Metagenome / Metatranscriptome Family F056103

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F056103
Family Type	Metagenome / Metatranscriptome
Number of Sequences	138
Average Sequence Length	43 residues
Representative Sequence	MSWSWRDLVVLTFMVLLFGAAMMANVSDGPMHEYRGSWVTRASR
Number of Associated Samples	105
Number of Associated Scaffolds	137

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	75.74 %
% of genes near scaffold ends (potentially truncated)	39.13 %
% of genes from short scaffolds (< 2000 bps)	84.06 %
Associated GOLD sequencing projects	95
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.44

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Unclassified (55.797 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (13.768 % of family members)
Environment Ontology (ENVO)	Unclassified (50.000 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (73.188 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	Yes	Secondary Structure distribution:	α-helix: 36.11% β-sheet: 0.00% Coil/Unstructured: 63.89%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.44
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.44
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 137 Family Scaffolds
PF04311	DUF459	2.19
PF01042	Ribonuc_L-PSP	1.46
PF04226	Transgly_assoc	1.46
PF00072	Response_reg	0.73
PF00196	GerE	0.73
PF00534	Glycos_transf_1	0.73
PF06411	HdeA	0.73
PF00011	HSP20	0.73
PF03150	CCP_MauG	0.73
PF01758	SBF	0.73
PF10503	Esterase_PHB	0.73
PF00004	AAA	0.73
PF13560	HTH_31	0.73
PF02796	HTH_7	0.73
PF02735	Ku	0.73
PF04679	DNA_ligase_A_C	0.73
PF12844	HTH_19	0.73
PF13193	AMP-binding_C	0.73
PF01527	HTH_Tnp_1	0.73
PF03807	F420_oxidored	0.73
PF12833	HTH_18	0.73

COG ID	Name	Functional Category	% Frequency in 137 Family Scaffolds
COG2845	Peptidoglycan O-acetyltransferase, SGNH hydrolase family	Cell wall/membrane/envelope biogenesis [M]	2.19
COG0251	Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family	Defense mechanisms [V]	1.46
COG2261	Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family	General function prediction only [R]	1.46
COG0071	Small heat shock protein IbpA, HSP20 family	Posttranslational modification, protein turnover, chaperones [O]	0.73
COG1273	Non-homologous end joining protein Ku, dsDNA break repair	Replication, recombination and repair [L]	0.73
COG1793	ATP-dependent DNA ligase	Replication, recombination and repair [L]	0.73
COG1858	Cytochrome c peroxidase	Posttranslational modification, protein turnover, chaperones [O]	0.73

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.80 %
All Organisms	root	All Organisms	44.20 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.80 %
cellular organisms	root	All Organisms → cellular organisms	44.20 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.80 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	44.20 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.80 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	41.30 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.80 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	36.23 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.80 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	31.88 %
Rhodobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales	0.72 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.80 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	26.09 %
Hyphomicrobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	0.72 %
Rhodobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae	0.72 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.80 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	21.74 %
unclassified Hyphomicrobiaceae	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae	0.72 %
Rhodovulum	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum	0.72 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.80 %
Bradyrhizobium lablabi	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi	2.17 %
unclassified Bradyrhizobium	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium	2.17 %
Hyphomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	0.72 %
Bradyrhizobium erythrophlei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	0.72 %
unclassified Rhodovulum	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum	0.72 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.80 %
Bradyrhizobium lablabi	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi	2.17 %
Bradyrhizobium sp. URHA0002	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHA0002	0.72 %
Rhodovulum sp. PH10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10	0.72 %
Bradyrhizobium sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.	0.72 %
Bradyrhizobium sp. AUGA SZCCT0283	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283	0.72 %
Hyphomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	0.72 %
Bradyrhizobium erythrophlei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	0.72 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2170459010\|GIO7OMY01EFQ3X	Not Available	527	Open in IMG/M
