NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F056017

Metagenome / Metatranscriptome Family F056017

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F056017
Family Type Metagenome / Metatranscriptome
Number of Sequences 138
Average Sequence Length 37 residues
Representative Sequence MSAAGPPQGANCAPAFGGSAAAELANEAASVGVHQ
Number of Associated Samples 83
Number of Associated Scaffolds 138

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 57.89 %
% of genes near scaffold ends (potentially truncated) 44.93 %
% of genes from short scaffolds (< 2000 bps) 56.52 %
Associated GOLD sequencing projects 80
AlphaFold2 3D model prediction Yes
3D model pTM-score0.30

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (78.261 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(33.333 % of family members)
Environment Ontology (ENVO) Unclassified
(47.101 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(50.725 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Fibrous Signal Peptide: No Secondary Structure distribution: α-helix: 33.33%    β-sheet: 0.00%    Coil/Unstructured: 66.67%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.30
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 138 Family Scaffolds
PF00005ABC_tran 8.70
PF00528BPD_transp_1 7.25
PF02653BPD_transp_2 4.35
PF00873ACR_tran 2.90
PF00361Proton_antipo_M 2.17
PF03401TctC 1.45
PF01494FAD_binding_3 1.45
PF02321OEP 1.45
PF00171Aldedh 1.45
PF08281Sigma70_r4_2 1.45
PF04055Radical_SAM 1.45
PF06267DUF1028 1.45
PF13458Peripla_BP_6 1.45
PF027373HCDH_N 1.45
PF02777Sod_Fe_C 1.45
PF00483NTP_transferase 1.45
PF00346Complex1_49kDa 1.45
PF00248Aldo_ket_red 1.45
PF08402TOBE_2 1.45
PF00797Acetyltransf_2 1.45
PF02668TauD 0.72
PF03477ATP-cone 0.72
PF01970TctA 0.72
PF03934T2SSK 0.72
PF11306DUF3108 0.72
PF03972MmgE_PrpD 0.72
PF08241Methyltransf_11 0.72
PF04321RmlD_sub_bind 0.72
PF01266DAO 0.72
PF09948DUF2182 0.72
PF03450CO_deh_flav_C 0.72
PF00056Ldh_1_N 0.72
PF06857ACP 0.72
PF00327Ribosomal_L30 0.72
PF12769PNTB_4TM 0.72
PF00472RF-1 0.72
PF08445FR47 0.72
PF05035DGOK 0.72
PF16490Oxidoreduct_C 0.72
PF00378ECH_1 0.72
PF02142MGS 0.72
PF05834Lycopene_cycl 0.72
PF09837DUF2064 0.72
PF00288GHMP_kinases_N 0.72
PF01926MMR_HSR1 0.72
PF07793DUF1631 0.72
PF03840SecG 0.72
PF01032FecCD 0.72
PF12697Abhydrolase_6 0.72
PF08501Shikimate_dh_N 0.72
PF13432TPR_16 0.72
PF01127Sdh_cyt 0.72
PF02613Nitrate_red_del 0.72
PF11743DUF3301 0.72
PF00486Trans_reg_C 0.72
PF07992Pyr_redox_2 0.72
PF13466STAS_2 0.72
PF13401AAA_22 0.72
PF03447NAD_binding_3 0.72
PF02934GatB_N 0.72
PF12911OppC_N 0.72
PF07690MFS_1 0.72
PF13442Cytochrome_CBB3 0.72
PF00326Peptidase_S9 0.72
PF00106adh_short 0.72
PF00294PfkB 0.72
PF00795CN_hydrolase 0.72
PF01975SurE 0.72
PF00892EamA 0.72
PF02104SURF1 0.72
PF01966HD 0.72
PF07978NIPSNAP 0.72
PF01435Peptidase_M48 0.72
PF028262-Hacid_dh_C 0.72
PF00202Aminotran_3 0.72
PF09828Chrome_Resist 0.72
PF01047MarR 0.72
PF012572Fe-2S_thioredx 0.72
PF08811DUF1800 0.72
PF13561adh_short_C2 0.72
PF00682HMGL-like 0.72
PF02775TPP_enzyme_C 0.72
PF13298LigD_N 0.72
PF04995CcmD 0.72
PF02233PNTB 0.72
PF01717Meth_synt_2 0.72

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 138 Family Scaffolds
COG06542-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductasesEnergy production and conversion [C] 2.90
COG1538Outer membrane protein TolCCell wall/membrane/envelope biogenesis [M] 2.90
COG0014Gamma-glutamyl phosphate reductaseAmino acid transport and metabolism [E] 1.45
COG0240Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 1.45
COG0287Prephenate dehydrogenaseAmino acid transport and metabolism [E] 1.45
COG0451Nucleoside-diphosphate-sugar epimeraseCell wall/membrane/envelope biogenesis [M] 1.45
COG0578Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 1.45
COG0605Superoxide dismutaseInorganic ion transport and metabolism [P] 1.45
COG0644Dehydrogenase (flavoprotein)Energy production and conversion [C] 1.45
COG0649NADH:ubiquinone oxidoreductase 49 kD subunit (chain D)Energy production and conversion [C] 1.45
COG0665Glycine/D-amino acid oxidase (deaminating)Amino acid transport and metabolism [E] 1.45
COG0677UDP-N-acetyl-D-mannosaminuronate dehydrogenaseCell wall/membrane/envelope biogenesis [M] 1.45
COG0702Uncharacterized conserved protein YbjT, contains NAD(P)-binding and DUF2867 domainsGeneral function prediction only [R] 1.45
COG1004UDP-glucose 6-dehydrogenaseCell wall/membrane/envelope biogenesis [M] 1.45
COG1012Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenaseLipid transport and metabolism [I] 1.45
COG1086NDP-sugar epimerase, includes UDP-GlcNAc-inverting 4,6-dehydratase FlaA1 and capsular polysaccharide biosynthesis protein EpsCCell wall/membrane/envelope biogenesis [M] 1.45
