IMG/M
3300007516Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01EnvironmentalOpen in IMG/M
3300007523Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-03EnvironmentalOpen in IMG/M
3300007554Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.709EnvironmentalOpen in IMG/M
3300007722Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-02 (megahit assembly)EnvironmentalOpen in IMG/M
3300007863Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459B_0.2umEnvironmentalOpen in IMG/M
3300008107Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NAEnvironmentalOpen in IMG/M
3300008952Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7umEnvironmentalOpen in IMG/M
3300009071Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405EnvironmentalOpen in IMG/M
3300009182Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaGEnvironmentalOpen in IMG/M
3300009422Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138EnvironmentalOpen in IMG/M
3300009432Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M MetagenomeEnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009441Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M MetagenomeEnvironmentalOpen in IMG/M
3300009538Microbial community of beach aquifer porewater from Cape Shores, Lewes, Delaware, USA - H-2WEnvironmentalOpen in IMG/M
3300009592Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009785Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130EnvironmentalOpen in IMG/M
3300010885northern Canada Lakes Co-assemblyEnvironmentalOpen in IMG/M
3300010981Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 4)EnvironmentalOpen in IMG/M
3300010987Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 6)EnvironmentalOpen in IMG/M
3300012418Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 72hr light incubation - RNA12.A_72.20151113 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012714Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES125 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012717Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES135 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012722Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES163 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012767Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA29.ICE_1m.20151125 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012771Freshwater microbial communities from Lake Croche, Canada - C_130625_E_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012920Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaGEnvironmentalOpen in IMG/M
3300012954Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaGEnvironmentalOpen in IMG/M
3300012967Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016693Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES036 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016740Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041413YT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017709Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27EnvironmentalOpen in IMG/M
3300017731Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16EnvironmentalOpen in IMG/M