3300000364\|INPhiseqgaiiFebDRAFT_101897963	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1021	Open in IMG/M
3300000955\|JGI1027J12803_100606985	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	524	Open in IMG/M
3300000955\|JGI1027J12803_101669717	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	613	Open in IMG/M
3300000955\|JGI1027J12803_104477868	Not Available	526	Open in IMG/M
3300000955\|JGI1027J12803_104601005	Not Available	514	Open in IMG/M
3300004153\|Ga0063455_101093161	Not Available	588	Open in IMG/M
3300004479\|Ga0062595_100380003	Not Available	1000	Open in IMG/M
3300005093\|Ga0062594_100473179	Not Available	1047	Open in IMG/M
3300005167\|Ga0066672_10821307	Not Available	583	Open in IMG/M
3300005330\|Ga0070690_100055219	Not Available	2544	Open in IMG/M
3300005330\|Ga0070690_100084445	Not Available	2081	Open in IMG/M
3300005339\|Ga0070660_100915508	Not Available	740	Open in IMG/M
3300005347\|Ga0070668_100564890	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	992	Open in IMG/M
3300005354\|Ga0070675_100354174	Not Available	1302	Open in IMG/M
3300005355\|Ga0070671_100832712	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	804	Open in IMG/M
3300005356\|Ga0070674_101094497	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	703	Open in IMG/M
3300005365\|Ga0070688_101018121	Not Available	659	Open in IMG/M
3300005367\|Ga0070667_100560679	All Organisms → cellular organisms → Bacteria → Proteobacteria	1050	Open in IMG/M
3300005434\|Ga0070709_10898080	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	700	Open in IMG/M
3300005437\|Ga0070710_10801831	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	673	Open in IMG/M
3300005456\|Ga0070678_100647504	Not Available	947	Open in IMG/M
3300005456\|Ga0070678_100647504	Not Available	947	Open in IMG/M
3300005457\|Ga0070662_101206680	Not Available	650	Open in IMG/M
3300005457\|Ga0070662_101241986	Not Available	641	Open in IMG/M
3300005548\|Ga0070665_100094084	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	3002	Open in IMG/M
3300005614\|Ga0068856_101133199	Not Available	799	Open in IMG/M
3300005615\|Ga0070702_100073459	Not Available	2026	Open in IMG/M
3300005618\|Ga0068864_101632997	Not Available	649	Open in IMG/M
3300005719\|Ga0068861_100811407	Not Available	879	Open in IMG/M
3300006163\|Ga0070715_10466671	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHA0002	716	Open in IMG/M
3300006175\|Ga0070712_100861952	Not Available	779	Open in IMG/M
3300006237\|Ga0097621_101136519	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	734	Open in IMG/M
3300006797\|Ga0066659_10182788	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1520	Open in IMG/M
3300006880\|Ga0075429_100419701	All Organisms → cellular organisms → Bacteria → Proteobacteria	1172	Open in IMG/M
3300006881\|Ga0068865_101665758	Not Available	574	Open in IMG/M
3300006953\|Ga0074063_12430807	Not Available	533	Open in IMG/M
3300009094\|Ga0111539_10505950	Not Available	1407	Open in IMG/M
3300009094\|Ga0111539_10912575	All Organisms → cellular organisms → Bacteria → Proteobacteria	1021	Open in IMG/M
3300009094\|Ga0111539_13195472	Not Available	528	Open in IMG/M
3300009098\|Ga0105245_10989137	Not Available	885	Open in IMG/M
3300009098\|Ga0105245_12238573	Not Available	600	Open in IMG/M
3300009100\|Ga0075418_10526049	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1270	Open in IMG/M
3300009100\|Ga0075418_12158771	Not Available	607	Open in IMG/M
3300009101\|Ga0105247_10054410	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.	2470	Open in IMG/M
3300009143\|Ga0099792_11259597	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	504	Open in IMG/M
3300009148\|Ga0105243_11163623	Not Available	783	Open in IMG/M
3300009156\|Ga0111538_10133835	All Organisms → cellular organisms → Bacteria → Proteobacteria	3149	Open in IMG/M
3300009162\|Ga0075423_11760362	Not Available	668	Open in IMG/M
3300009174\|Ga0105241_11397670	Not Available	670	Open in IMG/M
3300009176\|Ga0105242_11326405	Not Available	744	Open in IMG/M
3300009551\|Ga0105238_12295228	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	575	Open in IMG/M
3300009553\|Ga0105249_10249160	All Organisms → cellular organisms → Bacteria → Proteobacteria	1760	Open in IMG/M
3300009553\|Ga0105249_11380632	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	776	Open in IMG/M
3300010375\|Ga0105239_13641253	Not Available	501	Open in IMG/M
3300010397\|Ga0134124_10504784	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1170	Open in IMG/M
3300011119\|Ga0105246_11432572	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	646	Open in IMG/M
3300012198\|Ga0137364_10068035	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2428	Open in IMG/M
3300012199\|Ga0137383_10586371	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	816	Open in IMG/M
3300012212\|Ga0150985_104806141	Not Available	659	Open in IMG/M
3300012212\|Ga0150985_105177924	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	4543	Open in IMG/M
3300012212\|Ga0150985_113496423	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1872	Open in IMG/M
3300012469\|Ga0150984_101714470	Not Available	606	Open in IMG/M