COG12503-hydroxyacyl-CoA dehydrogenaseLipid transport and metabolism [I] 1.45
COG1748Saccharopine dehydrogenase, NADP-dependentAmino acid transport and metabolism [E] 1.45
COG20843-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenaseLipid transport and metabolism [I] 1.45
COG2162Arylamine N-acetyltransferaseSecondary metabolites biosynthesis, transport and catabolism [Q] 1.45
COG3181Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctCEnergy production and conversion [C] 1.45
COG3261Ni,Fe-hydrogenase III large subunitEnergy production and conversion [C] 1.45
COG3342Uncharacterized conserved protein, Ntn-hydrolase superfamilyGeneral function prediction only [R] 1.45
COG4230Delta 1-pyrroline-5-carboxylate dehydrogenaseAmino acid transport and metabolism [E] 1.45
COG0039Malate/lactate dehydrogenaseEnergy production and conversion [C] 0.72
COG0064Asp-tRNAAsn/Glu-tRNAGln amidotransferase B subunitTranslation, ribosomal structure and biogenesis [J] 0.72
COG0169Shikimate 5-dehydrogenaseAmino acid transport and metabolism [E] 0.72
COG0216Protein chain release factor RF1Translation, ribosomal structure and biogenesis [J] 0.72
COG0496Broad specificity polyphosphatase and 5'/3'-nucleotidase SurEReplication, recombination and repair [L] 0.72
COG0620Methionine synthase II (cobalamin-independent)Amino acid transport and metabolism [E] 0.72
COG1087UDP-glucose 4-epimeraseCell wall/membrane/envelope biogenesis [M] 0.72
COG1088dTDP-D-glucose 4,6-dehydrataseCell wall/membrane/envelope biogenesis [M] 0.72
COG1089GDP-D-mannose dehydrataseCell wall/membrane/envelope biogenesis [M] 0.72
COG1090NAD dependent epimerase/dehydratase family enzymeGeneral function prediction only [R] 0.72
COG1091dTDP-4-dehydrorhamnose reductaseCell wall/membrane/envelope biogenesis [M] 0.72
COG1186Protein chain release factor PrfBTranslation, ribosomal structure and biogenesis [J] 0.72
COG1282NAD/NADP transhydrogenase beta subunitEnergy production and conversion [C] 0.72
COG1314Protein translocase subunit SecGIntracellular trafficking, secretion, and vesicular transport [U] 0.72
COG1486Alpha-galactosidase/6-phospho-beta-glucosidase, family 4 of glycosyl hydrolaseCarbohydrate transport and metabolism [G] 0.72
COG1784TctA family transporterGeneral function prediction only [R] 0.72
COG1841Ribosomal protein L30/L7ETranslation, ribosomal structure and biogenesis [J] 0.72
COG1905NADH:ubiquinone oxidoreductase 24 kD subunit (chain E)Energy production and conversion [C] 0.72
COG2009Succinate dehydrogenase/fumarate reductase, cytochrome b subunitEnergy production and conversion [C] 0.72
COG20792-methylcitrate dehydratase PrpDCarbohydrate transport and metabolism [G] 0.72
COG2142Succinate dehydrogenase, hydrophobic anchor subunitEnergy production and conversion [C] 0.72
COG2175Taurine dioxygenase, alpha-ketoglutarate-dependentSecondary metabolites biosynthesis, transport and catabolism [Q] 0.72
COG2180Nitrate reductase assembly protein NarJ, required for insertion of molybdenum cofactorPosttranslational modification, protein turnover, chaperones [O] 0.72
COG2511Archaeal Glu-tRNAGln amidotransferase subunit E, contains GAD domainTranslation, ribosomal structure and biogenesis [J] 0.72
COG3114Heme exporter protein DIntracellular trafficking, secretion, and vesicular transport [U] 0.72
COG3156Type II secretory pathway, component PulKIntracellular trafficking, secretion, and vesicular transport [U] 0.72
COG3333TctA family transporterGeneral function prediction only [R] 0.72
COG3346Cytochrome oxidase assembly protein ShyY1Posttranslational modification, protein turnover, chaperones [O] 0.72
COG37342-keto-3-deoxy-galactonokinaseCarbohydrate transport and metabolism [G] 0.72
COG5267Uncharacterized conserved protein, DUF1800 familyFunction unknown [S] 0.72


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms80.43 %
UnclassifiedrootN/A19.57 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300005543|Ga0070672_100022076All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales4667Open in IMG/M
3300005543|Ga0070672_100045565All Organisms → cellular organisms → Bacteria → Proteobacteria3393Open in IMG/M
3300005560|Ga0066670_10019407All Organisms → cellular organisms → Bacteria → Proteobacteria3129Open in IMG/M
3300005561|Ga0066699_10034286All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2978Open in IMG/M
3300005561|Ga0066699_10772724All Organisms → cellular organisms → Bacteria679Open in IMG/M
3300005576|Ga0066708_10096187All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1752Open in IMG/M
3300005587|Ga0066654_10869211Not Available516Open in IMG/M
3300005598|Ga0066706_10564308All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium 13_1_20CM_4_70_13904Open in IMG/M