3300017756Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22EnvironmentalOpen in IMG/M
3300017818Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017951Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018426Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018692Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782155-ERR1712153)EnvironmentalOpen in IMG/M
3300018766Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000317 (ERX1789428-ERR1719465)EnvironmentalOpen in IMG/M
3300018846Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001299 (ERX1789404-ERR1719503)EnvironmentalOpen in IMG/M
3300018848Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001442 (ERX1789421-ERR1719148)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300019032Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782188-ERR1712216)EnvironmentalOpen in IMG/M
3300019048Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166)EnvironmentalOpen in IMG/M
3300019051Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000064 (ERX1782232-ERR1712227)EnvironmentalOpen in IMG/M
3300019123Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782390-ERR1712195)EnvironmentalOpen in IMG/M
3300019261Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041413BS (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020048Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915EnvironmentalOpen in IMG/M
3300020172Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1EnvironmentalOpen in IMG/M
3300020205Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1EnvironmentalOpen in IMG/M
3300020422Marine prokaryotic communities collected during Tara Oceans survey from station TARA_076 - TARA_B100000513 (ERX555999-ERR599126)EnvironmentalOpen in IMG/M
3300020603Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015035 Kigoma Deep Cast 150mEnvironmentalOpen in IMG/M
3300021169Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021342Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021350Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021355Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 150m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021902Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-1S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021910Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-87M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021941Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-120M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300022752Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BBEnvironmentalOpen in IMG/M
3300022929Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaGEnvironmentalOpen in IMG/M
3300023184Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503EnvironmentalOpen in IMG/M
3300025340Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE20Aug07 (SPAdes)EnvironmentalOpen in IMG/M
3300025357Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Sep07 (SPAdes)EnvironmentalOpen in IMG/M
3300025388Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE31Jul07 (SPAdes)EnvironmentalOpen in IMG/M
3300025466Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Aug07 (SPAdes)EnvironmentalOpen in IMG/M