3300012469\|Ga0150984_112045668	Not Available	615	Open in IMG/M
3300012469\|Ga0150984_120670027	Not Available	520	Open in IMG/M
3300012685\|Ga0137397_10258476	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1298	Open in IMG/M
3300012944\|Ga0137410_11683292	Not Available	558	Open in IMG/M
3300012951\|Ga0164300_10024572	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10	2135	Open in IMG/M
3300012955\|Ga0164298_10030203	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2426	Open in IMG/M
3300012955\|Ga0164298_10162181	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi	1268	Open in IMG/M
3300012958\|Ga0164299_10435497	All Organisms → cellular organisms → Bacteria	853	Open in IMG/M
3300012958\|Ga0164299_11478286	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	529	Open in IMG/M
3300012960\|Ga0164301_10046761	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2199	Open in IMG/M
3300012984\|Ga0164309_11078797	Not Available	667	Open in IMG/M
3300012985\|Ga0164308_10374504	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1156	Open in IMG/M
3300012989\|Ga0164305_10054377	All Organisms → cellular organisms → Bacteria	2362	Open in IMG/M
3300012989\|Ga0164305_11521845	Not Available	594	Open in IMG/M
3300013297\|Ga0157378_10991694	Not Available	874	Open in IMG/M
3300013297\|Ga0157378_11925368	Not Available	640	Open in IMG/M
3300013306\|Ga0163162_10483868	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	1369	Open in IMG/M
3300013306\|Ga0163162_10928309	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	982	Open in IMG/M
3300013306\|Ga0163162_11141344	Not Available	883	Open in IMG/M
3300013306\|Ga0163162_11271868	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283	836	Open in IMG/M
3300013306\|Ga0163162_12167223	Not Available	638	Open in IMG/M
3300013308\|Ga0157375_11316085	Not Available	850	Open in IMG/M
3300013308\|Ga0157375_13657406	Not Available	511	Open in IMG/M
3300014325\|Ga0163163_11684150	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	695	Open in IMG/M
3300014326\|Ga0157380_10648236	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1053	Open in IMG/M
3300014968\|Ga0157379_10209271	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1765	Open in IMG/M
3300014968\|Ga0157379_10459948	Not Available	1176	Open in IMG/M
3300015077\|Ga0173483_10037309	All Organisms → cellular organisms → Bacteria	1802	Open in IMG/M
3300015371\|Ga0132258_10203016	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	4810	Open in IMG/M
3300015371\|Ga0132258_13350940	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi	1101	Open in IMG/M
3300015373\|Ga0132257_103552957	Not Available	567	Open in IMG/M
3300015374\|Ga0132255_100900246	Not Available	1323	Open in IMG/M
3300017792\|Ga0163161_10634328	Not Available	884	Open in IMG/M
3300017792\|Ga0163161_11570844	Not Available	579	Open in IMG/M
3300018469\|Ga0190270_11376955	Not Available	751	Open in IMG/M
3300018476\|Ga0190274_11354199	Not Available	800	Open in IMG/M
3300018476\|Ga0190274_11733180	Not Available	719	Open in IMG/M
3300018481\|Ga0190271_10886369	Not Available	1017	Open in IMG/M
3300018482\|Ga0066669_10114331	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1907	Open in IMG/M
3300018482\|Ga0066669_10741954	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	866	Open in IMG/M
3300020579\|Ga0210407_10000780	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	33300	Open in IMG/M
3300021475\|Ga0210392_10000720	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	18983	Open in IMG/M
3300021479\|Ga0210410_10084917	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2785	Open in IMG/M
3300025315\|Ga0207697_10385566	Not Available	622	Open in IMG/M
3300025901\|Ga0207688_10316590	Not Available	957	Open in IMG/M
3300025904\|Ga0207647_10354393	Not Available	831	Open in IMG/M
3300025906\|Ga0207699_11212453	Not Available	559	Open in IMG/M
3300025916\|Ga0207663_11631380	Not Available	519	Open in IMG/M
3300025920\|Ga0207649_10643283	Not Available	819	Open in IMG/M
3300025930\|Ga0207701_10015414	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	7403	Open in IMG/M
3300025930\|Ga0207701_10127071	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	2270	Open in IMG/M
3300025933\|Ga0207706_10179813	All Organisms → cellular organisms → Bacteria	1857	Open in IMG/M
3300025934\|Ga0207686_10965334	Not Available	690	Open in IMG/M
3300025936\|Ga0207670_11102588	Not Available	670	Open in IMG/M
3300025937\|Ga0207669_10678385	Not Available	845	Open in IMG/M
3300025938\|Ga0207704_10478364	Not Available	999	Open in IMG/M
3300025939\|Ga0207665_10533529	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	910	Open in IMG/M
3300025944\|Ga0207661_10060434	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	3058	Open in IMG/M
3300025960\|Ga0207651_11005792	Not Available	745	Open in IMG/M
3300025972\|Ga0207668_11742113	Not Available	562	Open in IMG/M
3300025981\|Ga0207640_10896021	Not Available	774	Open in IMG/M
3300026041\|Ga0207639_10977784	Not Available	792	Open in IMG/M
3300026089\|Ga0207648_10281249	Not Available	1488	Open in IMG/M