3300005617|Ga0068859_100027879Not Available5663Open in IMG/M
3300005617|Ga0068859_100043962All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria4489Open in IMG/M
3300005618|Ga0068864_100334687All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1425Open in IMG/M
3300005840|Ga0068870_10011872All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria4054Open in IMG/M
3300005841|Ga0068863_100100485All Organisms → cellular organisms → Bacteria → Proteobacteria2749Open in IMG/M
3300005843|Ga0068860_100043996All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria4257Open in IMG/M
3300006032|Ga0066696_10651870Not Available680Open in IMG/M
3300006046|Ga0066652_101793457Not Available555Open in IMG/M
3300006057|Ga0075026_100880214All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria549Open in IMG/M
3300006172|Ga0075018_10654129All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300006173|Ga0070716_101349982All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Ralstonia → Ralstonia solanacearum578Open in IMG/M
3300006175|Ga0070712_100457393All Organisms → cellular organisms → Bacteria → Proteobacteria1064Open in IMG/M
3300006797|Ga0066659_10784040All Organisms → cellular organisms → Bacteria → Proteobacteria787Open in IMG/M
3300009012|Ga0066710_100043824All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales5438Open in IMG/M
3300009012|Ga0066710_100106312All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria3774Open in IMG/M
3300009038|Ga0099829_10994462Not Available696Open in IMG/M
3300009075|Ga0105090_10019243All Organisms → cellular organisms → Bacteria → Proteobacteria4185Open in IMG/M
3300009090|Ga0099827_10262514All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1454Open in IMG/M
3300009090|Ga0099827_11179282All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria666Open in IMG/M
3300009090|Ga0099827_11790575All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium535Open in IMG/M
3300009137|Ga0066709_100001202All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria16536Open in IMG/M
3300009137|Ga0066709_100007401All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria9484Open in IMG/M
3300009137|Ga0066709_100176531All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Azoarcus → unclassified Azoarcus → Azoarcus sp.2774Open in IMG/M
3300009137|Ga0066709_100181974All Organisms → cellular organisms → Bacteria2737Open in IMG/M
3300009137|Ga0066709_100215046All Organisms → cellular organisms → Bacteria → Proteobacteria2539Open in IMG/M
3300009137|Ga0066709_100388733All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1931Open in IMG/M
3300009553|Ga0105249_10046572All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria3947Open in IMG/M
3300010880|Ga0126350_10898414All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1061Open in IMG/M
3300011432|Ga0137428_1147002All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia691Open in IMG/M
3300011444|Ga0137463_1096867All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1110Open in IMG/M
3300011445|Ga0137427_10479310Not Available511Open in IMG/M
3300012198|Ga0137364_10112917All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1928Open in IMG/M
3300012201|Ga0137365_10067323All Organisms → cellular organisms → Bacteria → Proteobacteria2701Open in IMG/M
3300012201|Ga0137365_10069774All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales2651Open in IMG/M
3300012201|Ga0137365_10775957Not Available700Open in IMG/M
3300012202|Ga0137363_10608840All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium922Open in IMG/M
3300012206|Ga0137380_10370709All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae1275Open in IMG/M
3300012206|Ga0137380_10450465All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1138Open in IMG/M
3300012206|Ga0137380_10675233All Organisms → cellular organisms → Bacteria → Proteobacteria898Open in IMG/M
3300012207|Ga0137381_10171220All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1875Open in IMG/M
3300012207|Ga0137381_10256988All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Flammeovirgaceae → Flexithrix → Flexithrix dorotheae1519Open in IMG/M
3300012207|Ga0137381_10433602All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1147Open in IMG/M
3300012207|Ga0137381_10577946All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria979Open in IMG/M
3300012207|Ga0137381_10621766All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium941Open in IMG/M
3300012208|Ga0137376_11414579All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300012209|Ga0137379_10029661All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales5265Open in IMG/M