3300025640Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519 (SPAdes)EnvironmentalOpen in IMG/M
3300025680Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 (SPAdes)EnvironmentalOpen in IMG/M
3300025712Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321 (SPAdes)EnvironmentalOpen in IMG/M
3300025869Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 (SPAdes)EnvironmentalOpen in IMG/M
3300025887Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025890Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes)EnvironmentalOpen in IMG/M
3300026420Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 40R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026466Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 70R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026495Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 24R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026500Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 54R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026503Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 91R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027757Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759 (SPAdes)EnvironmentalOpen in IMG/M
3300027763Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027771Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027833Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027899Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes)EnvironmentalOpen in IMG/M
3300027976Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 (SPAdes)EnvironmentalOpen in IMG/M
3300027983Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-03 (SPAdes)EnvironmentalOpen in IMG/M
3300028008Seawater microbial communities from Monterey Bay, California, United States - 1D_rEnvironmentalOpen in IMG/M
3300028137Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028250Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 8R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028282Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028575Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030699Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030702Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-14 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030709Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-17 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031522Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031579Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1120_Surface (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031710Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031739Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031742Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031784Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112EnvironmentalOpen in IMG/M
3300032092Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121EnvironmentalOpen in IMG/M
3300032462Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-02 (spades assembly)EnvironmentalOpen in IMG/M
3300032517Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032521Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032707Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032752Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300033572Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300034022Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058EnvironmentalOpen in IMG/M
3300034107Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Apr2017-rr0133EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
SA_S1_NOR08_45mDRAFT_1015505313300000128MarineMFFYISGIGSTFFNTEKKNFGIFVGDKVLRLLFPFVVAIFVFLIP
BBAY83_1003492233300001263Macroalgal SurfaceMFFYISGIASTFFDTEKHHYGIFIGGKILRILVPFAIAIFAFLIPRLYFGQ*
JGI20158J14315_1018885113300001355Pelagic MarineMFFYISGVGSTFFKTEEKHFGIFVGDKVLRLLVPFTIAIFVFLIPRLYFGQHYEEWTRP
RCM47_117145113300001848Marine PlanktonMFFYISGIGATFFRTEDKXFGIFVGEKTLRLLVPFVIGIFAFLIPRLYFG*
Ga0007840_100151023300003802FreshwaterMFFYISGMAATFFNTEGKGFGIYFTDKVFRLAVPFVVGIFVFLVPRLYFG*
Ga0031658_105679813300003860Freshwater Lake SedimentMFFYISGIGATFFRTEDKNFGIFVGEKALRLLVPFVIGIFLFLIPRLYFG*
Ga0031658_107276723300003860Freshwater Lake SedimentMAATFFNTEGKGFGIYFTDKVLRLAVPFVVGIFVFLVPRLYFGQ*
Ga0066178_1024623523300004124Freshwater LakeMFFYISGMASTFFNTEGKGFGIYFTDKVLRLAVPFVVGIFVFLVPRLYFGQ*
Ga0065168_101559623300004684FreshwaterMFFYISGIGATFFRTEDKNFGIFVGEKTLRLLVPFVIGIFAFLIPRLYFG*
Ga0065171_103795023300004692FreshwaterMFFYISGMAATFFNTEGKGFGIYFTDKVLRLAVPFVVGIFVFLVPRLYFG*
Ga0007748_1106514013300004769Freshwater LakeMFFYISGIGSTFFKTEEKNFGIFVGDKVLRLLVPFVVAIFVFLIPRLYFGQ*
Ga0007804_106830723300004770FreshwaterFFNTEGKGFGIYFTDKVFRLAVPFVVGIFVFLVPRLYFG*
Ga0007752_1109244423300004789Freshwater LakeFFNTEGKGFGIYFTDKVLRLAVPFVVGIFVFLVPRLYFG*
Ga0007758_1092355913300004790Freshwater LakeMFFYISGIGATFFRTEDKNFGIFVGEKALRLLVPFVIGIFAFLIPRLYFG*
Ga0075493_154435433300006396AqueousMFFYISGIGATFFDTEKKNYGYFVGGKVLRLLLPFVVAIFVFLIPRLYFGQ*
Ga0099654_1055508123300006415LakeMFFYISGMAATFFNTEGKGFGIYFTDKVLRLAVPFVVGIFVFLVPRLYFGQ*
Ga0103273_113586423300007200Freshwater LakeMFFYISGMAATFFNTEGKGFGIYFTDKVLRLAVPFVVGIFVFLIPRLYFG*
Ga0105050_1015684413300007516FreshwaterMFFYISGMGATFFNTEGKGFGIFVGDKLLRLMVPFVLAIFIFLIPRLYFG*
Ga0105050_1089855513300007516FreshwaterYISGIGATFFNTEKNNYGIFVGGKVLRLLVPFVIAIFVFLIPRLYFGQ*
Ga0105052_1010980123300007523FreshwaterVQIGIPKFFYISGIGATFFNTEKNNYGIFVGGKVLRLLVPFVIAIFVFLIPRLYFGQ*
Ga0102820_108678333300007554EstuarineMFFYISGIGSTFFKTEEKNFGIFVGDKVLRLLIPFVVAIFVFLIPRLYFGQQYEDFTRPD
Ga0105051_1009930813300007722FreshwaterVQIGIPMFFYISGIGATFFNTEKNNYGIFVGGKVLRLLVPFVIAIFVFLIPRLYFGQ*
Ga0105744_119828013300007863Estuary WaterIIKCLVQIGIPMFFYISGIGATFFKTEEKNFGIFVGEKALRLLVPFIIGIFVFLIPRLYFG*
Ga0114340_116908013300008107Freshwater, PlanktonPMFFYISGIGATFFRTEDKNFGIFVGEKTLRLLVPFVIGIFAFLIPRLYFG*
Ga0115651_113731423300008952MarineMFFYISGIGATFFNTEKHHYGIFVGGKVLRLLIPFIVAIFVFLIPRLYFGQ*
Ga0115566_1053321713300009071Pelagic MarineMFFYISGIGATFFKTEEKNFGIFVGEKALRLLVPFIIGIFVFLIPRLYFG*
Ga0114959_1052196013300009182Freshwater LakeMFFYISGIGATFFRTEDKNFGIFVGEKTLRLLVPFLIGIFAFLIPRLYFGQ*
Ga0114998_1018137023300009422MarineMFFYISGIGSTFYRTEDKNFGIFIGEKVLRLLVPFILAIFIFLIPRLYFG
Ga0115005_1015251323300009432MarineMFFYISGIGATFFDTEKNHFGVFVGGKVLRLLVPFVVAIFVFLIPRLYFGQ*
Ga0115008_1028849533300009436MarineMFFYISGIASSFYNTESKGFALFLWDKILRLALPFVVGIFVFLIPRLYFG*
