Basic Information | |
---|---|
Family ID | F056456 |
Family Type | Metagenome |
Number of Sequences | 137 |
Average Sequence Length | 43 residues |
Representative Sequence | VPTPPPGGSPAWSGTYTYTSSSTGTFSITANGDGTTITVP |
Number of Associated Samples | 113 |
Number of Associated Scaffolds | 137 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.74 % |
% of genes near scaffold ends (potentially truncated) | 97.81 % |
% of genes from short scaffolds (< 2000 bps) | 89.05 % |
Associated GOLD sequencing projects | 103 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.38 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (85.401 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (31.387 % of family members) |
Environment Ontology (ENVO) | Unclassified (39.416 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (42.336 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 20.59% Coil/Unstructured: 79.41% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 137 Family Scaffolds |
---|---|---|
PF00496 | SBP_bac_5 | 13.14 |
PF13633 | Obsolete Pfam Family | 10.22 |
PF07963 | N_methyl | 6.57 |
PF13544 | Obsolete Pfam Family | 4.38 |
PF06750 | DiS_P_DiS | 2.92 |
PF01314 | AFOR_C | 2.92 |
PF08334 | T2SSG | 2.92 |
PF00072 | Response_reg | 0.73 |
PF13191 | AAA_16 | 0.73 |
PF04392 | ABC_sub_bind | 0.73 |
PF02852 | Pyr_redox_dim | 0.73 |
PF14022 | DUF4238 | 0.73 |
PF00902 | TatC | 0.73 |
PF00805 | Pentapeptide | 0.73 |
PF00211 | Guanylate_cyc | 0.73 |
PF00528 | BPD_transp_1 | 0.73 |
PF04173 | DoxD | 0.73 |
PF02730 | AFOR_N | 0.73 |
PF01695 | IstB_IS21 | 0.73 |
PF03631 | Virul_fac_BrkB | 0.73 |
PF00821 | PEPCK_GTP | 0.73 |
PF08402 | TOBE_2 | 0.73 |
PF02738 | MoCoBD_1 | 0.73 |
PF08241 | Methyltransf_11 | 0.73 |
PF07690 | MFS_1 | 0.73 |
PF03928 | HbpS-like | 0.73 |
PF01068 | DNA_ligase_A_M | 0.73 |
PF12019 | GspH | 0.73 |
PF04350 | PilO | 0.73 |
PF01370 | Epimerase | 0.73 |
PF00112 | Peptidase_C1 | 0.73 |
COG ID | Name | Functional Category | % Frequency in 137 Family Scaffolds |
---|---|---|---|
COG1989 | Prepilin signal peptidase PulO (type II secretory pathway) or related peptidase | Cell motility [N] | 8.76 |
COG2414 | Aldehyde:ferredoxin oxidoreductase | Energy production and conversion [C] | 3.65 |
COG3167 | Type IV pilus assembly protein PilO | Cell motility [N] | 1.46 |
COG0805 | Twin-arginine protein secretion pathway component TatC | Intracellular trafficking, secretion, and vesicular transport [U] | 0.73 |
COG1274 | Phosphoenolpyruvate carboxykinase, GTP-dependent | Energy production and conversion [C] | 0.73 |
COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 0.73 |
COG1357 | Uncharacterized conserved protein YjbI, contains pentapeptide repeats | Function unknown [S] | 0.73 |
COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 0.73 |
COG1484 | DNA replication protein DnaC | Replication, recombination and repair [L] | 0.73 |
COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.73 |
COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.73 |
COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 0.73 |
COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.73 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 85.40 % |
Unclassified | root | N/A | 14.60 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300004267|Ga0066396_10087436 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
3300005178|Ga0066688_10696957 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
3300005332|Ga0066388_100346701 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2131 | Open in IMG/M |
3300005332|Ga0066388_106787370 | Not Available | 576 | Open in IMG/M |
3300005445|Ga0070708_102270082 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 501 | Open in IMG/M |
3300005446|Ga0066686_10919162 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 573 | Open in IMG/M |
3300005468|Ga0070707_101313928 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 689 | Open in IMG/M |
3300005557|Ga0066704_10893520 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 549 | Open in IMG/M |
3300005558|Ga0066698_10401868 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 941 | Open in IMG/M |