3300012209|Ga0137379_10137767All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2344Open in IMG/M
3300012209|Ga0137379_11068035All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium713Open in IMG/M
3300012210|Ga0137378_10023752All Organisms → cellular organisms → Bacteria → Proteobacteria5398Open in IMG/M
3300012210|Ga0137378_10024431All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae5327Open in IMG/M
3300012210|Ga0137378_10047673All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3848Open in IMG/M
3300012210|Ga0137378_10287903All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1528Open in IMG/M
3300012210|Ga0137378_10703567All Organisms → cellular organisms → Bacteria → Proteobacteria921Open in IMG/M
3300012349|Ga0137387_10065801All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2457Open in IMG/M
3300012349|Ga0137387_10096588All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2053Open in IMG/M
3300012350|Ga0137372_10022024All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria5947Open in IMG/M
3300012350|Ga0137372_10302244Not Available1240Open in IMG/M
3300012351|Ga0137386_10367162Not Available1036Open in IMG/M
3300012351|Ga0137386_10369952All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Palaeoptera → Ephemeroptera → Furcatergalia → Scapphodonta → Ephemeridae → Ephemera → Ephemera danica1032Open in IMG/M
3300012354|Ga0137366_10506924All Organisms → cellular organisms → Bacteria871Open in IMG/M
3300012354|Ga0137366_10562053All Organisms → cellular organisms → Bacteria → Proteobacteria820Open in IMG/M
3300012356|Ga0137371_10142492All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1878Open in IMG/M
3300012356|Ga0137371_10873022All Organisms → cellular organisms → Bacteria → Proteobacteria684Open in IMG/M
3300012357|Ga0137384_10187119All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales1733Open in IMG/M
3300012357|Ga0137384_10314894All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1300Open in IMG/M
3300012357|Ga0137384_11383271All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium552Open in IMG/M
3300012358|Ga0137368_10089468All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales2425Open in IMG/M
3300012359|Ga0137385_10060396All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae3378Open in IMG/M
3300012359|Ga0137385_10716802All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium835Open in IMG/M
3300012359|Ga0137385_11401698All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300012361|Ga0137360_10943261All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium744Open in IMG/M
3300012684|Ga0136614_10090220All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2324Open in IMG/M
3300012917|Ga0137395_10060739All Organisms → cellular organisms → Bacteria → Proteobacteria2410Open in IMG/M
3300012929|Ga0137404_10763896Not Available877Open in IMG/M
3300012971|Ga0126369_10104428All Organisms → cellular organisms → Bacteria → Proteobacteria2573Open in IMG/M
3300012977|Ga0134087_10744632Not Available524Open in IMG/M
3300014326|Ga0157380_13059667All Organisms → cellular organisms → Bacteria → Proteobacteria533Open in IMG/M
3300015371|Ga0132258_10013021All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria17584Open in IMG/M
3300015371|Ga0132258_10080482All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales7595Open in IMG/M
3300015371|Ga0132258_10172966All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales5209Open in IMG/M
3300015371|Ga0132258_10180610All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Prosthecomicrobium → Prosthecomicrobium hirschii5099Open in IMG/M
3300015371|Ga0132258_10184341All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria5049Open in IMG/M
3300015371|Ga0132258_10467607All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales3147Open in IMG/M
3300017930|Ga0187825_10012642All Organisms → cellular organisms → Bacteria → Proteobacteria2827Open in IMG/M
3300018071|Ga0184618_10020680All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2152Open in IMG/M
3300018071|Ga0184618_10056015All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1447Open in IMG/M
3300018083|Ga0184628_10040638All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales2335Open in IMG/M
3300018431|Ga0066655_10562986Not Available763Open in IMG/M
3300018431|Ga0066655_10920320All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri599Open in IMG/M
3300018431|Ga0066655_10927560Not Available597Open in IMG/M
3300018431|Ga0066655_11329152All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium necroappetens517Open in IMG/M
3300018482|Ga0066669_10031646All Organisms → cellular organisms → Bacteria → Proteobacteria3132Open in IMG/M