Ga0115007_1008721933300009441MarineMFFYISGIASSFYNTEAKGFALFFWDKCLRLAVPFVVGVFIFLIPRLYFG*
Ga0129287_1013109313300009538Beach Aquifer PorewaterMFFYISGIAASFFDTEKHHYGVFIGGKILRILIPFVIAIFAFLIPRLYFG*
Ga0115101_104769423300009592MarineMFFYISGIGATFFKTEDKNFAIFVGEKALRLLVPFIIGIFVFLIPRLYFG*
Ga0115102_1037582523300009606MarineMFFYISGMGATFFNTEGKGFFLFTWNKILRLMIPFVIAIFVFLIPRLYFGQPY
Ga0115001_1046450913300009785MarineMFFYISGIASSYYNTESKGFALFFWDKILRLMIPFILAIFIFLIPRLYLG*
Ga0133913_1188355823300010885Freshwater LakeMFFYISGIGATFFRTEDKNFGIFVGEKTLRLLVPFVIGIFAFLIPRLYFGQ*
Ga0138316_1093938113300010981MarineQIGIPMFFYISGMGTTFTNTERDMAFFRFLWGKILRIAIPFGIAIFVFLMPRLYLG*
Ga0138324_1010229413300010987MarineVKSLVQIGIPMFFYISGMGTTFTNTERDMAFFRFLWGKILRIAIPFGIAIFVFLMPRLYLG*
Ga0138261_116384713300012418Polar MarineMFFYISGIGATFFDTEKNHFGIFVGGKILRLLVPFVVAIFVFLIPRLYFGQ*
Ga0157601_123152623300012714FreshwaterGIPMFFYISGIGATFFRTEDKNFGIFVGEKTLRLLVPFVIGIFAFLIPRLYFG*
Ga0157609_101112323300012717FreshwaterYISGIGATFFRTEDKNFGIFVGEKTLRLLVPFVIGIFAFLIPRLYFG*
Ga0157630_107611523300012722FreshwaterMFFYISGMAATFFNTEGKGFGIYFTDKALRLAVPFVVGIFVFLVPRLYFG*
Ga0138267_122273313300012767Polar MarineMFFYISGIGATFFYTEKNHFGIFVGGKILRLLVPFVVAIFVFLIPRLYFGQ*
Ga0138270_100627013300012771Freshwater LakeATFFNTEGKGFGIYFTDKVLRLAVPFVVGIFVFLVPRLYFGQ*
Ga0160423_1096673713300012920Surface SeawaterMFFYISGMASTYYNTEGRGFGLFLGDKTLRLLLPFVLAIFIFLMPRLYFGQPYEDWC
Ga0163111_1252439523300012954Surface SeawaterMFFYVSGIGSTFFRTEDKNYGIFVGDKVLRLLVPFVVAIFVFLIPRL
Ga0129343_102333713300012967AqueousMFFYISGIGSTFFRTEDKNFGIFVGDKILRLLVPFVVAIFVFLIPRLYFGQTYEDFTRPD
Ga0180038_111207813300016693FreshwaterATFFNTEGKGFGIYFTDKVLRLAVPFVVGIFVFLVPRLYFG
Ga0182096_117552933300016740Salt MarshLVQIGIPMFFYISGIGSTFFNTERDHYGIFVGGKVLRLLVPFIVAIFVFLIPRLYFG
Ga0181387_111832823300017709SeawaterMFFYISGMGATFFNTEGKGFGVFVGDKTLRLGVPFVCAIFIFLIPRLY
Ga0181416_117450923300017731SeawaterMFFYISGIGATFFRTEDKNFAIFVGEKALRLLVPFIAGIF
Ga0181382_113489913300017756SeawaterKSLVQIGIPMFFYISGMAMTFYNTEGKGFGIFLGEKTLRLIVPFAIAIFVFLIPRLYFGQ
Ga0181565_1077491913300017818Salt MarshMFFYISGMGATFFNTEGKGFGNFVGNKVLRLMVPFVIAIFIFLIPRL
Ga0181577_1068693723300017951Salt MarshVQIGIPMFFYISGIGSTFFNTEKNHYGVFVGGKVLRLLVPFVVAIFVFLIPRLYFG
Ga0181566_1043627733300018426Salt MarshMFFYISGIGATFFRTEEKNFGIFVGDKVLRLLIPFIVAIFVFLIPRLYFG
Ga0192944_100321413300018692MarineMFFYISGMGATFYNTEGKGFGSFVGNKVLRLMVPFVVAIFIFLIPRLYFG
Ga0193181_100309323300018766MarineMFFYISGMAMTFYNTEGKGFGVFLGEKSLRLLVPFVLAIFVFLIPRLYFGQ
Ga0193253_101103733300018846MarineMFFYISGIGATFFKTEDKNFAIFVGEKALRLLVPFIIGIFVFLIPRLYFG
Ga0193253_101653123300018846MarineMFFYISGMAMTFYNTEGKGFGVFLGEKSLRLIVPFVLAIFVFLIPRLYFGQ
Ga0192970_101805133300018848MarineTFYNTEAKGFGVFLGEKSLRLLVPFIAAIFIFLIPRLYFG
Ga0192961_1003857713300018980MarineISGMGATFYNTEGKGFGSFVGNKVLRLMVPFVVAIFIFLIPRLYFG
Ga0192961_1012057313300018980MarineMFFYISGIGATFFDTEKSHFGIFVGGKVLRLLVPFVVAIFVFLIPRLYFGQ
Ga0192869_1005131713300019032MarineGIPMFFYVSGIGATFFRTEDKHFGIYIGDKVLRLLVPFVVAIFVFLIPRLYFG
Ga0192981_1001438953300019048MarineMFFYISGIGATFFDTEKNHFGIFVGGKVLRLLVPFVIAIFVFLIPRLYFGQ
Ga0192826_1002688623300019051MarineVQIGIPMFFYISGMASTFFNTEGKGFGLFLGNKTLRLLVPFALAIFVFLIPRLYFGQ
Ga0192980_110050923300019123MarineMFFYISGMGATFFNTEGKGFFLFTWNKILRLMIPFVIAIVVFLIPRL