3300026121\|Ga0207683_10173426	Not Available	1954	Open in IMG/M
3300026121\|Ga0207683_12122916	Not Available	510	Open in IMG/M
3300028379\|Ga0268266_10235137	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi	1689	Open in IMG/M
3300028710\|Ga0307322_10121434	Not Available	682	Open in IMG/M
3300028802\|Ga0307503_10456085	All Organisms → cellular organisms → Bacteria → Proteobacteria	680	Open in IMG/M
3300028802\|Ga0307503_10653716	Not Available	586	Open in IMG/M
3300031058\|Ga0308189_10099382	All Organisms → cellular organisms → Bacteria → Proteobacteria	920	Open in IMG/M
3300031740\|Ga0307468_100385288	Not Available	1063	Open in IMG/M
3300032180\|Ga0307471_100166642	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2149	Open in IMG/M
3300032205\|Ga0307472_101282637	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	704	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	55.80%
Environmental	Environmental	44.20%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	55.80%
Terrestrial	Environmental → Terrestrial	44.20%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	44.20%
Rhizosphere	Host-Associated → Plants → Rhizosphere	33.33%
Rhizoplane	Host-Associated → Plants → Rhizoplane	21.01%
Roots	Host-Associated → Plants → Roots	1.45%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	34.06%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	20.29%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	13.04%
Soil	Host-Associated → Plants → Rhizosphere → Soil	13.04%
Loam	Environmental → Terrestrial → Soil → Loam	10.14%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	5.07%
Soil	Host-Associated → Plants → Rhizoplane → Soil	2.90%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	1.45%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	20.29%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	19.57%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	13.04%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	13.04%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	9.42%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	8.70%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	5.07%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	4.35%
Unclassified	Host-Associated → Plants → Rhizoplane → Soil → Unclassified	2.90%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	1.45%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	1.45%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	0.72%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	13.77%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	5.80%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	5.80%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	5.07%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	5.07%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	5.07%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	4.35%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	3.62%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	3.62%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	2.90%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	2.90%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	2.90%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere	2.90%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	2.90%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	2.90%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	2.17%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	2.17%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere	2.17%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	2.17%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	2.17%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	2.17%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	2.17%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere	2.17%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	1.45%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	1.45%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	1.45%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere	1.45%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	1.45%
Corn, Switchgrass And Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	1.45%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.72%
Grass Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil	0.72%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	0.72%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	0.72%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	0.72%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	0.72%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2170459010	Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!)	Environmental	Open in IMG/M
3300000364	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300000955	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300004153	Grasslands soil microbial communities from Hopland, California, USA (version 2)	Environmental	Open in IMG/M
3300004479	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs	Environmental	Open in IMG/M
3300005093	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks	Environmental	Open in IMG/M