3300018482|Ga0066669_10126332All Organisms → cellular organisms → Bacteria1833Open in IMG/M
3300020004|Ga0193755_1171442All Organisms → cellular organisms → Bacteria → Proteobacteria643Open in IMG/M
3300020006|Ga0193735_1010038All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales2982Open in IMG/M
3300021478|Ga0210402_10017129All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales6214Open in IMG/M
3300021478|Ga0210402_11106762All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria719Open in IMG/M
3300022756|Ga0222622_11253142Not Available546Open in IMG/M
3300025910|Ga0207684_10009323All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales8673Open in IMG/M
3300025922|Ga0207646_10127808All Organisms → cellular organisms → Bacteria2286Open in IMG/M
3300025922|Ga0207646_10311629All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1422Open in IMG/M
3300025922|Ga0207646_10507326Not Available1086Open in IMG/M
3300026088|Ga0207641_12269512All Organisms → cellular organisms → Bacteria → Proteobacteria542Open in IMG/M
3300026089|Ga0207648_10013019All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria7760Open in IMG/M
3300026320|Ga0209131_1016274All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales4534Open in IMG/M
3300026320|Ga0209131_1348998All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium550Open in IMG/M
3300026326|Ga0209801_1144775Not Available1005Open in IMG/M
3300026334|Ga0209377_1175934All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium759Open in IMG/M
3300026523|Ga0209808_1181199Not Available746Open in IMG/M
3300026523|Ga0209808_1322876All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria500Open in IMG/M
3300026550|Ga0209474_10046618All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae3125Open in IMG/M
3300027775|Ga0209177_10284595Not Available624Open in IMG/M
3300030339|Ga0311360_10482861Not Available994Open in IMG/M
3300031521|Ga0311364_10638406All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → unclassified Candidatus Accumulibacter → Candidatus Accumulibacter sp. SK-111073Open in IMG/M
3300031996|Ga0308176_12153869Not Available595Open in IMG/M
3300032397|Ga0315287_10119602All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria3015Open in IMG/M
3300032397|Ga0315287_12480269Not Available557Open in IMG/M
3300033433|Ga0326726_10003389All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria14627Open in IMG/M
3300033433|Ga0326726_10011616All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales7763Open in IMG/M
3300033433|Ga0326726_10016808All Organisms → cellular organisms → Bacteria6367Open in IMG/M
3300033433|Ga0326726_10080788All Organisms → cellular organisms → Bacteria → Proteobacteria2881Open in IMG/M
3300034090|Ga0326723_0166920All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium970Open in IMG/M
3300034090|Ga0326723_0349050Not Available668Open in IMG/M
3300034115|Ga0364945_0270502All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei → Burkholderia pseudomallei 1710b526Open in IMG/M
3300034150|Ga0364933_098769All Organisms → cellular organisms → Bacteria → Proteobacteria738Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil33.33%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil11.59%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil10.87%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.35%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil4.35%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere4.35%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere4.35%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil2.90%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment2.17%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.17%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.17%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.45%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.45%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment1.45%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.45%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.45%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.72%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.72%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.72%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand0.72%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.72%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.72%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.72%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.72%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.72%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.72%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.72%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.72%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.72%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.72%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006057Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012EnvironmentalOpen in IMG/M