3300005559|Ga0066700_10150606 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1576 | Open in IMG/M |
3300005561|Ga0066699_10006443 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 5349 | Open in IMG/M |
3300005563|Ga0068855_101662788 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 652 | Open in IMG/M |
3300005568|Ga0066703_10287210 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 996 | Open in IMG/M |
3300005569|Ga0066705_10815743 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 556 | Open in IMG/M |
3300005598|Ga0066706_11489399 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 509 | Open in IMG/M |
3300005764|Ga0066903_106208192 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
3300005841|Ga0068863_101106665 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 797 | Open in IMG/M |
3300005842|Ga0068858_102571858 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300006796|Ga0066665_11040916 | Not Available | 626 | Open in IMG/M |
3300006800|Ga0066660_10911358 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 715 | Open in IMG/M |
3300006846|Ga0075430_101288688 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
3300006871|Ga0075434_101456124 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 694 | Open in IMG/M |
3300007255|Ga0099791_10160079 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1054 | Open in IMG/M |
3300007265|Ga0099794_10436005 | Not Available | 686 | Open in IMG/M |
3300009038|Ga0099829_10817347 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 774 | Open in IMG/M |
3300009088|Ga0099830_11016304 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 687 | Open in IMG/M |
3300009088|Ga0099830_11223749 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 624 | Open in IMG/M |
3300009089|Ga0099828_11692548 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 556 | Open in IMG/M |
3300009090|Ga0099827_11252323 | Not Available | 645 | Open in IMG/M |
3300009092|Ga0105250_10314820 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Phycicoccus → Phycicoccus elongatus → Phycicoccus elongatus Lp2 | 679 | Open in IMG/M |
3300009098|Ga0105245_12299334 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 593 | Open in IMG/M |
3300009137|Ga0066709_102583068 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 681 | Open in IMG/M |
3300009162|Ga0075423_12583296 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 555 | Open in IMG/M |
3300009176|Ga0105242_12012572 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
3300009792|Ga0126374_11206118 | Not Available | 606 | Open in IMG/M |
3300010046|Ga0126384_11136042 | Not Available | 718 | Open in IMG/M |
3300010048|Ga0126373_10894104 | All Organisms → cellular organisms → Bacteria | 952 | Open in IMG/M |
3300010301|Ga0134070_10114258 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 949 | Open in IMG/M |
3300010320|Ga0134109_10266143 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
3300010320|Ga0134109_10351785 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 579 | Open in IMG/M |
3300010325|Ga0134064_10109332 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 918 | Open in IMG/M |
3300010336|Ga0134071_10133005 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1202 | Open in IMG/M |
3300010358|Ga0126370_10382962 | All Organisms → cellular organisms → Bacteria | 1149 | Open in IMG/M |
3300010358|Ga0126370_11769939 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
3300010359|Ga0126376_11203700 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 772 | Open in IMG/M |
3300010359|Ga0126376_12555450 | Not Available | 559 | Open in IMG/M |
3300010366|Ga0126379_11432807 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 797 | Open in IMG/M |
3300010376|Ga0126381_103986039 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
3300010398|Ga0126383_10057234 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 3282 | Open in IMG/M |
3300010398|Ga0126383_10070019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3012 | Open in IMG/M |
3300010398|Ga0126383_11631742 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 734 | Open in IMG/M |