3300005167	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121	Environmental	Open in IMG/M
3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Environmental	Open in IMG/M
3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Host-Associated	Open in IMG/M
3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Host-Associated	Open in IMG/M
3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Host-Associated	Open in IMG/M
3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Host-Associated	Open in IMG/M
3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Host-Associated	Open in IMG/M
3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Environmental	Open in IMG/M
3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Host-Associated	Open in IMG/M
3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Environmental	Open in IMG/M
3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Environmental	Open in IMG/M
3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Host-Associated	Open in IMG/M
3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Host-Associated	Open in IMG/M
3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Host-Associated	Open in IMG/M
3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Host-Associated	Open in IMG/M
3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Environmental	Open in IMG/M
3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Host-Associated	Open in IMG/M
3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Host-Associated	Open in IMG/M
3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Environmental	Open in IMG/M
3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Environmental	Open in IMG/M
3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)	Host-Associated	Open in IMG/M
3300006797	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108	Environmental	Open in IMG/M
3300006880	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Host-Associated	Open in IMG/M
3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Host-Associated	Open in IMG/M
3300006953	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300009094	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)	Host-Associated	Open in IMG/M
3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Host-Associated	Open in IMG/M
3300009100	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2	Host-Associated	Open in IMG/M
3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Host-Associated	Open in IMG/M
3300009143	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2	Environmental	Open in IMG/M
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated	Open in IMG/M
3300009156	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)	Host-Associated	Open in IMG/M
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated	Open in IMG/M
3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Host-Associated	Open in IMG/M
3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Host-Associated	Open in IMG/M
3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Host-Associated	Open in IMG/M
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated	Open in IMG/M
3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Host-Associated	Open in IMG/M
3300010397	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4	Environmental	Open in IMG/M
3300010403	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3	Environmental	Open in IMG/M
3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Host-Associated	Open in IMG/M
3300012198	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG	Environmental	Open in IMG/M
3300012199	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG	Environmental	Open in IMG/M
3300012212	Combined assembly of Hopland grassland soil	Host-Associated	Open in IMG/M
3300012469	Combined assembly of Soil carbon rhizosphere	Host-Associated	Open in IMG/M
3300012685	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG	Environmental	Open in IMG/M
3300012944	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012951	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG	Environmental	Open in IMG/M
3300012955	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG	Environmental	Open in IMG/M
3300012958	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG	Environmental	Open in IMG/M
3300012960	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG	Environmental	Open in IMG/M
3300012984	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG	Environmental	Open in IMG/M
3300012985	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG	Environmental	Open in IMG/M
3300012989	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG	Environmental	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Host-Associated	Open in IMG/M
3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Host-Associated	Open in IMG/M
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated	Open in IMG/M
3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Host-Associated	Open in IMG/M
3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Host-Associated	Open in IMG/M