3300006172Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009075Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015EnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010880Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011398Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT600_2EnvironmentalOpen in IMG/M
3300011432Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT718_2EnvironmentalOpen in IMG/M
3300011444Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2EnvironmentalOpen in IMG/M
3300011445Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT700_2EnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012358Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012684Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06)EnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300017930Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5EnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018083Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1EnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019882Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2EnvironmentalOpen in IMG/M
3300020004Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2EnvironmentalOpen in IMG/M
3300020006Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2EnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes)EnvironmentalOpen in IMG/M
3300026334Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes)EnvironmentalOpen in IMG/M
3300026523Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes)EnvironmentalOpen in IMG/M
3300026547Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes)EnvironmentalOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300027902Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes)EnvironmentalOpen in IMG/M
3300030339III_Bog_N1 coassemblyEnvironmentalOpen in IMG/M
3300031521III_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032397Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0EnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300034090Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00NEnvironmentalOpen in IMG/M
3300034115Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17EnvironmentalOpen in IMG/M
3300034150Sediment microbial communities from East River floodplain, Colorado, United States - 25_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0070672_10002207643300005543Miscanthus RhizosphereMSAAGPSQGAKGAPSGGSAAAELTNETASVGVVR*
Ga0070672_10004556523300005543Miscanthus RhizosphereMTMSAAGPSQGANCAPFGGSAAAELANEAASVGVQ*
Ga0066670_1001940723300005560SoilMSDMSAAGPSQGAHCSPSGGSAAAELINEAASVGVV*
Ga0066699_1003428643300005561SoilMSAAGPSQGANSSPSGGSAAAEWVNEAASVGAHI*
Ga0066699_1077272423300005561SoilMSAAGPPQGANCSPAFGGSAAAELVNEAASVGVHK*
Ga0066708_1009618723300005576SoilRDAGGKRMSAAEPYHYAGAPAFGGSAAAELATQLANEAASVGVVP*
Ga0066654_1086921113300005587SoilMSAAGPPQGANFAPTGGSAAAEFANEAASVGVHICAAG
Ga0066706_1056430823300005598SoilMSAAGPPQGANCAPAFGGSAAAEWVNEAASVGAHP
Ga0068859_10002787923300005617Switchgrass RhizosphereMSAAGPLQGAHGSPSGGSDAAEWANEAASVGALK*
Ga0068859_10004396213300005617Switchgrass RhizosphereQMSAAGPPQGANSAPSGGSAAAELDNEAASVEAHR*
Ga0068864_10033468723300005618Switchgrass RhizosphereMSAMSAAGPPQGANCSPSGGSEAAELDNAAASVGVQ*
Ga0068870_1001187233300005840Miscanthus RhizosphereMSAAGPSQGANSSPSGGSVAAEFVYEAASVGALQ*
Ga0068863_10010048523300005841Switchgrass RhizosphereMSAAGPSQGANSSPSGGSVAAEFVYAAASAGALQ*
Ga0068860_10004399653300005843Switchgrass RhizosphereMSAAGPPQGANSAPSGGSAAAELDNEAASVEAHR*
Ga0066696_1065187023300006032SoilMSAAGPPQGANCAPAFGGSAAAELANELANEAASVGVHQ*
Ga0066652_10179345723300006046SoilMSAAEPFHGAGAPSFGGSAAVDLANELANEAASVGVHS
Ga0075026_10088021423300006057WatershedsMSTTLSAIMSAAGPPEGANRSPSGGSAAAEWVNEAAGVGAVI*
Ga0075018_1065412913300006172WatershedsASKDTGGIRVMSADGPPQGANCSAPGGSAAAEWANEAASVGAHQ*
Ga0070716_10134998213300006173Corn, Switchgrass And Miscanthus RhizosphereHMSAAGPPQGANSAPTEGSAAAALANPAASVGGP*
Ga0070712_10045739313300006175Corn, Switchgrass And Miscanthus RhizosphereMSGAGPSQAASCAPNGGSAAAERANEAASVGVLK*
Ga0066659_1078404013300006797SoilGRLRDAEVEFMSAAGPPQGANCSPAFGGSAAAELANEAASVGVQ*
Ga0066710_10004382423300009012Grasslands SoilMSAAGPPQSANCAPAFGGSAAAEWVNEAASVGVVA
Ga0066710_10010631233300009012Grasslands SoilMSAAGPPQGANCSPAFGGSAAAEWVNEAASVGVLT
Ga0099829_1099446223300009038Vadose Zone SoilMSAAEPFHGAGAPSGGSAAVELANELAHEAASVGVLP*
Ga0105090_1001924343300009075Freshwater SedimentMSAAGPSQGANRAPSGGSAAAEWVNEAASVGAHQ*