Ga0182097_150015123300019261Salt MarshMFFYISGIGATFFRTEEKNFGIFVGDKVLRLLIPFIVAIFVFLIPRLYFGQ
Ga0207193_125845213300020048Freshwater Lake SedimentMFFYISGIGATFFRTEDKNFGIFVGEKALRLLVPFVIGIFLFLIPRLYFG
Ga0211729_1046364123300020172FreshwaterMFFYISGMAATFFNTEGKGLVIYFTDKVLRLAVPFVVGIFVFLVPRLYFG
Ga0211729_1147812713300020172FreshwaterMFFYISGIGATFFRTEDKNFGIFVGEKTLRLLVPFVIGIFAFLIPRLYFG
Ga0211731_1147845323300020205FreshwaterMFFYISGMAATFFNTEGKGFGIYFTDKVLRLAVPFVVGIFVFLVPRLYFG
Ga0211702_1006206723300020422MarineMFFYISGMAMTFYNTEGKGFGVFLGEKSLRLVVPFVLAIFIFLIPRLYFG
Ga0194126_1083124613300020603Freshwater LakeMFFYISGIGSTFFRTEDKNFAIFVGEKVLRLLVPFIIGIFVFLIPRLYFGQTYED
Ga0206687_169565413300021169SeawaterMFFYISGIGATFFDTEKNHFGIFVGGKVLRLLVPFVVAIFVFLIPRLYFGQ
Ga0206691_180097513300021342SeawaterMFFYISGIGATFFNTEKHHYGIFVGGKVLRLLIPFVVAIFVFLIPRLYFGQ
Ga0206692_153678723300021350SeawaterMFFYISGMGATFFNTEGKGFGNFIGNKVLRLMVPFVVAIFIFLIPRLYFGQ
Ga0206690_1067809823300021355SeawaterMFFYISGIGSTFFNTERKNYFIFLGEKILRLLIPFIIGIFVFLMPRLYLGQPY
Ga0063086_100754023300021902MarineMFFYISGIASSFYNTESKGFALFLFDKILRLALPFVVGIFIFLIPRLYFG
Ga0063100_105395023300021910MarineMFFYISGIASSFYNTEAKGFALFFWDKCLRLAVPFVVGVFIFLIPRLYFG
Ga0063102_112358513300021941MarineMFFYISGIGATFFDTEKNHFGVFVGGKVLRLLVPFVAAIFIFLIPRLYFGQ
Ga0214917_1017999323300022752FreshwaterMFFYISGIGATFFRTEDKNFGIFVGEKTLRLLVPFVIGIFAFLIPRLYFGQ
Ga0255752_1022488813300022929Salt MarshMFFYISGIGSTFFNTEKNHYGIFVGGKVLRLLVPFVVAIFVFLIPRLYF
Ga0214919_1063594213300023184FreshwaterGIPMFFYISGIGATFFRTEDKNFGIFVGEKTLRLLVPFVIGIFAFLIPRLYFGQ
Ga0208866_101045923300025340FreshwaterMFFYISGMAATFFNTEGKGFGIYFTDKVFRLAVPFVVGIFVFLVPRLYFG
Ga0208383_101573113300025357FreshwaterTFFNTEGKGFGIYFTDKVLRLAVPFVVGIFVFLVPRLYFG
Ga0208503_103641913300025388FreshwaterMFFYISGIGATFFRTEDKNFGIFVGEKTLRLLVPFVIGIFAFLIPRLY
Ga0208497_109514713300025466FreshwaterTFFNTEGKGFGIYFTDKVFRLAVPFVVGIFVFLVPRLYFG
Ga0209198_118575213300025640Pelagic MarineMFFYVSGIGSTFFRTEDKHFGIFVGDKVLRLLVPFVIAIF
Ga0209306_102552243300025680Pelagic MarineMFFYISGIGATFFKTEEKNFGIFVGEKALRLLVPFIIGIFVFLIPRLYFG
Ga0209306_118542313300025680Pelagic MarineMFFYISGMAMTFYNTEAKGFGVFLGEKSLRLLVPFVLAIFVFLIP
Ga0209305_119851523300025712Pelagic MarineMFFYISGMAMTFYNTEAKGFGVFLGEKSLRLLVPFVLAIFVFLIPRLYFG
Ga0209308_1017621833300025869Pelagic MarineMFFYISGIGSTFFKTEEKNFGIFVGDKVLRLLIPFIVAIFVFLIPRLYFGQQYEDFTRPDDQ
Ga0208544_1005923933300025887AqueousMFFYISGIGATFFDTEKKNYGYFVGGKVLRLLLPFVVAIFVFLIPRLYFGQ
Ga0209631_1006464523300025890Pelagic MarineMFFYISGIGATFFDTEKNHFGIFVGGKVLGLLVPFVVAIFVFLIPRLYFGQ
Ga0209631_1030034613300025890Pelagic MarineMFFYISGIGSTFFDTEKSNYGVFVGGKFLRLLLPFILGIFAFLIPRLYLGQQY
Ga0247581_102689013300026420SeawaterIGIPMFFYISGMAMTFYNTEGKGFGVFLGEKSLRLIVPFVLAIFVFLIPRLYFGQ
Ga0247598_114220323300026466SeawaterMFFYISGIGSTFFRTEDKNFGIFVGDKVLRLLIPFTLAIFIFLIPRLYFGQ
Ga0247571_112107013300026495SeawaterIVKSLVQIGIPMFFYISGMAMTFYNTEGKGFGIFLGEKTLRLIVPFAIAIFVFLIPRLYFGQ
Ga0247592_103379313300026500SeawaterPMFFYISGMAMTFYNTEGKGFGVFLGEKSLRLIVPFVLAIFVFLIPRLYFGQ
Ga0247605_102366713300026503SeawaterMFFYISGMAMTFYNTEGKGFGVFLEEKSLRLIVPFVLAIFVFLIPRLYFGQ
Ga0208671_1025167613300027757EstuarineMFFYISGMGATFFNTEGKGFGNFVGNKTLRLMVPFFIAIFVFLIPRLY
Ga0209088_1037655223300027763Freshwater LakeMFFYISGMAATFFNTEGKGFGIYFTDKVLRLAVPFVVGIFVFLVPRLYFGQ
Ga0209279_1029016513300027771MarineMFFYISGMGATFFNTEGKGFFLFTWNKILRLLIPFVVAIFVFLI
Ga0209092_1030592133300027833MarineMFFYISGIASSFYNTESKGFALFLWDKILRLALPFVVGIFVFLIPRLYFG
Ga0209668_1101780223300027899Freshwater Lake SedimentFYISGIGATFFRTEDKNFGIFVGEKTLRLLVPFVIGIFAFLIPRLYFG
Ga0209702_1012335523300027976FreshwaterMFFYISGMGATFFNTEGKGFGIFVGDKLLRLMVPFVLAIFIFLIPRLYFG
Ga0209284_1036148313300027983FreshwaterYISGMGATFFNTEGKGFGIFVGDKLLRLMVPFVLAIFIFLIPRLYFG
Ga0228674_123821413300028008SeawaterIVKSLVQIGIPMFFYISGMAATFYNTEGKGFALFLGEKSLRLLVPFALAIFIFLIPRLYF
Ga0256412_103311833300028137SeawaterMFFYISGIGSTFFRTEDKNYGIFVGDKVLRLLVPFTLAIFIFLIPRLYFGQ
Ga0256412_108421413300028137SeawaterMFFYISGIGATFFKTEEKNFGIFVGEKALRLLVPFILGIFIFLIPRLYFG
Ga0256412_123247413300028137SeawaterMFFYVSGIGATFFRTEEKNFGIFVGDKILRLLVPFVIAIFVFLIPRLYFG
Ga0247560_10453413300028250SeawaterMFFYISGIGATFFDTEKNHFGIFVGGKFLRLLVPFVFAIFVFLIPRLYFGQ
Ga0256413_106256113300028282SeawaterMFFYISGMAMTFYNTEGKGFGIFLGEKSLRLLVPFVLAIFVFLIPRLYFG
Ga0256413_114778423300028282SeawaterMFFYISGIASSFYNTEAKGFTLFVWDKILRLAVPFVVAIFIFLIPRLYFG
Ga0256413_129921423300028282SeawaterPMFFYVSGIGATFFRTEDKHFGIYIGDKVLRLLVPFVVAIFVFLIPRLYFGQ
Ga0304731_1051400213300028575MarineQIGIPMFFYISGMGTTFTNTERDMAFFRFLWGKILRIAIPFGIAIFVFLMPRLYLG
Ga0307398_1009129123300030699MarineMFFYVSGMAATFFNTEGKGFGIFFWDKCLRILIPFIAAIFIFLMPRLYIG
Ga0307399_1059430413300030702MarineMFFYISGIGATFFDTEKNHFGIFVGGKVLRLLVPFVI
Ga0307400_1066377313300030709MarineMFFYISGIGSAFFNTESKGFALFFWEKVLRLAVPFVIGIFVFLIPRLYFG
Ga0307388_1013086233300031522MarinePMFFYISGIASSFYNTEAKGFALFIWEKILRLAIPFVVAIFIFLIPRLYFG
Ga0307388_1043329913300031522MarineMFFYISGMAATFFNTEGKGFGIFFWDKCLRILIPFIIAIFVFLMPRIYLG
Ga0308134_109687713300031579MarineMFGLNRIPMFFYISGIGATFFDTEKNHFGVFVGGKVLRLLVPFVAAIFIFLIPRLYFGQ
Ga0307386_1081208713300031710MarineMFFYISGMGATFFNTEGKGFFLFTWNKILRLMIPFAIAIFIFLIPRLYFGQPYEDWCR
Ga0307383_1006071543300031739MarineMFFYISGMAMTFYNTEAKGFGVFLGEKSLRLLVPFIAAIFIFLIPRLYFG
Ga0307383_1013989513300031739MarineMFFYISGIGTAFYNTEKKGFAMFFIDKVLRLAIPFFLGMFIFLIPRLYFG
Ga0307383_1072695413300031739MarineFFNTEGKGFGIFFWDKCLRILIPFVIAIFVFLMPRIYLG
Ga0307395_1052962313300031742MarineFYISGIASSYYNTESKGFALFFWDKILRLIIPFIFAIFIFLIPRLYLG
Ga0315899_1174526013300031784FreshwaterMFFYISGIGSTFFRTEDKNFAIFVGEKVLRLLVPFIIGIFVFLIPRLYFG
Ga0315905_1146250523300032092FreshwaterMFFYISGIGATFFRTEDKNFGIFVGEKTLRLLVPFVIGIFAFL
Ga0335396_1070646413300032462FreshwaterMFFYISGIGATFFNTEKNNYGIFVGGKVLRLLVPFVIAIFVFLIPRLYFGQ
Ga0314688_1019246623300032517SeawaterFFYISGIGSTFYRTEDKNFGIFVAEKVLRLLVPFILAIFIFLIPRLYFG
Ga0314680_1096069823300032521SeawaterYISGMASTFFNTEAKGFGIFFWDKCLRILIPFIVAIFVFLIPRLYIGQ
Ga0314687_1008290543300032707SeawaterGIPMFFYISGIGATFFKTEEKNFGIFVGEKALRLLVPFIIGIFVFLIPRLYFG
Ga0314700_1061177313300032752SeawaterTFFNTEGKGFGLFFYDKCLRILLPFIVGIFVFLMPRIYLGQQY
Ga0307390_1103950813300033572MarineYISGIGSTFFNTEKSHFGIFLGGKVLRLIVPFIVAIFVFLIPRLYFGQ
Ga0335005_0099045_1345_15003300034022FreshwaterMFFYISGIGATFFKTEEKNFGIFVGDKVLRLLVPFVVAIFVFLIPRLYFGQ
Ga0335037_0729159_347_5143300034107FreshwaterMFFYISGIGSTFFRTEDKNFAIFVGEKVLRLLVPFIIGIFVFLIPRLYFGQTYEDW

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.