3300015077	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)	Environmental	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Host-Associated	Open in IMG/M
3300018469	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T	Environmental	Open in IMG/M
3300018476	Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T	Environmental	Open in IMG/M
3300018481	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T	Environmental	Open in IMG/M
3300018482	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118	Environmental	Open in IMG/M
3300020579	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M	Environmental	Open in IMG/M
3300021475	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O	Environmental	Open in IMG/M
3300021479	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M	Environmental	Open in IMG/M
3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)	Host-Associated	Open in IMG/M
3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)	Host-Associated	Open in IMG/M
3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)	Host-Associated	Open in IMG/M
3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)	Environmental	Open in IMG/M
3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025930	Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)	Environmental	Open in IMG/M
3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)	Environmental	Open in IMG/M
3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)	Environmental	Open in IMG/M
3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300028710	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380	Environmental	Open in IMG/M
3300028802	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S	Environmental	Open in IMG/M
3300031058	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031740	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05	Environmental	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M
3300032205	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
F62_01072920	2170459010	Grass Soil	LLWSWRDLDVLTFLMLLFGAAMMANVSDGPMHEYRGSWVTRASR
INPhiseqgaiiFebDRAFT_1018979631	3300000364	Soil	MRKSWLDLAVLAFLVLLFVAAIMANISDGPMHEYRGAWV
JGI1027J12803_1006069851	3300000955	Soil	MRKSWLDLAVLAFLVLLFVAAIMANISDGPMHEYRGAWVTRA
JGI1027J12803_1016697172	3300000955	Soil	MSWGWRDLVMLTFLVLLFGAAMIANVSDGPMREHRGSWV
JGI1027J12803_1044778681	3300000955	Soil	MWRNLVALTFSVFLLGAALMANVGDGPMSQYRGSWLTR
JGI1027J12803_1046010051	3300000955	Soil	MWRELIALTFLGLLLGAAMIANVSDGPMREYRGSWAQPLRQAP
Ga0063455_1010931612	3300004153	Soil	MLRRLRDLLVLMFLVLLLGAAMIANVSDGPMPEYRGSWVSRASRF*
Ga0062595_1003800031	3300004479	Soil	MRKKDRTVMCWRDRVVLIFFVLLFGAAIMANLNEGPMHEYRGAWVTRVSR*
Ga0062594_1004731791	3300005093	Soil	MSWSWRDLVALTHFVLLFGATMIANVSDGPMHEYRGSWVTRASR*
Ga0066672_108213072	3300005167	Soil	MAWNWRDLVVLIFFVLLFGAAMMAHVSDGPLAEHRGTWVTHALR*
Ga0070690_1000552193	3300005330	Switchgrass Rhizosphere	MSWSWRDLVVLTFMVVLFGAAMMANVSDGPMHEYRGSWVARASR*
Ga0070690_1000844451	3300005330	Switchgrass Rhizosphere	MSWSWRDLVALTLFVLLFGATMIANVSDGPMHEYRGSWVTRASR*
Ga0070660_1009155081	3300005339	Corn Rhizosphere	RMSWSWRDLFALTFFVQLFGAAMMANVSDGPMHEYRGSWVARASR*
Ga0070668_1005648902	3300005347	Switchgrass Rhizosphere	MWRQLVGLIFWGLLFGAALMANVTDGPMRDHRGSWVTHASIGR*
Ga0070675_1003541743	3300005354	Miscanthus Rhizosphere	MWRDLVALTFSVLLLGAAVMANLSGGPLPEHRGSWVTHASR*
Ga0070671_1008327122	3300005355	Switchgrass Rhizosphere	MSWNWRNLVVLTFLVFLFGAAMMANVSDGPFHEYRGSWARHAL*
Ga0070674_1010944971	3300005356	Miscanthus Rhizosphere	GSMSWNWRDLVVMAFFVLLFGAAMIANMVDGPMREHRGSWVTHALR*
Ga0070688_1010181212	3300005365	Switchgrass Rhizosphere	GEGRMSWSWRDLVVLTFMVVLFGAAMMANVSDGPMHEYRGSWVARASR*
Ga0070667_1005606792	3300005367	Switchgrass Rhizosphere	SWSWRDLVALTFLVLLFGTAMMANMSDGPMHEYRGSWVSRASR*
Ga0070709_108980803	3300005434	Corn, Switchgrass And Miscanthus Rhizosphere	MWRELVGLSLLVVLLGAAMVANVTDGSMRDYRGSWLTHASK*
Ga0070710_108018312	3300005437	Corn, Switchgrass And Miscanthus Rhizosphere	MWRDLVALTLAALLLGAAIVANVSDGPMRDFRGSWVTHASQ*
Ga0070678_1006475041	3300005456	Miscanthus Rhizosphere	MSWSWRDLVVLTFLVLLFGAAMMANVSDGPMHEYRGSWVSRASR*
Ga0070678_1006475043	3300005456	Miscanthus Rhizosphere	MSWSWRDLVVVTFLVMLLGGAMVANVSDGPMHQYRGSWVTRASR*
Ga0070662_1012066802	3300005457	Corn Rhizosphere	MSWSWRDLVVVTFLVMLLGAAMVANVSDGLMHQYRGSWVTRASR*
Ga0070662_1012419861	3300005457	Corn Rhizosphere	MWRDLVALTFSVLLLGAAVMANLSGGPLPEHRGSWVTHAS
Ga0070665_1000940843	3300005548	Switchgrass Rhizosphere	MSWSWRDLFALTFFVLLFGAAMMANVSDGPMHEYRGSWVARASR*
Ga0068856_1011331993	3300005614	Corn Rhizosphere	MWRNLVALTFSVFLLGAALMANVGDGPMSQYRGSW
Ga0070702_1000734591	3300005615	Corn, Switchgrass And Miscanthus Rhizosphere	MSWSWRDLVALTLFVLLFGVTMIANVSDGPMHEYRGSWVTRASR*
Ga0068864_1016329971	3300005618	Switchgrass Rhizosphere	WRDLVALTFSVLLLGAAVMANLSGGPLPEHRGSWVTHASR*
Ga0068861_1008114071	3300005719	Switchgrass Rhizosphere	MSWSWRDLVVVTFLVMLLGAAMVANVSDGPMHQYRGSWVT
Ga0070715_104666711	3300006163	Corn, Switchgrass And Miscanthus Rhizosphere	MSWNWRDLVELTFLVLLFGAAMIANVSDGPMREHRGSWVTHALR*
Ga0070712_1008619521	3300006175	Corn, Switchgrass And Miscanthus Rhizosphere	MWRQMVGLIFWGLLFGAALMANVTDGPMRDHRGSWVTHASIGR*