Ga0099827_1026251423300009090Vadose Zone SoilMSAAEPYHCAGAPALGGSAAAELANELANEAASVGAQQ*
Ga0099827_1117928213300009090Vadose Zone SoilMAMSAAEPYHCAGAPAFGGSAAGELVNEAASVGVLQ*
Ga0099827_1179057523300009090Vadose Zone SoilMSAAEPFHGAGAPVFRGSAAAEFVNEAASVGVHP*
Ga0066709_100001202133300009137Grasslands SoilMSDAGPPQGANCAPAFGGSAAAEFANEAASVGAQ*
Ga0066709_10000740193300009137Grasslands SoilMSAAGPPQGANFAPTGGSAAAEFANEAASLGVQS*
Ga0066709_10017653123300009137Grasslands SoilMSAAEPYHCAGAPAFGGSAAAELANEAASVGVLP*
Ga0066709_10018197443300009137Grasslands SoilMSAAEPFHGAGTPAFGGSAAAELINEAASVGAHQ*
Ga0066709_10021504643300009137Grasslands SoilMSAAGPPQGANCSPALGGSAAAELANELSNEAASVGAHQ*
Ga0066709_10038873323300009137Grasslands SoilMSAAEPFHGAGAPSFGGSAAVDLANELANEAASVGVHS*
Ga0105249_1004657243300009553Switchgrass RhizosphereMSAAGPSQGANSSPSGGSVAAEFVYAAASAGALR*
Ga0126350_1089841413300010880Boreal Forest SoilMSAAGPPQGANCAPAFGGSAAAELANEAASVGVQS
Ga0137348_107683923300011398SoilMSAAGPSQGANCSPAGGSEAASAASVGGTYRAAGPS
Ga0137428_114700223300011432SoilMSAAGPPQGANCAPPGGSAAASLANEAASVGAHQIGIG
Ga0137463_109686723300011444SoilMSTAGLPQGANCSPSGGSAAAELAAELATELANKAASVGAQ*
Ga0137427_1047931013300011445SoilMDIAMSAAGPSQGANYSPSGGSAAAELANEAATVG
Ga0137364_1011291713300012198Vadose Zone SoilMSAAGPSQGANYSPPGGSAAATAASVGVYLDPPALGFGTL
Ga0137365_1006732363300012201Vadose Zone SoilMSAAEPSHGAGAPAFEGSAAAELANEAASVGVHQ*
Ga0137365_1006977453300012201Vadose Zone SoilMSAAEPFHGAGAPAFGGSAAAELANEAASVGVNDSD*
Ga0137365_1077595723300012201Vadose Zone SoilGMSAAGPPQGANCAPAFGGSAAAELAKEAASVRVHMSVGARA*
Ga0137363_1060884013300012202Vadose Zone SoilMSAAEPFHGVGAPAFGGGAAAELATQLANEAASVGVVP*
Ga0137380_1037070923300012206Vadose Zone SoilMSAAEPFHGAGAPALAGSAAAELVNEAASVGVHL*
Ga0137380_1045046523300012206Vadose Zone SoilMSAAERPHGAGAPYRGSAAAELVNELAKEAASVGVQQ*
Ga0137380_1067523323300012206Vadose Zone SoilMARSSLMSATEPFHGAGAPAFGGSAAAELANEAASVGV
Ga0137381_1017122023300012207Vadose Zone SoilMSAAEPFHGADAPAFGASAAAELATQLATQLANEAASVGVVP*
Ga0137381_1025698823300012207Vadose Zone SoilVLGDPPTVMSAAGPPQGANGAPAFGGSAAAELSNEAASVGVQ*
Ga0137381_1043360223300012207Vadose Zone SoilMSAAEPFHGAGAPAFGGSAAAELVNEAANVGVHQ*
Ga0137381_1057794633300012207Vadose Zone SoilMSAPGPPQGVNCAPAFGGSAAAEFNEAASGGGYFHER
Ga0137381_1062176613300012207Vadose Zone SoilMSAAEPFHGAGAPAFGGSAAPQLANELANEAASVRVVP*
Ga0137376_1141457913300012208Vadose Zone SoilMSAAGPSQGANYSPFGGRGQSVAAELANEAASVGVR*
Ga0137379_1002966153300012209Vadose Zone SoilMSATEPFHGAGAPAFGGSAAAELANEAASVGVLP*
Ga0137379_1013776723300012209Vadose Zone SoilMSAAEPLHGAGTPAFGGSAAAELDNEAASVGVHQ*
Ga0137379_1106803523300012209Vadose Zone SoilMSAAEPFHGAGAPAFGGSAAAQLANELANEAASVGVH
Ga0137378_1002375223300012210Vadose Zone SoilMSAADPFYGAGTPAFGGSAAAELTTQLTNEAASVGVLQ*
Ga0137378_1002443133300012210Vadose Zone SoilMSAAESLHGAGTPAFGGSAAAELANELATEAASVGGHQ*
Ga0137378_1004767323300012210Vadose Zone SoilMSAAGPPQGANCAPAFGGSAAAELANEAASVGVHQ*
Ga0137378_1028790313300012210Vadose Zone SoilMSGNMSAAGLSQGANCAPAFGGSAAAELVNEAASVGVHQ*
Ga0137378_1070356723300012210Vadose Zone SoilVEAEADMNTAGPPQGVNCAPAFGGSAAAELANELANEAASVGVLP*
Ga0137387_1006580143300012349Vadose Zone SoilMSAAEPFHGAGAPAFGGSAAAELVSEAASVGALQ*
Ga0137387_1009658823300012349Vadose Zone SoilMSAAEPFHGAGAPAVGGSATAELSTQLANEAASVGVVP*
Ga0137372_1002202473300012350Vadose Zone SoilMSAAEPSRGAGAPAFGGSAAAQLANELANEAASVGVH*
Ga0137372_1030224413300012350Vadose Zone SoilMSAAGPPQGANCTPFGGSAAAELANEAASVGEHICAA
Ga0137386_1036716233300012351Vadose Zone SoilMSAAEPFHGAGAPAFGGSAAAELVSEAASVGVHQ*
Ga0137386_1036995213300012351Vadose Zone SoilMSAAGPPQGANCAPLGGSAAAEVANELANEAASVG
Ga0137366_1050692423300012354Vadose Zone SoilMSAAEPFHGAGAPAFGGSAAAELANEAASVGVNDRD*
Ga0137366_1056205323300012354Vadose Zone SoilMARSNLMSATEPPQGANCAPAFGGSAAAELANEAASVGV
Ga0137371_1014249223300012356Vadose Zone SoilMSAAERFHGAGAPAFGGSAAAELSNEAASVGVVA*
Ga0137371_1087302213300012356Vadose Zone SoilMSAAEPPQGANCAPAFGGSAAAELANEAASVGVHICAA
Ga0137384_1018711933300012357Vadose Zone SoilMSAAGPPQGANGAPAFGGSAAAEFANEAASVGVHP
Ga0137384_1031489433300012357Vadose Zone SoilMSATERFHGAGAPAFGGSAAAELANEATSVGVLP*
Ga0137384_1138327123300012357Vadose Zone SoilRAAGPPQGASCAPSGGSAAAKLANEWVNEAASVGVHH*
Ga0137368_1008946833300012358Vadose Zone SoilMSAAGPPQGANCAPSGGSAEAELANKASVGVHQDALL
Ga0137385_1006039623300012359Vadose Zone SoilMSAAERFHGAGAPAFGGSAAAELSNEAASVGVVP*
Ga0137385_1071680213300012359Vadose Zone SoilIHENFFLFVEAEADMNAAGPPQGVNCAPAFGGSAAAEFNEAASVGVLP*
Ga0137385_1140169813300012359Vadose Zone SoilYIRRIMSAAGPPQGANCAPAFGGSVAAEWVNEAASVGVV*
Ga0137360_1094326123300012361Vadose Zone SoilMSAAEPFHGAGARAFGGSTAAELVNEAASVGVLT*
Ga0136614_1009022033300012684Polar Desert SandMSDAEPSQGANYSHSGGSAAAAELANEAASVGGP*
Ga0137395_1006073943300012917Vadose Zone SoilMSAAEPYDGAGAPAFGGSAAAELTNEAASVGGLP*