3300010398|Ga0126383_12919179 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
3300010403|Ga0134123_11584161 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → Paenibacillus → Paenibacillus baekrokdamisoli | 702 | Open in IMG/M |
3300011269|Ga0137392_11457052 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 544 | Open in IMG/M |
3300011269|Ga0137392_11552774 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 521 | Open in IMG/M |
3300011271|Ga0137393_10372315 | All Organisms → cellular organisms → Bacteria | 1222 | Open in IMG/M |
3300012096|Ga0137389_10275562 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1419 | Open in IMG/M |
3300012189|Ga0137388_10274559 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1540 | Open in IMG/M |
3300012189|Ga0137388_10994173 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 774 | Open in IMG/M |
3300012189|Ga0137388_11808563 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
3300012199|Ga0137383_10665400 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 761 | Open in IMG/M |
3300012201|Ga0137365_10079089 | All Organisms → cellular organisms → Bacteria | 2479 | Open in IMG/M |
3300012201|Ga0137365_10306697 | All Organisms → cellular organisms → Bacteria | 1176 | Open in IMG/M |
3300012203|Ga0137399_11550932 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 550 | Open in IMG/M |
3300012204|Ga0137374_11080855 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
3300012206|Ga0137380_10460224 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1124 | Open in IMG/M |
3300012206|Ga0137380_11365554 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae | 593 | Open in IMG/M |
3300012207|Ga0137381_10644872 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 922 | Open in IMG/M |
3300012207|Ga0137381_10828679 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 801 | Open in IMG/M |
3300012208|Ga0137376_11276671 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
3300012209|Ga0137379_10386416 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1309 | Open in IMG/M |
3300012209|Ga0137379_11606385 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 549 | Open in IMG/M |
3300012353|Ga0137367_10175182 | Not Available | 1560 | Open in IMG/M |
3300012357|Ga0137384_11125342 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 628 | Open in IMG/M |
3300012359|Ga0137385_10191333 | All Organisms → cellular organisms → Bacteria | 1789 | Open in IMG/M |
3300012363|Ga0137390_11024791 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 777 | Open in IMG/M |
3300012517|Ga0157354_1075599 | Not Available | 536 | Open in IMG/M |
3300012917|Ga0137395_10590575 | Not Available | 802 | Open in IMG/M |
3300012925|Ga0137419_10243952 | Not Available | 1351 | Open in IMG/M |
3300012948|Ga0126375_11142981 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 644 | Open in IMG/M |
3300012971|Ga0126369_13279033 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
3300012976|Ga0134076_10112994 | All Organisms → cellular organisms → Bacteria | 1087 | Open in IMG/M |
3300015371|Ga0132258_12442969 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1308 | Open in IMG/M |
3300016270|Ga0182036_10032141 | All Organisms → cellular organisms → Bacteria | 3134 | Open in IMG/M |
3300016341|Ga0182035_11813915 | Not Available | 552 | Open in IMG/M |
3300018000|Ga0184604_10333742 | Not Available | 538 | Open in IMG/M |
3300018059|Ga0184615_10062113 | All Organisms → cellular organisms → Bacteria | 2084 | Open in IMG/M |
3300018468|Ga0066662_11834094 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
3300025160|Ga0209109_10051855 | All Organisms → cellular organisms → Bacteria | 2177 | Open in IMG/M |
3300025164|Ga0209521_10280455 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 956 | Open in IMG/M |
3300025318|Ga0209519_10629232 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
3300025325|Ga0209341_10264736 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Marmoricola → unclassified Marmoricola → Marmoricola sp. Leaf446 | 1422 | Open in IMG/M |
3300025326|Ga0209342_10992448 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 641 | Open in IMG/M |
3300025327|Ga0209751_10012872 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 7457 | Open in IMG/M |
3300025327|Ga0209751_11192118 | Not Available | 558 | Open in IMG/M |
3300025538|Ga0210132_1049485 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
3300025560|Ga0210108_1045574 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
3300025922|Ga0207646_11426545 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 601 | Open in IMG/M |
3300026035|Ga0207703_10432378 | All Organisms → cellular organisms → Bacteria | 1227 | Open in IMG/M |
3300026309|Ga0209055_1025059 | All Organisms → cellular organisms → Bacteria | 2805 | Open in IMG/M |
3300026318|Ga0209471_1336523 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 500 | Open in IMG/M |
3300026333|Ga0209158_1031333 | All Organisms → cellular organisms → Bacteria | 2297 | Open in IMG/M |
3300026371|Ga0257179_1016400 | Not Available | 827 | Open in IMG/M |
3300026494|Ga0257159_1059989 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 650 | Open in IMG/M |
3300026507|Ga0257165_1115159 | Not Available | 502 | Open in IMG/M |
3300026514|Ga0257168_1075555 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 745 | Open in IMG/M |
3300026528|Ga0209378_1309159 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 507 | Open in IMG/M |
3300026532|Ga0209160_1167681 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 959 | Open in IMG/M |
3300026536|Ga0209058_1149630 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1098 | Open in IMG/M |
3300026540|Ga0209376_1256772 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 742 | Open in IMG/M |
3300026548|Ga0209161_10363291 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 644 | Open in IMG/M |
3300027655|Ga0209388_1061481 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1083 | Open in IMG/M |
3300027846|Ga0209180_10630150 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
3300027846|Ga0209180_10811337 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 500 | Open in IMG/M |
3300027862|Ga0209701_10402284 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 763 | Open in IMG/M |
3300027875|Ga0209283_10091662 | All Organisms → cellular organisms → Bacteria | 1980 | Open in IMG/M |
3300027875|Ga0209283_10269712 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1127 | Open in IMG/M |
3300027882|Ga0209590_10487397 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 796 | Open in IMG/M |
3300027882|Ga0209590_10731446 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
3300027882|Ga0209590_10796893 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 600 | Open in IMG/M |
3300027882|Ga0209590_10958651 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 536 | Open in IMG/M |
3300031545|Ga0318541_10035169 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2510 | Open in IMG/M |
3300031640|Ga0318555_10717459 | Not Available | 540 | Open in IMG/M |
3300031682|Ga0318560_10574340 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 611 | Open in IMG/M |
3300031751|Ga0318494_10202943 | Not Available | 1130 | Open in IMG/M |
3300031770|Ga0318521_10048072 | All Organisms → cellular organisms → Bacteria | 2189 | Open in IMG/M |
3300031770|Ga0318521_10204049 | Not Available | 1143 | Open in IMG/M |
3300031820|Ga0307473_10249796 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1087 | Open in IMG/M |
3300032039|Ga0318559_10342004 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
3300032174|Ga0307470_11297402 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
3300032180|Ga0307471_100878822 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylovulum → Methylovulum psychrotolerans | 1063 | Open in IMG/M |
3300032205|Ga0307472_102194252 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 557 | Open in IMG/M |
3300032205|Ga0307472_102439079 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 531 | Open in IMG/M |
3300032401|Ga0315275_10064107 | All Organisms → cellular organisms → Bacteria | 3957 | Open in IMG/M |
3300033807|Ga0314866_034188 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 793 | Open in IMG/M |
3300034125|Ga0370484_0173659 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 31.39% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 13.87% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 10.95% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.03% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.38% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.65% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.92% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 2.92% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.19% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.19% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.19% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.19% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.46% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.46% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.46% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.46% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.46% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.73% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.73% |
Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.73% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.73% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.73% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.73% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.73% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.73% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300004267 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio | Environmental | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012517 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.6.yng.070610 | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
3300018059 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coex | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300025160 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2 | Environmental | Open in IMG/M |
3300025164 | Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 4 | Environmental | Open in IMG/M |
3300025318 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 1 | Environmental | Open in IMG/M |
3300025325 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 (SPAdes) | Environmental | Open in IMG/M |
3300025326 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_2 (SPAdes) | Environmental | Open in IMG/M |
3300025327 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1 (SPAdes) | Environmental | Open in IMG/M |
3300025538 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025560 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
3300026371 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-B | Environmental | Open in IMG/M |
3300026494 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-A | Environmental | Open in IMG/M |
3300026507 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-B | Environmental | Open in IMG/M |
3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
3300033807 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_10 | Environmental | Open in IMG/M |
3300034125 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0066396_100874362 | 3300004267 | Tropical Forest Soil | TNGLNQVAGPFMANVPHPPPGGTPVWSAYAYNSTTAGTFTITANGDNTTITVP* |
Ga0066688_106969572 | 3300005178 | Soil | VPTPPPGGSPAWLSTYTYTSSSTGTFSVTASGDGTTITAQ* |
Ga0066388_1003467011 | 3300005332 | Tropical Forest Soil | MASVPNPPSGGSPAWGAYTYTSSTTGTFSITNMGDGTTVTAP* |
Ga0066388_1067873702 | 3300005332 | Tropical Forest Soil | SAGPFVTSIPMLPPGGSPAWGAAYTYTSSTVGTFSITVWGDGTKITATGDGTTVTAP* |
Ga0070708_1022700821 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VPPPGGSPAWGGAYTYTPNAGAGTFTVSATGDGTTITVP* |
Ga0066686_109191621 | 3300005446 | Soil | NGLGQSAGPFVARVPTPPPGGSPAWSGTYTYTSSSTGTFSVTANGDGTTITVP* |
Ga0070707_1013139282 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | NQSAGPFMASVPAPPPGGTPAWGAYAYASSTAGTFTITATGDGTTITVP* |
Ga0066704_108935202 | 3300005557 | Soil | FVARVPTPPPGGSPAWSGTYTYTSSSTGTFSISANGDGTTITVP* |
Ga0066698_104018681 | 3300005558 | Soil | PPGGSPAWGGAYTYTPNAGAGTFTVSATGDGTTITVP* |
Ga0066700_101506061 | 3300005559 | Soil | LGQAAGPFMARVPTPPPGGSPAWSGTYTYTSSSTGTFSVTANGDGTTITVP* |
Ga0066699_100064436 | 3300005561 | Soil | PGGGSPAWSGTYTYTSSSTGTFSVTANGDGTTITFP* |
Ga0068855_1016627881 | 3300005563 | Corn Rhizosphere | VPPPGGSPAWGANYTYAPNAGAGTFTVSATGDGTTVTVP* |
Ga0066703_102872101 | 3300005568 | Soil | TPPPGGSPAWSGTYTYTSSSTGTFSVTANGDGTTITVP* |
Ga0066705_108157431 | 3300005569 | Soil | TPPPGGSPAWSGTYTYTSSSTGTFSVTANGDGTTITMQ* |
Ga0066706_114893991 | 3300005598 | Soil | NGLGQSAGPFVARVPTPPPGGSPAWSGTYTYTSSSTGTFSITANGDGTTITIP* |
Ga0066903_1062081922 | 3300005764 | Tropical Forest Soil | GALQVPQGGTPAWGAYTYTSSTAGTFRIDVAGDGTTITAP* |
Ga0068863_1011066652 | 3300005841 | Switchgrass Rhizosphere | VPVPPPGGSPAWGANYTYAPNAGAGTFTVSATGDGTTVTVP* |
Ga0068858_1025718582 | 3300005842 | Switchgrass Rhizosphere | PPPGGSPAWGANYTYTPNAAAGTFVVTATGDSTTITVP* |
Ga0066665_110409162 | 3300006796 | Soil | PFIARIPTPPGGGSPAWSGTYTYTSSSTGTFSVTANGDGTTITFP* |
Ga0066660_109113581 | 3300006800 | Soil | GLGQSAGPFVARVPTPPPGGSPAWSGTYTYTSSSTGTFSITANGDGTTITVP* |
Ga0075430_1012886881 | 3300006846 | Populus Rhizosphere | PPSGGSPAWSSSYTYTSTTSGSFSVTANGDGVTVVAP* |
Ga0075434_1014561242 | 3300006871 | Populus Rhizosphere | GPFVARVPTPPPGGSPAWSGTYTYTSSSTGTFSITANGDGTTITVP* |
Ga0099791_101600791 | 3300007255 | Vadose Zone Soil | LTDLTQQTANGLGQNAGPFIARVPTPPPGGSPAWSGTYTYTSSSTGTFSVTANGDGTTITVP* |
Ga0099794_104360052 | 3300007265 | Vadose Zone Soil | PTPPGGGAPAWSATYTYTSSSTGTFSITANGDSTTITYP* |
Ga0099829_108173472 | 3300009038 | Vadose Zone Soil | MANVPTPPPGGSPAWSGAYTYTSSSTGTFSITANGDGTTVTVP* |
Ga0099830_110163043 | 3300009088 | Vadose Zone Soil | PPGGSPAWSGTYTYTSSSTGTFSITANGDGTTITVP* |
Ga0099830_112237491 | 3300009088 | Vadose Zone Soil | MARIPTPPPGGSPAWSGAYTYTSSTTGTFSVTANGDGTTITVP* |
Ga0099828_116925482 | 3300009089 | Vadose Zone Soil | PPPGGSPAWSGAYTYTSSTTGTFSVTANGDGTTITVP* |
Ga0099827_112523232 | 3300009090 | Vadose Zone Soil | GGSPAWSGAYTYTSSTTGTFSVTANGDGTTITVP* |
Ga0105250_103148202 | 3300009092 | Switchgrass Rhizosphere | PTPPATWSATYTYVANQAAGTFSISATGDSTTITVP* |
Ga0105245_122993341 | 3300009098 | Miscanthus Rhizosphere | PGGSPAWGATYTYTPNAAAGTFSISATGDGTTITVP* |
Ga0066709_1025830682 | 3300009137 | Grasslands Soil | SVPTPPPSGSPAWSGTYTYTSSTTGTFSVTANGDGTTITVQ* |
Ga0075423_125832962 | 3300009162 | Populus Rhizosphere | QVAGPFMARIPTPPPGGSPAWSGTYTYTSSSTGTFSVTANGDGTTITVP* |
Ga0105242_120125722 | 3300009176 | Miscanthus Rhizosphere | MGSIPVPPTGGSPAWGNSYTYTPNAATGTFVVTATGDNTTNTVP* |
Ga0126374_112061181 | 3300009792 | Tropical Forest Soil | ERRTFRVFSPAPPWGGSPAWGAYTYTWSTAGTFSIIAIGDGTTVTAP* |
Ga0126384_111360422 | 3300010046 | Tropical Forest Soil | FVTSIPHPPLGGSPAWGAYTYTSSTAGTFSIIATGDGTTVTAP* |
Ga0126373_108941043 | 3300010048 | Tropical Forest Soil | WGAYTYTSSTAGTFRIDVAGDGTTITATGDGTTITAP* |
Ga0134070_101142582 | 3300010301 | Grasslands Soil | PFVARVPTPPPGGSPAWSGTYTYTSSSTGTFSVTANGDGTTITVP* |
Ga0134109_102661433 | 3300010320 | Grasslands Soil | QAAGPFVARVPTPPPGGSPAWSGTYTYTSSSTGTFSVTANGDGTTITVP* |
Ga0134109_103517851 | 3300010320 | Grasslands Soil | FVARVPTPPPGGSPAWSGTYTYTSSSTGTFSITANGDGTTITVP* |
Ga0134064_101093322 | 3300010325 | Grasslands Soil | VPTPPPGGSPAWSGTYTYTSSSTGTFSITANGDGTTITVP* |
Ga0134071_101330053 | 3300010336 | Grasslands Soil | GTVPVPPPGGSPAWGAAYTYTPNAGAGTFSVTATGDGTTVTVP* |
Ga0126370_103829623 | 3300010358 | Tropical Forest Soil | AQIPVPPPGGTPGWGGAYTYTSSTAGTFSITATGDGTTVTSP* |
Ga0126370_117699392 | 3300010358 | Tropical Forest Soil | GPFMASVPSPPPGGSPAWGTYTYTSSTAGTFSIVATGDGTTITVP* |
Ga0126376_112037001 | 3300010359 | Tropical Forest Soil | PQPPPGGSPVWSAYAYNSTTAGTFTITANGDNTTITVP* |
Ga0126376_125554501 | 3300010359 | Tropical Forest Soil | ERAGPFTDSVPHPPLGGTPPWGSYTFTSSSTGTFSIMAVGDGTTFVVP* |
Ga0126379_114328071 | 3300010366 | Tropical Forest Soil | PLIPVPPRGGTPAWSAAYTYTSSTTGTFSITAAGDGTTVTAP* |
Ga0126381_1039860391 | 3300010376 | Tropical Forest Soil | PPPGGSPAWGGAYTYTSSTAGTFSITATGDGTTVTVP* |
Ga0126383_100572341 | 3300010398 | Tropical Forest Soil | WVPRPPSGGTPAWGAYTYTSSTAGTFSVTASGDGTTITLP* |
Ga0126383_100700191 | 3300010398 | Tropical Forest Soil | IPHPPLGGSPAWGAYTYTSSTAGTFSIIATGDGTTVTAP* |
Ga0126383_116317422 | 3300010398 | Tropical Forest Soil | FMASIPNPPPGGSPAWGGNYTYTSSTAGTFSITATGDGTTITVP* |
Ga0126383_129191791 | 3300010398 | Tropical Forest Soil | SVPQPPPGGSPAWGAYTYTSSTAGTFSIVATGDGTTITVP* |
Ga0134123_115841611 | 3300010403 | Terrestrial Soil | PGGSPAWGASYTYTPNAGAGTFTVAATGDGTTITMP* |
Ga0137392_114570521 | 3300011269 | Vadose Zone Soil | LGQNAGPFIARVPTPPPGGSPAWSGTYTYTSSSTGTFSVTANGDGTTITVP* |
Ga0137392_115527742 | 3300011269 | Vadose Zone Soil | PFMASVPAPPPGGTPAWGAYAYASSTAGTFTVTATGDGTTITVP* |
Ga0137393_103723151 | 3300011271 | Vadose Zone Soil | IPAPGGSPAWSGTYTYTSSSTGTFSITATGDGTTITIP* |
Ga0137389_102755621 | 3300012096 | Vadose Zone Soil | PPPGGTPAWGAYAYASSTAGTFTITATGDGTTITVP* |
Ga0137388_102745591 | 3300012189 | Vadose Zone Soil | ATVPAPPPGGTPPWGAYAYASSSTGTFVVTATGDGTTITLP* |
Ga0137388_109941731 | 3300012189 | Vadose Zone Soil | PIPAPGGSPAWSGTYTYTSGSTGTFSITATGDGTTITVP* |
Ga0137388_118085631 | 3300012189 | Vadose Zone Soil | PPGGSPAWSGAYTYTSSTTGTFSVTANGDGTTITVP* |
Ga0137388_118172291 | 3300012189 | Vadose Zone Soil | NLTDLTQQTANGLGQNAGPFIARVPAVPPGGSPAWAGYTYTSSSAGTFSVTANGDGTTITVP* |
Ga0137383_106654001 | 3300012199 | Vadose Zone Soil | VNDRNQSAGPFIATVPPPPYGGTPAWGAYAYTSSSTGTFSVTAIGDGTTITVP* |
Ga0137365_100790891 | 3300012201 | Vadose Zone Soil | TPPPSGSPAWSGTYTYTSSSTGTFSVTANGDGTTITVQ* |
Ga0137365_103066973 | 3300012201 | Vadose Zone Soil | PAPPPGGSPAWSGTYTYTSSSTGTFSITANGDGTTITVP* |
Ga0137399_115509321 | 3300012203 | Vadose Zone Soil | TAGPFMANVPNPPPGGSPAWGAYAYTSSTAGTFSITATGDGTTITVP* |
Ga0137374_110808551 | 3300012204 | Vadose Zone Soil | MASVPAPPAGGTPAWGVYGYTTNANGTFTVTATGDGTTITVP* |
Ga0137380_104602241 | 3300012206 | Vadose Zone Soil | QSAGPFVARVPTPPPGGSPAWSGTYTYTSSSTGTFSITANGDGTTITVP* |
Ga0137380_113655541 | 3300012206 | Vadose Zone Soil | LNQSAGPFMAAVPAPPPGGTPAWGAYAYASSTAGTFTITATGDGTTITVP* |
Ga0137381_106448722 | 3300012207 | Vadose Zone Soil | GQSAGPFVARVPTPPPGGSPAWSGTYTYTSSSTGTFSVTANGDGTTITVP* |
Ga0137381_108286792 | 3300012207 | Vadose Zone Soil | LGQSAGPFVARVPTPPPGGSPAWSGTYTYTSSSTGTFSITANGDGTTITIP* |
Ga0137376_112766711 | 3300012208 | Vadose Zone Soil | FVARVPTPPPGGSPAWSGTYTYTSSSTGTFSVTANGDGTTITVP* |
Ga0137379_103864161 | 3300012209 | Vadose Zone Soil | PPPGGSPTWSGTYAYTSSSTGTFSVTANGDGTTITMQ* |
Ga0137379_116063851 | 3300012209 | Vadose Zone Soil | PPAPGDSPAWSGAYTYTSSSTGTFSITANGDGSTVTVP* |
Ga0137367_101751821 | 3300012353 | Vadose Zone Soil | IPTPPGGGSPAWSGTYTYTSSSTGTFSVTANGDGTTITFP* |
Ga0137384_111253421 | 3300012357 | Vadose Zone Soil | NGLGQNAGPFIARVPTPPPGGSPAWSGTYTYTSSSTGTFSITANGDGTTITVP* |
Ga0137385_101913333 | 3300012359 | Vadose Zone Soil | FMGSVPVPPPGGSPAWGGSYTYTPNAGAGTFTVAATGDGTTISVP* |
Ga0137390_110247911 | 3300012363 | Vadose Zone Soil | LGQSAGPFMARVPTPPPGGSPAWSGTYTYTSSSTGTFSITANGDGTTITIP* |
Ga0157354_10755991 | 3300012517 | Unplanted Soil | RPPSGGTPAWGAYTYTSSTVGTLSVTASGDGTTITLP* |
Ga0137395_105905752 | 3300012917 | Vadose Zone Soil | PDRSMANVPTPPPGGSPVWSGAYTYTSSSTGTFSITASGDNTTITVP* |
Ga0137419_102439522 | 3300012925 | Vadose Zone Soil | DLTQQTANGLGQNAGPFIARVPTPPGGGSPAWSGTYTYTSSSTGTFSITANGDGTTITFP |
Ga0126375_111429812 | 3300012948 | Tropical Forest Soil | SVPAPPPGGSPAWGAYLYTSSSAGTFTITASGDGTTVTVP* |
Ga0126369_132790332 | 3300012971 | Tropical Forest Soil | TPPPGGSPAWSAAYTYTSSSTGTFSITSNGDNTTITLP* |
Ga0134076_101129941 | 3300012976 | Grasslands Soil | GGSPAWGGAYTYTPNAGAGTFTVSATGDGTTVTVP* |
Ga0132258_124429691 | 3300015371 | Arabidopsis Rhizosphere | PPPGGSPAWGASYTYTPNAGAGTFSITATGDGTTVTVP* |
Ga0182036_100321415 | 3300016270 | Soil | GPFMPLIPVPSWGGSPAWGLYIYTSSIAGTFSITASGDGTTITVP |
Ga0182035_118139151 | 3300016341 | Soil | WSAGPFMPLIPVPSWGGSPAWGLYIYTSSIAGTFSITASGDGTTITVP |
Ga0184604_103337421 | 3300018000 | Groundwater Sediment | TVPPPPYGGTPAWGAYAYTLSSTGTFSVTATGDGTTITVP |
Ga0184615_100621131 | 3300018059 | Groundwater Sediment | AGPFMASVPAPPPGGTPAWGAYGYASSTAGTFSVTATGDGTTITVP |
Ga0066662_118340941 | 3300018468 | Grasslands Soil | PPGGSPAWSGTYTYTSSSTGTFSITANGDGTTITVP |
Ga0209109_100518551 | 3300025160 | Soil | PAPPPGGTPAWGAYGYASSTAGTFSITATGDGTTITVP |
Ga0209521_102804553 | 3300025164 | Soil | QSAGPFMASVPAPPPGGTPAWGAYGYASSTAGTFSITATGDGTTITVP |
Ga0209519_106292321 | 3300025318 | Soil | GPFMASVPAPPPGGTPAWGAYGYASSTAGTFSITATGDGTTITVP |
Ga0209341_102647363 | 3300025325 | Soil | PPGGTPAWGAYGYTSSTAGTFSITATGDGTTITVP |
Ga0209342_109924483 | 3300025326 | Soil | PPPGGTPSWGAYTYTSSTAGTFSIVGTGDGTTITVP |
Ga0209751_100128721 | 3300025327 | Soil | ASVPAPPPGGTPSWGAYTYTSSTAGTFSIVGTGDGTTITVP |
Ga0209751_111921182 | 3300025327 | Soil | PPGGTPAWGAYGYASSTAGTFSITATGDGTTITVP |
Ga0210132_10494851 | 3300025538 | Natural And Restored Wetlands | GLNQSAGPFMASVPAPPPGGTPAWGAYAYTANTNGTFTITATGDGTTITVP |
Ga0210108_10455741 | 3300025560 | Natural And Restored Wetlands | PAGGTPPWPAAYTYTPNFATGQFSISATGDGTTVAVP |
Ga0207646_114265451 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | ILGHIAGPFIASVPTPPPSGSPAWSGTYTYTSSTTGTFSVTANGDGTTITVQ |
Ga0207703_104323783 | 3300026035 | Switchgrass Rhizosphere | GPFLGSVPVPPPGGSPAWGANYTYTPNAAAGTFVVTATGDSTTITVP |
Ga0209055_10250594 | 3300026309 | Soil | TTTGLGQSAGPFVARVPTPPPGGSPAWSGTYTYTSSSTGTFSITANGDGTTITVP |
Ga0209471_13365231 | 3300026318 | Soil | GPFIATVPTPPPGGSPAWSGTYTYTSSSTGTFSITANGDGTTITVP |
Ga0209158_10313335 | 3300026333 | Soil | GPFVARVPTPPPGGSPAWSGTYTYTSSSTGTFSVTANGDGTTITVP |
Ga0257179_10164001 | 3300026371 | Soil | IARIPTPPGGGSPAWSGTYTYTSSSTGTFSVTANGDGTTITFP |
Ga0257159_10599891 | 3300026494 | Soil | QSAGPFITTVPPPPHGGEPAWGAYTYMSSGAGTFLVTATGDGTTITVP |
Ga0257165_11151591 | 3300026507 | Soil | FMASVPAPPPGGSPAWGAYAYTSSTAGTFTITATGDGTTITVP |
Ga0257168_10755553 | 3300026514 | Soil | TPPPGGSPAWSLAYTYTSSSTGTFSVTANGDATTITVP |
Ga0209378_13091591 | 3300026528 | Soil | IARIPTPPGGGSPAWSGTYTYTSSSTGTFSVSANGDGTTITFP |
Ga0209160_11676813 | 3300026532 | Soil | PPAGGAPAWSGTYTYTSSSTGTFSITANGDGTTITVP |
Ga0209058_11496302 | 3300026536 | Soil | LGTVPVPPPGGSPAWGAAYTYTPNAGAGTFSVTATGDGTTVSLP |
Ga0209376_12567723 | 3300026540 | Soil | SAGPFVARVPTPPPGGSPAWSGTYTYTSSSTGTFSVTANGDGTTITVP |
Ga0209161_103632912 | 3300026548 | Soil | TDLTQATTNILGHTAGPFIASVPMPPPGGSPTWSGTYAYTSSSNGTFSVTANGDGTTITM |
Ga0209388_10614811 | 3300027655 | Vadose Zone Soil | LAGPFMARIPTPPPGGTPAWSGTYTYTSSSTGTFSVTANGDGTTITVP |
Ga0209180_106301502 | 3300027846 | Vadose Zone Soil | AAPPPGGTPAWGAYAYASSTAGTFTITATGDGTTITVP |
Ga0209180_108113371 | 3300027846 | Vadose Zone Soil | TANGLGQNAGPFIARVPAVPPGGSPAWAGYTYTSSSAGTFSVTANGDGTTITVP |
Ga0209701_104022841 | 3300027862 | Vadose Zone Soil | PFVARVPTPPPGGSPAWSGAYTYTSSSTGTFSVTANGDGTTITVP |
Ga0209283_100916621 | 3300027875 | Vadose Zone Soil | PPGGAPAWSATYTYTSSSTGTFSITANGDGTTITIP |
Ga0209283_102697121 | 3300027875 | Vadose Zone Soil | PPPGGSPAWSGAYTYTSSTTGTFSVTANGDGTTITVP |
Ga0209590_104873971 | 3300027882 | Vadose Zone Soil | MASVPAPPPGGTPAWGAYAYASSTAGTFTITATGDGTTITVP |
Ga0209590_107314461 | 3300027882 | Vadose Zone Soil | TPPPGGSPAWSGAYTFTSSSTGTFSITANGDGTTITVP |
Ga0209590_107968931 | 3300027882 | Vadose Zone Soil | PFVARVPTPPPGGSPAWSGTYTYTSSSTGTFSITANGDGTTITIP |
Ga0209590_109586511 | 3300027882 | Vadose Zone Soil | RIPTPPPGGSPAWSGAYTYTSSTTGTFSVTANGDGTTITVP |
Ga0318541_100351694 | 3300031545 | Soil | QSAGPFMASIPNPPPGGSPAWGAYNYTSSTAGTFTITATGDGTTITVP |
Ga0318555_107174591 | 3300031640 | Soil | PLIPVPSWGGSPAWGLYIYTSSIAGTFSITASGDGTTITVP |
Ga0318560_105743401 | 3300031682 | Soil | QPPPGGSPAWGNYTYTSSTAGTFTITATGDGTTITVP |
Ga0318494_102029432 | 3300031751 | Soil | LPMPASGGSPAWGAYTYTSSTAGTFSITATGDGTTVTAP |
Ga0318521_100480723 | 3300031770 | Soil | NQSAGPFMASIPNPPPGGSPAWGAYNYTSSTAGTFTITATGDGTTITVP |
Ga0318521_102040492 | 3300031770 | Soil | LIPVPSWGGSPAWGLYIYTSSIAGTFSITASGDGTTITVP |
Ga0307473_102497961 | 3300031820 | Hardwood Forest Soil | PPGGTPAWGAYAYASSTAGTFTVTGTGDGTTITVP |
Ga0318559_103420042 | 3300032039 | Soil | FMPLVPRPPSGGSPPWGAYTYTSSTSGTFSVTATGDGTTITLP |
Ga0307470_112974022 | 3300032174 | Hardwood Forest Soil | SAGPFVATVPPPPFGGTPPWGAFAYQSSTAGTFIITATGDGTTITFP |
Ga0307471_1008788223 | 3300032180 | Hardwood Forest Soil | GGTPAWGAVYTYTPNVAAGTFSISATGDGTTITVP |
Ga0307472_1021942521 | 3300032205 | Hardwood Forest Soil | SIPAPPPGGSPAWGGNYTYTPNAGAGTFTISATGDGTTITVP |
Ga0307472_1024390791 | 3300032205 | Hardwood Forest Soil | PFMGSIPVPPPGGSPAWGGNYTYTPNAGAGTFTVSATGDGTTITVP |
Ga0315275_100641075 | 3300032401 | Sediment | PGGTPAWVAYAYAPNAAAGTYTITATGDGTTITVP |
Ga0314866_034188_3_116 | 3300033807 | Peatland | SSPPGGSPAWGAYTYTSSSAGTFSITATGDGTTVTVP |
Ga0370484_0173659_439_582 | 3300034125 | Untreated Peat Soil | SAGPFMASVPASPPGGTPAWGAYAYTSSTAGTFSITGTGDGTTITVP |
⦗Top⦘ |