Ga0097621_1011365192	3300006237	Miscanthus Rhizosphere	MSWNWRDLVVMAFFVLLFGAAMIANMVDGPMREHRGSWVTHALR*
Ga0066659_101827885	3300006797	Soil	MAWNWWDLVVLIFFVLLFGAAMMAHVSDGPLAEHRGTWVTHALR*
Ga0075429_1004197014	3300006880	Populus Rhizosphere	MSWRWRELVVLTFLVLLLGAAMIANVSDGPMSEYRGSWVTRASRF*
Ga0068865_1016657581	3300006881	Miscanthus Rhizosphere	MWRDLVALTFSVLLLGAAVMANLSGGPMPEHRGSWVTHASR*
Ga0074063_124308072	3300006953	Soil	MWRELVGLTFLVLLFGAALMANVADGPMRDHRGSWVTHASIGR*
Ga0111539_105059502	3300009094	Populus Rhizosphere	MSWSWRDLVVLTFLVMLLGAAMVANVSDGPMYEYQVRG*
Ga0111539_109125752	3300009094	Populus Rhizosphere	MSWRWRDLVVLTFLVLLLGAAMIANVSDGPMSEYRGSWVTRASRF*
Ga0111539_131954721	3300009094	Populus Rhizosphere	MSWSWRDLVVLTFMVLLFGAAMMANVSDGPMHEYRGSWVARASR*
Ga0105245_109891372	3300009098	Miscanthus Rhizosphere	MWRNLVTLTLSVFLLGAALMANVGDGPMSQYRGSWLTRASR*
Ga0105245_122385731	3300009098	Miscanthus Rhizosphere	MWRDLVALTFSVLLLGAAVMANLSGGPMPEHRGSWVTHASR
Ga0075418_105260491	3300009100	Populus Rhizosphere	ESRMSSRWRELVGLTFLVLLLGAAMIANVSDGPMSEYRGSWVTRASRF*
Ga0075418_121587711	3300009100	Populus Rhizosphere	MSWNWRDLVVLTFMVLLFGAAMMANVSDGPMHEYRGSWVARASR*
Ga0105247_100544101	3300009101	Switchgrass Rhizosphere	MSWSWRDLVALTFLVLLFGTAMMANMSDGPMHEYRGSWV
Ga0099792_112595972	3300009143	Vadose Zone Soil	MSWGWRDLVVLTFLVLVFGAAMIANVSDGPMREHRGSWVTHVLR*
Ga0105243_111636231	3300009148	Miscanthus Rhizosphere	EGSMSWNWRDLVVMAFFVLLFGAAMIANMVDGPMREHRGSWVTHALR*
Ga0111538_101338353	3300009156	Populus Rhizosphere	MSSRWRELVGLTFLVLLLGAAMIANVSDGPMSEYRGSWVTRASRF*
Ga0075423_117603621	3300009162	Populus Rhizosphere	MELVGLGVLTFMVLLFGAAMMANVSDGPMHECRGSWVARASR*
Ga0105241_113326312	3300009174	Corn Rhizosphere	VIRWRRTKRDKKGEAAMWRDLVALTFSVLLLGAAVMANLSGGPMPEHRGSWVTHASR*
Ga0105241_113976702	3300009174	Corn Rhizosphere	EGRMSWSWRDLVVLTRVVVLLGAAMMARVSHGPMHEYRGSWVARASR*
Ga0105242_113264051	3300009176	Miscanthus Rhizosphere	RQTFAYSDKCEKREGSMSWNWRDLVVMAFFVLLFGAAMIANMVDGPMREHRGSWVTHALR
Ga0105238_122952281	3300009551	Corn Rhizosphere	MSWNWRNLVVLTFLVFLFGAAMMANVSDGPFHEYRGSWARHALR*
Ga0105249_102491602	3300009553	Switchgrass Rhizosphere	MSRSWRDLVALTFFVLLFGAAMVANVSDGPLHEYRGSWVARAR*
Ga0105249_113806321	3300009553	Switchgrass Rhizosphere	WRWRDLVVLTLLVLLLGAAMIANVSDGPMSEYRGSWVTRASRF*
Ga0105239_136412531	3300010375	Corn Rhizosphere	MWRNLVALTFSVLLLGAALMANVGDGPMSQYRGSWLTRASR*
Ga0134124_105047841	3300010397	Terrestrial Soil	EGSMSWNWRNLVVLTFLVFLFGAAMMANVSDGPFHEYRGSWARHALR*
Ga0134123_111686382	3300010403	Terrestrial Soil	MWRDVVALTLAALLLGAAIIANVGDGPMREHRGSWVTHASKLSR*
Ga0105246_114325722	3300011119	Miscanthus Rhizosphere	MWRDLVALTLAALLLGAAIVANVSDGPMRDHRGSWVTHASQ*
Ga0137364_100680354	3300012198	Vadose Zone Soil	MSWGWRDLVVLTFLVLVFGAAMIANVSDGPMREHRGSWVTHGLR*
Ga0137383_105863711	3300012199	Vadose Zone Soil	MRKREGSMAWNWRDLVVLTFLALVFGAAMIANVSDGPMHEHRG
Ga0150985_1048061411	3300012212	Avena Fatua Rhizosphere	VALTLAALQLGAAIIANVGDGPMREHRGSWVTHASKLSR*
Ga0150985_1051779243	3300012212	Avena Fatua Rhizosphere	MCRWRDLVVLTILILLLGAAMIANVSDGPMSEYRGSWVTRASRF*
Ga0150985_1134964232	3300012212	Avena Fatua Rhizosphere	MSWRWRELVVLTFLILLLGAAMIVNVSDGPMSEYRGSWVTRASRF*
Ga0150984_1017144701	3300012469	Avena Fatua Rhizosphere	MSATKTKGSVMWRELVGLSLMVVLLGAAIVANVTDGPMRDYRGSWLTHASK*
Ga0150984_1120456681	3300012469	Avena Fatua Rhizosphere	MLRRLRDLLVLMFLVLLLGAAMIANVSDGPMPEYR
Ga0150984_1206700271	3300012469	Avena Fatua Rhizosphere	MWRELVGLIFWVLLFGAALMANFTDGPMREHRGSWVARASQLSR*
Ga0137397_102584762	3300012685	Vadose Zone Soil	MLSGWRALVVLTFLVLLIGAATIVNVSDGPMRQHRGSWVTYALR*
Ga0137410_116832921	3300012944	Vadose Zone Soil	MLSGWRALVVLTFLVFLFGAAMIANVSDGPMRERRGSWVTHALR*
Ga0164300_100245724	3300012951	Soil	MSWNWRDLVVLTFLVFLFGAAMLANVSDGPLHEHRGSWVTHGLAIAQWYTSL
Ga0164298_100302032	3300012955	Soil	MSWNWRDLVVLTFLVFLFGAAMLANVSDGPLHEHRGSWVTHALR*
Ga0164298_101621812	3300012955	Soil	MWRDLVALTVSVLLLGAAVMANLSGGPLPEHRGSWVTHASR*
Ga0164299_104354973	3300012958	Soil	SWSWRDLVVLTFMVLLFGAAMMANVSDGPMQEYRGSWVARASR*
Ga0164299_114782861	3300012958	Soil	MEFADLVALTFSALLLGAAIMANVSDGPMREHRGSWVTHALR*
Ga0164301_100467613	3300012960	Soil	KREGSMSWNWRDLVVLTFLVFLFGAAMLANVSDGPLHEHRGSWVTHALR*
Ga0164309_110787972	3300012984	Soil	MWRELVGLIFLVLLFGAALMANVTDGPMRDHRGAWVTQASK*
Ga0164308_103745042	3300012985	Soil	MSWNWKNLVILTFLVFLFGAAMVANLSDGPLHEHRGSWARH
Ga0164305_100543771	3300012989	Soil	EGSMSWGWRDLVVLTFLVPLFGAAMIANVSDGPMREHRGSWVTHALR*
Ga0164305_115218451	3300012989	Soil	MSWGWRDLVVLTFLVLLFGAAMIANVSDGPMREHRGSWVTHALR*
Ga0157378_109916941	3300013297	Miscanthus Rhizosphere	MSWNWRDLVVMAFFLLLFGAAMIANMVDGPMREHRGSWVTHALR*
Ga0157378_119253682	3300013297	Miscanthus Rhizosphere	MSWNWRNLVVLTFLVFLFGAAIMANVSDGPFHEYRGSWARHALR*
Ga0163162_104838682	3300013306	Switchgrass Rhizosphere	MWRELVGLIFWLLLFGAALMANVTDGPMREHRGSWVTHALQLSR*
Ga0163162_109283092	3300013306	Switchgrass Rhizosphere	MKGRKGGMWRELVGLTFLGLLLGAAMIANVGDGAMREYRGAWVTH
Ga0163162_111413442	3300013306	Switchgrass Rhizosphere	MWRELVGLIFLVLLFGAALMANVTDGPMRDHRGSWVTQVSK*
Ga0163162_112718684	3300013306	Switchgrass Rhizosphere	MWRDWVALTVSVLLLGAAIIANVTDGPMREHRGAWVARASR*
Ga0163162_121672231	3300013306	Switchgrass Rhizosphere	MWRELVGLIFLALLFGAALMANVTDGPMRDHRASWVTHASVGR*