Ga0137404_1076389613300012929Vadose Zone SoilMSAGGPPQGANCAPFGGSAAAELANEAASVGVHHRAEEI
Ga0126369_1010442843300012971Tropical Forest SoilMSAAGPSQGANCAPAFGGSAAAELINEAASVGVL*
Ga0134087_1074463223300012977Grasslands SoilMSAAGPPQGANCSPALGGSAAAELANELSNEAASVG
Ga0157380_1305966723300014326Switchgrass RhizosphereVMSAAGPSQGANCSPSGGSAAAELANEAASVGAVQ*
Ga0132258_1001302113300015371Arabidopsis RhizosphereMSAAGPSQGANWSPSGGSEAAELDNEAASVGVHP*
Ga0132258_1008048243300015371Arabidopsis RhizosphereMSAAWPSQGANCFPLGGSAAAELANEAASVGAHR*
Ga0132258_1017296643300015371Arabidopsis RhizosphereMSGEGPRRGANYAPFGGSAAAELANEAASVGVDP*
Ga0132258_1018061033300015371Arabidopsis RhizosphereMSAAGPSQGANCSPSGGSAAAELANEAASVGAVK*
Ga0132258_1018434123300015371Arabidopsis RhizosphereMSAAGPSQGANYAPSGGSAAAELINEAASVGVQL*
Ga0132258_1046760733300015371Arabidopsis RhizosphereMSAAGPSQGANSAPSGGSAAAEFDNEAASVGANR*
Ga0187825_1001264213300017930Freshwater SedimentMSAAGPPQGAHCAPAFGGSVAAELADEAASVGVLE
Ga0184618_1002068063300018071Groundwater SedimentKNMRTSMNTMSAAGPSQGANCSPYGGSEAAKAASVGGPK
Ga0184618_1005601543300018071Groundwater SedimentMSAAGPSQGANSTPSGGSAAAELTNEAASVGTHQSA
Ga0184628_1004063823300018083Groundwater SedimentMGVMSAAGPSQGENCPHSGSSAAAELDNEAAGMGVV
Ga0066655_1056298623300018431Grasslands SoilAGMSAAGPPQGANGAHAVGGSAAAELINEAASVGVV
Ga0066655_1092032023300018431Grasslands SoilMSAAGPPRGANWSPDFGGSAAAELANEAASVRVHE
Ga0066655_1092756023300018431Grasslands SoilMSAAGPSQGANCAPAFGGSAAAELTNEAGSVGVLP
Ga0066655_1132915213300018431Grasslands SoilMRLSAAGPSQGARAPSGGSAAAELATELANEAASV
Ga0066669_1003164623300018482Grasslands SoilMSADGPSRGANCVPSGGSEAAELVNEAASVGAVHHARMQP
Ga0066669_1012633233300018482Grasslands SoilMTAMSAAGPPQGANCSPAFEGSAAAEWVNEAASVGVV
Ga0193713_119381923300019882SoilMSTAGPPQGANSAPFGGSAAASAASVGVVNRTAGPPQAAGLRA
Ga0193755_117144213300020004SoilMVSAAGPPQGANNSPSGRSAAAELDNEAASVGVPSE
Ga0193735_101003843300020006SoilMSAAGPSQGVNYSPFGGRGQSVAAELANEAASVGDQP
Ga0210402_1001712923300021478SoilMSAAGPPQGANRSPAFGGSAAAQLATEWANEAASVGAQQ
Ga0210402_1110676223300021478SoilMSAAGPPQGANCAPAFGGSAAAELANELANEAASVGAHQ
Ga0222622_1125314213300022756Groundwater SedimentMSAAGPPQGANSSPSGGSAAASAASVGAHFRVEDRHFED
Ga0207684_1000932393300025910Corn, Switchgrass And Miscanthus RhizosphereMSMSAAEPSHGVGAPPFGGSAEAELANEAASVGVHQ
Ga0207646_1012780823300025922Corn, Switchgrass And Miscanthus RhizosphereMSAAGPPQGANCALAFGGSAAAELVNEAASVGVHI
Ga0207646_1031162923300025922Corn, Switchgrass And Miscanthus RhizosphereMSAAEPFHGAGAPAFGGSAAAELANELANEAASVGVQ
Ga0207646_1050732613300025922Corn, Switchgrass And Miscanthus RhizosphereRKAAGMSMSAAEPSHGVGAPAFGGSAEAELANEAASVGVHQ
Ga0207641_1226951223300026088Switchgrass RhizosphereMSGAGPPQAANGAPSGGSAAAPAASVGAVPVPLLEVSG
Ga0207648_1001301933300026089Miscanthus RhizosphereMTMSAAGPSQGANCAPFGGSAAAELANEAASVGVQ
Ga0209131_101627443300026320Grasslands SoilMSAAGPSQGANYAPAFGGSAAAELTNEAASMGVHQ
Ga0209131_134899813300026320Grasslands SoilLHAMSAAEPFHGAGAPSGGSAAPELVNETASVGVL
Ga0209801_114477513300026326SoilGELMSAAEPYHCAGAPAFGGSAAAQLANELANEAASVEVLP
Ga0209377_117593413300026334SoilVEAEAHMNAAGPPHGVNCAPAFGGSAAAEFNEAASVGVLP
Ga0209808_118119913300026523SoilYGMSAAGPPQGANCSPAFGGSAAAELANELANEAASVGVHQ
Ga0209808_132287623300026523SoilGGKRMSAAEPYHCAGAPAFGGSAAAELATQLANEAASVGVVP
Ga0209156_1010983913300026547SoilMSAAGPPQGANSAPAFGGSAAAEWVNEAASVGVHICAAGPPQG
Ga0209474_1004661813300026550SoilMSGAGPSQAANCAPAFGGSAAAELSTQLANEAASVGAHQ
Ga0209177_1028459523300027775Agricultural SoilDMRAAGPPQGAHGAPAGGSAAAELANEAASVGALS
Ga0209048_10002328173300027902Freshwater Lake SedimentMNAAEPSQGAHRAPSGGSAAASFSLAASVGVQLSAAE
Ga0311360_1048286123300030339BogMSDVNMSAAGLSQGANRAPSGGSAAAKAASVGVQL
Ga0311364_1063840613300031521FenMSAAGPSQGANSSPSGGSAAAKLCLGASVGAHHLLHILH
Ga0308176_1215386913300031996SoilGPMSDAGPSQAANCAPSGGSEAAESANEAASVGVR
Ga0315287_1011960243300032397SedimentMSAAGPSQGANGAPPGGSAAAELANEAASVGAHQRA
Ga0315287_1160586213300032397SedimentMSAAGPPQGANGAPTGGKTAAPAASVGAVRSAPVLQ
Ga0315287_1248026923300032397SedimentMTGPVSAAGPSQGANYAPSGGSAAAKAASVGAHISEP
Ga0326726_10003389113300033433Peat SoilMSAAEPFHGAGAPDSGGSAAAQFAKLVANEAASVGVQ
Ga0326726_1001161613300033433Peat SoilMSAAEPFHGAGAPSGGSAAAELANELANEAASVGVL
Ga0326726_1001680823300033433Peat SoilMSAAEPLQGAGAPAFGGSAAAQLANELATQLANEAASVGVVP
Ga0326726_1008078843300033433Peat SoilMSAAEPYHCAGAPAFGGSAAAELANELAKEAASVGVHP
Ga0326723_0166920_862_9693300034090Peat SoilAVSAAGSPQGANRAPSGGSAAAELANEAASVGVHQ
Ga0326723_0349050_561_6683300034090Peat SoilMSAAEPYHCAGAPAFGGSAAAELANELANEAASVGV
Ga0364945_0270502_1_1083300034115SedimentMTTPKFRAAGPPQGANSAPSGGSAAAESTNEAASVG
Ga0364933_098769_1_1083300034150SedimentMSNTIRAAGPPQGANCAPSGGSAAARAASVGVVTPS


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.