Ga0157375_113160851	3300013308	Miscanthus Rhizosphere	KKEGSMSWNWRDLVVMAFFVLLFGAAMIANMVDGPMREHRGSWVTHALR*
Ga0157375_136574061	3300013308	Miscanthus Rhizosphere	MSRSWRDLVALTFFVLLFGAAMVANVSDGPLHEYRGSWVARASR*
Ga0163163_116841501	3300014325	Switchgrass Rhizosphere	QTRLEKKEGSMSWNWRNLVVLTFLVFLFGAAMMANVSDGPFHEYRGSWARHALR*
Ga0157380_106482363	3300014326	Switchgrass Rhizosphere	RDLFALTFFVLLFGAAMMANVSDVPMHEYRGSWVARASR*
Ga0157379_102092712	3300014968	Switchgrass Rhizosphere	MSWRWRDLVVLTLLVLLLGAAMIANVSDGPMSEYRGSWVTRASRF*
Ga0157379_104599482	3300014968	Switchgrass Rhizosphere	MSWSWRDLVVLTFMVLLFGAAMMANVSDGPMHEYRGSWVTRASR*
Ga0173483_100373095	3300015077	Soil	ELVALGFLVLLLGAALMANVTDGPMPEQRGSWLTYASK*
Ga0132258_102030162	3300015371	Arabidopsis Rhizosphere	MWRDLIALTFSVLLLGAAVMANLTKGPMPEHRGSWVTHASR*
Ga0132258_133509403	3300015371	Arabidopsis Rhizosphere	MWRDLVALTFSVLLLGAAVMANLSGGPLPEHRGSWVTHA
Ga0132257_1035529571	3300015373	Arabidopsis Rhizosphere	MWRELVGLIFLALLFGAALMANVNDGPMREYRGSWVTYASK*
Ga0132255_1009002462	3300015374	Arabidopsis Rhizosphere	MSWSWRDLVVLTFMVLLFGAAMMANVSDGPMHEYRGAWVTRASR*
Ga0163161_106343282	3300017792	Switchgrass Rhizosphere	MSWSWRDLVALTHFVLLFGATMIANVSDGPMHEYRGSWVTRASR
Ga0163161_115708441	3300017792	Switchgrass Rhizosphere	MSWSWRDLVVVTFLVMLLGAAMVANVSDGPMHEYRGSWVARSSR
Ga0190270_113769552	3300018469	Soil	MSWNWQDLVALTFSALLLGAAIIANVGDGPMRDHRGSWVTQASR
Ga0190274_113541991	3300018476	Soil	RMLRRLRDLLVLMFLVLLLGAAMIANVSDGPMPEYRGS
Ga0190274_117331802	3300018476	Soil	MSWKWQDLVVLTVSTLLLGAAMLATVSDGPMRDHRGWWVTRAL
Ga0190271_108863692	3300018481	Soil	MWRDVVALTLGALLLGAAILANVTDGPMREHRGSWVTRASIGR
Ga0066669_101143314	3300018482	Grasslands Soil	VVVTFLVLVFGAAMIANVSDGPMREHRGSWVTHVLR
Ga0066669_107419541	3300018482	Grasslands Soil	MAWNWRDLVVLIFFVLLFGAAMMAHVSDGPLAEHRGTWVTHALR
Ga0210407_1000078014	3300020579	Soil	MWRDLVALTVSVLLLGAAIIANVSDGPMREHRGAWVTRASR
Ga0210392_1000072020	3300021475	Soil	MWRDLVALTVSVPLLGAAIIANVSDGPMREHRGAWVTRASR
Ga0210410_100849172	3300021479	Soil	MSWNWRDLVELTFLVLLFGAAMIANVSDGPMREHRGSWVTHALR
Ga0207697_103855661	3300025315	Corn, Switchgrass And Miscanthus Rhizosphere	MSWSWRDLVVLTFMVVLFGAAMMANVSDGPMHEYRGSWVARASR
Ga0207688_103165902	3300025901	Corn, Switchgrass And Miscanthus Rhizosphere	MSWSWRDLVALTFLVLLFGTAMMANMSDGPMHEYRGSWVSRASR
Ga0207647_103543932	3300025904	Corn Rhizosphere	MSWSWRDLVALTLFVLLFGATMIANVSDGPMHEYRGSWVTRASR
Ga0207699_112124532	3300025906	Corn, Switchgrass And Miscanthus Rhizosphere	MWRELIFWVLLFGAALMANVTGGPMREHRGSWVTHASQL
Ga0207663_116313801	3300025916	Corn, Switchgrass And Miscanthus Rhizosphere	MAWNWRDLVVLTFLVFLFGAAMLANVSDGPLHEHRGSWVTHALR
Ga0207649_106432833	3300025920	Corn Rhizosphere	MSWSWRDLVALTLFVLLFGATMIANVSDGPMHEYRGSWVT
Ga0207701_1001541415	3300025930	Corn, Switchgrass And Miscanthus Rhizosphere	MSWSWRDLFALTFFVLLFGAAMMANVSDGPMHEYRGSWVARASR
Ga0207701_101270714	3300025930	Corn, Switchgrass And Miscanthus Rhizosphere	MSWSWRDLVALTFFVLLFGAAMVANVSDGPLHEYRGSWVARASR
Ga0207706_101798131	3300025933	Corn Rhizosphere	KRIMWWYVVTWSFSVLLLGAAILVNLGDGPMREHRGSWVTHASR
Ga0207686_109653342	3300025934	Miscanthus Rhizosphere	MSWRWRDLVVLTLLVLLLGAAMIANVSDGPMSEYRGSWVTRAS
Ga0207670_111025881	3300025936	Switchgrass Rhizosphere	MSWSWRDLFALTFFVLLFGAAMMANVSDGPMHEYRGSWVA
Ga0207669_106783851	3300025937	Miscanthus Rhizosphere	MSWRWRDLVVLTLLVLLLGAAMIANVSDGPMSEYRGSWVTRALRF
Ga0207704_104783641	3300025938	Miscanthus Rhizosphere	WRDLVALTLFVLLFGATMIANVSDGPMHEYRGSWVTRASR
Ga0207665_105335292	3300025939	Corn, Switchgrass And Miscanthus Rhizosphere	MWREFVGLTFLGLLLGAAMIANVGDGAMREYRGAWVTHASK
Ga0207661_100604343	3300025944	Corn Rhizosphere	MWRDLVALTFSVLLLGAAVMANLSGGPMPEHRSSWVTHASR
Ga0207651_110057922	3300025960	Switchgrass Rhizosphere	MSRSWRDLVALTFFVLLFGAAMVANVSDGPLHEYRGSWVARASR
Ga0207668_117421132	3300025972	Switchgrass Rhizosphere	WVALTVLVLLLGAAIIANVTDGPMREHRGAWVARASR
Ga0207640_108960212	3300025981	Corn Rhizosphere	MSWSWRDLFALTFFVLLFGAAMMANVSDGPMHEYRGSWVAR
Ga0207639_109777841	3300026041	Corn Rhizosphere	EKGGRMSWSWRDLFALTFFVLLFGAAMMANVSDGPMHEYRGSWVARASR
Ga0207648_102812491	3300026089	Miscanthus Rhizosphere	MSWSWRDLVAVTVLLFGAAMMANVSDGPLHEYRGSWVARASR
Ga0207683_101734264	3300026121	Miscanthus Rhizosphere	MSWSWRDLVALTHFVLLFGATMIANVSDGPMHEYRG
Ga0207683_121229163	3300026121	Miscanthus Rhizosphere	ALTVSVLLLGAAIIANVTDGPMREHRGAWVARASR
Ga0268266_102351371	3300028379	Switchgrass Rhizosphere	MWRDLVALTFSVLLLGAAVMANLSGGPLPEHRGSWVTHASR
Ga0307322_101214341	3300028710	Soil	MSWSWRDLVVLTFSVLLFGAAMMANVSDGPMREYRGSWV
Ga0307503_104560852	3300028802	Soil	GMWRNLVALTFSVLLLGAALMANVGEGPMSEYRGSWLTRASR
Ga0307503_106537162	3300028802	Soil	MSWSWRDLFALTFFVLLFGAAMMANVSDGPMHEYRGSW
Ga0308189_100993822	3300031058	Soil	MSWRWRELVVLTFLVLLLGAAMIANVSDGPMSEYRGSWVTRASRF
Ga0307468_1003852882	3300031740	Hardwood Forest Soil	MEGSMSWNWRNLVVLTFLVFLFGAAMMANVSDGPFHEYRGSWARHALR
Ga0307471_1001666425	3300032180	Hardwood Forest Soil	MWRELVALAFLVLLLGAALMANVTDGPMPEQRGSWLTYASK
Ga0307472_1012826371	3300032205	Hardwood Forest Soil	MWRQLVGLIFWGLLFGAALMANVTDGPMRDHRGSWVTHA

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F056103

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences