NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F055983

Metagenome / Metatranscriptome Family F055983

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F055983
Family Type Metagenome / Metatranscriptome
Number of Sequences 138
Average Sequence Length 45 residues
Representative Sequence STWRLDSDGLLLTGRGGSWRFSESDATTWERIPASSDPLVLMRQ
Number of Associated Samples 126
Number of Associated Scaffolds 138

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.72 %
% of genes near scaffold ends (potentially truncated) 97.83 %
% of genes from short scaffolds (< 2000 bps) 93.48 %
Associated GOLD sequencing projects 117
AlphaFold2 3D model prediction Yes
3D model pTM-score0.52

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (96.377 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(11.594 % of family members)
Environment Ontology (ENVO) Unclassified
(22.464 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(42.029 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 30.56%    Coil/Unstructured: 69.44%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.52
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 138 Family Scaffolds
PF03972MmgE_PrpD 18.12
PF08450SGL 10.14
PF12697Abhydrolase_6 10.14
PF01875Memo 7.25
PF02617ClpS 2.90
PF02771Acyl-CoA_dh_N 2.17
PF04909Amidohydro_2 2.17
PF01042Ribonuc_L-PSP 1.45
PF03401TctC 0.72
PF00989PAS 0.72
PF02627CMD 0.72
PF00496SBP_bac_5 0.72
PF13426PAS_9 0.72
PF13592HTH_33 0.72
PF01546Peptidase_M20 0.72
PF069833-dmu-9_3-mt 0.72
PF01575MaoC_dehydratas 0.72
PF106053HBOH 0.72
PF07978NIPSNAP 0.72
PF04191PEMT 0.72
PF028262-Hacid_dh_C 0.72
PF01909NTP_transf_2 0.72
PF08448PAS_4 0.72
PF04828GFA 0.72
PF14015DUF4231 0.72

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 138 Family Scaffolds
COG20792-methylcitrate dehydratase PrpDCarbohydrate transport and metabolism [G] 18.12
COG3386Sugar lactone lactonase YvrECarbohydrate transport and metabolism [G] 10.14
COG3391DNA-binding beta-propeller fold protein YncEGeneral function prediction only [R] 10.14
COG1355Predicted class III extradiol dioxygenase, MEMO1 familyGeneral function prediction only [R] 7.25
COG2127ATP-dependent Clp protease adapter protein ClpSPosttranslational modification, protein turnover, chaperones [O] 2.90
COG1960Acyl-CoA dehydrogenase related to the alkylation response protein AidBLipid transport and metabolism [I] 2.17
COG0251Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 familyDefense mechanisms [V] 1.45
COG2764Zn-dependent glyoxalase, PhnB familyEnergy production and conversion [C] 0.72
COG3181Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctCEnergy production and conversion [C] 0.72
COG3791Uncharacterized conserved proteinFunction unknown [S] 0.72
COG3865Glyoxalase superfamily enzyme, possible 3-demethylubiquinone-9 3-methyltransferaseGeneral function prediction only [R] 0.72
COG0599Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase familyGeneral function prediction only [R] 0.72
COG2128Alkylhydroperoxidase family enzyme, contains CxxC motifInorganic ion transport and metabolism [P] 0.72


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.38 %
UnclassifiedrootN/A3.62 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000597|AF_2010_repII_A1DRAFT_10160468All Organisms → cellular organisms → Bacteria → Proteobacteria538Open in IMG/M
3300000955|JGI1027J12803_109283542All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → Methylobacterium nodulans1856Open in IMG/M
3300001661|JGI12053J15887_10076572All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1847Open in IMG/M
3300001976|JGI24752J21851_1027495All Organisms → cellular organisms → Bacteria → Proteobacteria747Open in IMG/M
3300003911|JGI25405J52794_10017632All Organisms → cellular organisms → Bacteria1420Open in IMG/M
3300004157|Ga0062590_101354711All Organisms → cellular organisms → Bacteria → Proteobacteria705Open in IMG/M
3300005294|Ga0065705_11050715All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales534Open in IMG/M
3300005332|Ga0066388_101938959All Organisms → cellular organisms → Bacteria → Proteobacteria1053Open in IMG/M
3300005332|Ga0066388_103756278All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae775Open in IMG/M
3300005332|Ga0066388_106324194All Organisms → cellular organisms → Bacteria → Proteobacteria597Open in IMG/M
3300005366|Ga0070659_101939732All Organisms → cellular organisms → Bacteria → Proteobacteria528Open in IMG/M
3300005440|Ga0070705_101736163All Organisms → cellular organisms → Bacteria → Proteobacteria528Open in IMG/M
3300005455|Ga0070663_100055155All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales2843Open in IMG/M
3300005471|Ga0070698_102011662All Organisms → cellular organisms → Bacteria → Proteobacteria531Open in IMG/M
3300005536|Ga0070697_100725086All Organisms → cellular organisms → Bacteria → Proteobacteria878Open in IMG/M
3300005560|Ga0066670_10111554All Organisms → cellular organisms → Bacteria → Proteobacteria1548Open in IMG/M
3300005578|Ga0068854_100727367All Organisms → cellular organisms → Bacteria → Proteobacteria859Open in IMG/M
3300005713|Ga0066905_100672259All Organisms → cellular organisms → Bacteria885Open in IMG/M
3300005764|Ga0066903_103088114All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales901Open in IMG/M
3300005764|Ga0066903_106264891All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria621Open in IMG/M
3300005764|Ga0066903_106694720All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria599Open in IMG/M
3300005841|Ga0068863_100270865All Organisms → cellular organisms → Bacteria → Proteobacteria1643Open in IMG/M
3300005981|Ga0081538_10047236All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales2643Open in IMG/M
3300006050|Ga0075028_100872052All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales553Open in IMG/M
3300006173|Ga0070716_100839170All Organisms → cellular organisms → Bacteria → Proteobacteria714Open in IMG/M
3300006175|Ga0070712_101512027All Organisms → cellular organisms → Bacteria → Proteobacteria587Open in IMG/M
3300006177|Ga0075362_10733565All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae517Open in IMG/M
3300006606|Ga0074062_12824542All Organisms → cellular organisms → Bacteria → Proteobacteria732Open in IMG/M
3300006806|Ga0079220_11733305All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria547Open in IMG/M
3300006844|Ga0075428_101793634All Organisms → cellular organisms → Bacteria → Proteobacteria639Open in IMG/M
3300006845|Ga0075421_102532080All Organisms → cellular organisms → Bacteria → Proteobacteria534Open in IMG/M
3300006846|Ga0075430_100285296All Organisms → cellular organisms → Bacteria → Proteobacteria1366Open in IMG/M
3300006854|Ga0075425_101050202All Organisms → cellular organisms → Bacteria929Open in IMG/M
3300006880|Ga0075429_100136624All Organisms → cellular organisms → Bacteria2145Open in IMG/M
3300006880|Ga0075429_101860214All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales522Open in IMG/M
3300006903|Ga0075426_10511033All Organisms → cellular organisms → Bacteria893Open in IMG/M
3300006904|Ga0075424_102371950All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales557Open in IMG/M
3300006969|Ga0075419_10126463All Organisms → cellular organisms → Bacteria → Proteobacteria1658Open in IMG/M
3300007076|Ga0075435_100490522All Organisms → cellular organisms → Bacteria1062Open in IMG/M
3300009088|Ga0099830_11185483All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria634Open in IMG/M
3300009094|Ga0111539_10084989All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root14623720Open in IMG/M
3300009098|Ga0105245_10411422All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1354Open in IMG/M
3300009100|Ga0075418_12579812All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium555Open in IMG/M
3300010043|Ga0126380_11966864All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria534Open in IMG/M
3300010046|Ga0126384_12288875All Organisms → cellular organisms → Bacteria521Open in IMG/M
3300010047|Ga0126382_10627974All Organisms → cellular organisms → Bacteria → Proteobacteria889Open in IMG/M
3300010047|Ga0126382_11464149All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales626Open in IMG/M
3300010359|Ga0126376_11093872All Organisms → cellular organisms → Bacteria805Open in IMG/M
3300010360|Ga0126372_10460148All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1182Open in IMG/M
3300010361|Ga0126378_13150741All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales525Open in IMG/M
3300010366|Ga0126379_11316591All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria829Open in IMG/M
3300010398|Ga0126383_10681701All Organisms → cellular organisms → Bacteria → Proteobacteria1105Open in IMG/M
3300010398|Ga0126383_12469870All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria604Open in IMG/M
3300011003|Ga0138514_100037573All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria941Open in IMG/M
3300011270|Ga0137391_11204638All Organisms → cellular organisms → Bacteria605Open in IMG/M
3300012189|Ga0137388_10788332Not Available881Open in IMG/M
3300012205|Ga0137362_10364845All Organisms → cellular organisms → Bacteria → Proteobacteria1251Open in IMG/M
3300012285|Ga0137370_10041536All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2436Open in IMG/M
3300012357|Ga0137384_10087488All Organisms → cellular organisms → Bacteria → Proteobacteria2592Open in IMG/M
3300012357|Ga0137384_10704125All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria820Open in IMG/M
3300012357|Ga0137384_11396467All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300012363|Ga0137390_11177795All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium714Open in IMG/M
3300012906|Ga0157295_10216836All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales620Open in IMG/M
3300012911|Ga0157301_10262549All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales613Open in IMG/M
3300012915|Ga0157302_10550206All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300012948|Ga0126375_12094772All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales502Open in IMG/M
3300012971|Ga0126369_13089349All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300012976|Ga0134076_10405768Not Available608Open in IMG/M
3300012977|Ga0134087_10396132All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales671Open in IMG/M
3300012985|Ga0164308_12215891All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria511Open in IMG/M
3300012989|Ga0164305_10577249All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria899Open in IMG/M
3300014260|Ga0075307_1105389All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales592Open in IMG/M
3300014326|Ga0157380_11331025All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides767Open in IMG/M
3300015371|Ga0132258_13842547All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1022Open in IMG/M
3300015372|Ga0132256_103491737All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium528Open in IMG/M
3300015373|Ga0132257_100194744All Organisms → cellular organisms → Bacteria → Proteobacteria2398Open in IMG/M
3300016341|Ga0182035_11516388All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales603Open in IMG/M
3300016387|Ga0182040_10433188All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1038Open in IMG/M
3300016404|Ga0182037_10510415All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1009Open in IMG/M
3300016445|Ga0182038_11256312All Organisms → cellular organisms → Bacteria661Open in IMG/M
3300017974|Ga0187777_10494280All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei854Open in IMG/M
3300017997|Ga0184610_1071473All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1061Open in IMG/M
3300018031|Ga0184634_10475292All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales561Open in IMG/M
3300018055|Ga0184616_10229836All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales700Open in IMG/M
3300018429|Ga0190272_11984701All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium615Open in IMG/M
3300018433|Ga0066667_10874735All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium771Open in IMG/M
3300018465|Ga0190269_11147326All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium605Open in IMG/M
3300018469|Ga0190270_13084721All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium527Open in IMG/M
3300018481|Ga0190271_11994365All Organisms → cellular organisms → Bacteria690Open in IMG/M
3300021560|Ga0126371_10861767All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1051Open in IMG/M
3300022756|Ga0222622_10737549All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria717Open in IMG/M
3300025906|Ga0207699_10058226All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2310Open in IMG/M
3300025927|Ga0207687_10745705All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales833Open in IMG/M
3300025928|Ga0207700_10148901All Organisms → cellular organisms → Bacteria1932Open in IMG/M
3300025929|Ga0207664_11334137All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria637Open in IMG/M
3300025932|Ga0207690_11330622All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria600Open in IMG/M
3300025935|Ga0207709_11451989All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales568Open in IMG/M
3300025939|Ga0207665_10356596All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1105Open in IMG/M
3300025961|Ga0207712_11263609All Organisms → cellular organisms → Bacteria659Open in IMG/M
3300025981|Ga0207640_10500327All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium1012Open in IMG/M
3300026304|Ga0209240_1053383All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1520Open in IMG/M
3300026494|Ga0257159_1028289All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales930Open in IMG/M
3300026540|Ga0209376_1350133Not Available558Open in IMG/M
3300027035|Ga0207776_1033948All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium639Open in IMG/M
3300027383|Ga0209213_1060045All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales713Open in IMG/M
3300027880|Ga0209481_10027021All Organisms → cellular organisms → Bacteria → Proteobacteria2576Open in IMG/M
3300027894|Ga0209068_10733181All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria580Open in IMG/M
3300028536|Ga0137415_10922438All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria683Open in IMG/M
3300028714|Ga0307309_10011828All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1582Open in IMG/M
3300028715|Ga0307313_10062727All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1102Open in IMG/M
3300028768|Ga0307280_10040941All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1421Open in IMG/M
3300028787|Ga0307323_10188720All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales744Open in IMG/M
3300028787|Ga0307323_10207301All Organisms → cellular organisms → Bacteria707Open in IMG/M
3300028799|Ga0307284_10222737All Organisms → cellular organisms → Bacteria745Open in IMG/M
3300028809|Ga0247824_10932449All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300028828|Ga0307312_10288802All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium1067Open in IMG/M
3300031640|Ga0318555_10314639All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium847Open in IMG/M
3300031679|Ga0318561_10818888All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria512Open in IMG/M
3300031681|Ga0318572_10694943All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria606Open in IMG/M
3300031724|Ga0318500_10500920All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria610Open in IMG/M
3300031771|Ga0318546_10129243All Organisms → cellular organisms → Bacteria1686Open in IMG/M
3300031777|Ga0318543_10243005All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria802Open in IMG/M
3300031779|Ga0318566_10605418All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria533Open in IMG/M
3300031793|Ga0318548_10277028All Organisms → cellular organisms → Bacteria824Open in IMG/M
3300031796|Ga0318576_10064332All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1618Open in IMG/M
3300031797|Ga0318550_10535204All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300031890|Ga0306925_10480841All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1324Open in IMG/M
3300031890|Ga0306925_10757489Not Available1011Open in IMG/M
3300031897|Ga0318520_10429630All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales810Open in IMG/M
3300031910|Ga0306923_10848776All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1004Open in IMG/M
3300031944|Ga0310884_10464463All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales738Open in IMG/M
3300031954|Ga0306926_12719264All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300031959|Ga0318530_10038233All Organisms → cellular organisms → Bacteria → Proteobacteria1758Open in IMG/M
3300032044|Ga0318558_10129655All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1202Open in IMG/M
3300032055|Ga0318575_10426659Not Available673Open in IMG/M
3300032055|Ga0318575_10489010All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria625Open in IMG/M
3300032179|Ga0310889_10736503All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales517Open in IMG/M
3300032261|Ga0306920_100823647All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1361Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil11.59%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil11.59%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil9.42%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere9.42%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil7.25%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil6.52%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil5.80%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.80%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.17%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.17%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.17%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.17%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere2.17%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.45%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.45%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.45%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.45%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.45%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.45%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.72%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.72%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.72%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.72%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.72%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.72%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.72%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.72%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.72%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.72%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.72%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.72%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.72%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere0.72%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere0.72%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.72%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.72%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.72%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000597Forest soil microbial communities from Amazon forest - 2010 replicate II A1EnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001661Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly)EnvironmentalOpen in IMG/M
3300001976Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7Host-AssociatedOpen in IMG/M
3300003911Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005366Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaGHost-AssociatedOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005981Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1Host-AssociatedOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006177Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2Host-AssociatedOpen in IMG/M
3300006606Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300011003Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015EnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012906Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1EnvironmentalOpen in IMG/M
3300012911Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2EnvironmentalOpen in IMG/M
3300012915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012976Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300014260Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D1_rdEnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300017997Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coexEnvironmentalOpen in IMG/M
3300018031Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1EnvironmentalOpen in IMG/M
3300018055Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_coexEnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018465Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 ISEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes)EnvironmentalOpen in IMG/M
3300026494Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-AEnvironmentalOpen in IMG/M
3300026540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes)EnvironmentalOpen in IMG/M
3300027035Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 30 (SPAdes)EnvironmentalOpen in IMG/M
3300027383Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027880Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)Host-AssociatedOpen in IMG/M
3300027894Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028714Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196EnvironmentalOpen in IMG/M
3300028715Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203EnvironmentalOpen in IMG/M
3300028768Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119EnvironmentalOpen in IMG/M
3300028787Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381EnvironmentalOpen in IMG/M
3300028799Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123EnvironmentalOpen in IMG/M
3300028809Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031944Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031959Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032179Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
AF_2010_repII_A1DRAFT_1016046813300000597Forest SoilASVTDIGLSTWRLDSDGLLLSGRGGSWRFSESDATTWERIPATSDPLVLMRQ*
JGI1027J12803_10928354243300000955SoilVADVELSTWRLDRDGLLLTGRGGSWRFSESDATTWERIPASSDPLVLMRQ*
JGI12053J15887_1007657213300001661Forest SoilDRDELVLAGPGGAWRFAESDTTTWERIPPSTDPLLLMRQ*
JGI24752J21851_102749513300001976Corn, Switchgrass And Miscanthus RhizosphereASVAGLGLSTWRLDPDGLLLSGSGGTWRFSESDPTTWERIPASTDPLVLMRQ*
JGI25405J52794_1001763213300003911Tabebuia Heterophylla RhizosphereGLTTWRLDPDGLLLSGNGGRWRFSESDATSWERIPASTDPMVLMRQ*
Ga0062590_10135471123300004157SoilGLGLSTWRLDPDGLLLSGSGGTWRFSESDPTTWERIPASTDPLVLMRE*
Ga0065705_1105071523300005294Switchgrass RhizosphereTFNPSTWRLDRDQLILTGRNGSWRFSESDATVWERVPLTVDPMLLVRQ*
Ga0066388_10193895913300005332Tropical Forest SoilPGCDPSVADVELSTWQLDSEGLLLTGRGGSWRFSESDATTWERIPASADPLVLMRQ*
Ga0066388_10375627813300005332Tropical Forest SoilWRIEINELVLVGPGGSWRFAESNDTTWERIPPSADPMVLLRQ*
Ga0066388_10632419413300005332Tropical Forest SoilPGCDPSVADVELSTWQLDSEGLLLTGRGGSWRFSESDATSWERIPASADPLVLMRQ*
Ga0070659_10193973223300005366Corn RhizosphereWRLDPDGLLLSGSGGTWRFSESDPTTWERIPASTDPLVLMRE*
Ga0070705_10173616313300005440Corn, Switchgrass And Miscanthus RhizosphereGCDASVADVELSTWRLDRDGLLLTGRGGSWRFSESDATTWERIPASSDPLVLMRQ*
Ga0070663_10005515543300005455Corn RhizosphereSVAGLGLSTWRLDPDGLLLSGSGGTWRFSESDPTTWERIPASTDPLVLMRQ*
Ga0070698_10201166213300005471Corn, Switchgrass And Miscanthus RhizosphereDVELSTWRLDRDGLLLTGRGGSWRFSESDATTWERIPASADPLVLMRQ*
Ga0070697_10072508623300005536Corn, Switchgrass And Miscanthus RhizosphereSTWRLDSDGLLLTGRGGSWRFSESDATTWERIPASSDPLVLMRQ*
Ga0066670_1011155413300005560SoilTWQLDSEGLLLTGRGGSWRFSESDATSWERIPASADPLVLMRQ*
Ga0068854_10072736723300005578Corn RhizosphereDPDGLLLSGSGGTWRFSESDPTTWERIPASTDPLVLMRE*
Ga0066905_10067225913300005713Tropical Forest SoilDGLLLSGRGGSWRFSESDATTWERIPATSDPLVLMRQ*
Ga0066903_10308811423300005764Tropical Forest SoilTWRIDSNELLLVGRGSTWRFSESDSTTWERIPPSSDPMVLMRQ*
Ga0066903_10626489113300005764Tropical Forest SoilLLLTGRGGSWRFSESDATTWERIPATSDPLVLMRQ*
Ga0066903_10669472023300005764Tropical Forest SoilDSDGLLLTGRGGSWRFSESDATTWERIPATSDPLVLMRQ*
Ga0068863_10027086533300005841Switchgrass RhizosphereLDPDGLLLSGSGGTWRFSESDPTTWERIPASTDPLVLMRQ*
Ga0081538_1004723613300005981Tabebuia Heterophylla RhizosphereDGLLLSGNGGRWRFSESDATSWERIPASTDPMVLMRQ*
Ga0075028_10087205213300006050WatershedsAAAINGLGLTAWRLEMNDLLLVGRGATWRFSESDATVWERIPPSTDPMLLMRQ*
Ga0070716_10083917013300006173Corn, Switchgrass And Miscanthus RhizosphereDIGLSTWRLDSDGLLLSGRGGSWRFSESDATTWERIPATSDPLVLMRQ*
Ga0070712_10151202723300006175Corn, Switchgrass And Miscanthus RhizosphereDSDGLLLTGRGGSWRFSESDATTWERIPASSDPMVLMRQ*
Ga0075362_1073356523300006177Populus EndosphereLGLSTWRLDPDGLLLSGSGGTWRFSESDPTTWERVPASTDPLVLMRQ*
Ga0074062_1282454223300006606SoilDIGLSTWRLDSDGLLLSGRSGSWRFSESDATTWERIPATSDPLVLMRQ*
Ga0079220_1173330513300006806Agricultural SoilGLLLTGRGGSWRFSESDATIWERIPASADPLVLMRQ*
Ga0075428_10179363413300006844Populus RhizosphereIAAFNPSTWRLDRDLLILTGRNGSWRFSESDATVWERVPLSTDPLLLVRQ*
Ga0075421_10253208013300006845Populus RhizosphereLLTGRGGSWRFSESDATTWERIPASSDPLVLMRQ*
Ga0075430_10028529613300006846Populus RhizosphereASVADIELSTWRLDRDGLLLTGRGGSWRFSESDATTWERVPATADPLVLVRQ*
Ga0075425_10105020213300006854Populus RhizosphereVELSTWRLDSDGLLLTGRGGSWRFSESDATTWERIPASSDPLVLMRQ*
Ga0075429_10013662413300006880Populus RhizosphereELVLTGRAGAWRFSESDATTWERIPPSTDPLVLMRQ*
Ga0075429_10186021413300006880Populus RhizosphereTWRLEDNELRLTGRTEAWRFSESDANTWERVPPSAEPMVLMRQ*
Ga0075426_1051103313300006903Populus RhizosphereTWQLDSEGLLLRGRGGSWRFSESDATTWERIPASADPLVLMRQ*
Ga0075424_10237195013300006904Populus RhizosphereLSTWRLDSNELVLSGRNGAWRFSESDTTTWERIPPSTDPIVLMRQ*
Ga0075419_1012646343300006969Populus RhizosphereVTWRLEGGELVLTGRAGAWRFSESDATTWERIPPSTDPLVLMRQ*
Ga0075435_10049052223300007076Populus RhizosphereGLSTWRLDGDGLLLSGRGGSWRFSESDATTWERIPATSDPLVLMRQ*
Ga0099830_1118548323300009088Vadose Zone SoilEGGELVLTGRAGAWRFSESDASTWERIPPSTDPLLLMRP*
Ga0111539_1008498923300009094Populus RhizosphereVKQGCDPSVADVELSTWRLDSDGLLLTGRGGSWRFSESDATTWERIPASSDPLVLMRQ*
Ga0105245_1041142233300009098Miscanthus RhizosphereSTWRLADNELLLTGRGGTWRFSESDASIWERVPPSTDPMLLMRQ*
Ga0075418_1257981213300009100Populus RhizospherePDGLLLSGSGGTWRFSESDPTTWERIPASTDPLVLMRQ*
Ga0126380_1196686423300010043Tropical Forest SoilCDASVADIGLSTWRLDSDGLLLSGRGGSWRFSESDATTWERIPATSDPLVLMRQ*
Ga0126384_1228887513300010046Tropical Forest SoilSEGLLLTGRGGSWRFSESDATTWERIPASADPLVLMRQ*
Ga0126382_1062797423300010047Tropical Forest SoilSVADIGLSTWRLDGDGLLLSGRGGSWRFSESDATTWERIPATSDPLVLMRQ*
Ga0126382_1146414923300010047Tropical Forest SoilGVGLLTWRLERDELLLVGRSGSWRFSESDATSWERIPPSADPLVLMRQ*
Ga0126376_1109387213300010359Tropical Forest SoilTWRLDSDGLLLTGRGGSWRFSESDATTWERIPATSDPMVLMRQ*
Ga0126372_1046014833300010360Tropical Forest SoilGCDSSVAGIELSTWRLDPDGLLLTGRGGSWRFSESDATTWERIPASSDPLVLMRQ*
Ga0126378_1315074113300010361Tropical Forest SoilFDSSVAGIELSTWRLDPDGLLLTGRGGSWRFSESDATTWERIPASSDPLVLMRQ*
Ga0126379_1131659123300010366Tropical Forest SoilLLSGRGGSWRFSESDATTWERIPATSDPLVLMRQ*
Ga0126383_1068170123300010398Tropical Forest SoilCDPSVADVELSTWQLDSEGLLLTGRAGSWRFSESDATTWERIPASADPLVLMRQ*
Ga0126383_1246987023300010398Tropical Forest SoilRLDSDGLLLTGRGGSWRFSESDATTWERIPATSDPLVLMRQ*
Ga0138514_10003757313300011003SoilIEDNELVVAGRSSAWRFSESDATTWERIPPSTDPLLMMRQ*
Ga0137391_1120463813300011270Vadose Zone SoilLLFSGRTGTWRFAESDATTWERIPPSTDPLLMMRQ*
Ga0137388_1078833213300012189Vadose Zone SoilTWRLQDNELLFSGRTGTWRFAESDATTWGRIPPSTDPLLMMRQ*
Ga0137362_1036484513300012205Vadose Zone SoilASVADIGLSTWRLDGDGLLLSGRGGSWRFSESDATTWERIPATSDPLVLMRQ*
Ga0137370_1004153643300012285Vadose Zone SoilTWRLDSDGLLLTGRGGSWRFSESDATTWERVPASSDPLVLMRQE*
Ga0137384_1008748843300012357Vadose Zone SoilWRLDGDGLLLSGRGGSWRFSESDATTWERIPATSDPLVLMRQ*
Ga0137384_1070412523300012357Vadose Zone SoilDSDGLLLSGRGGSWRFSESDATTWERIPATSDPLVLMRQ*
Ga0137384_1139646713300012357Vadose Zone SoilLVLAGRSGAWRFAESDSTTWERIPPSTDPLRLMRQ*
Ga0137390_1117779523300012363Vadose Zone SoilRLDNNELLFSGRTGTWRFAESDATTWERIPPSTDPLLMMRQ*
Ga0157295_1021683623300012906SoilAGLGLSTWRLDPDGLLLSGSGGTWRFSESDPTTWERIPASTDPLVLMRE*
Ga0157301_1026254913300012911SoilAGLGLSTWRLDPDGLLLSGSGGTWRFSESDPTTWERIPASTDPLVLRRE*
Ga0157302_1055020613300012915SoilLLLTGRGGTWRFSESDVSTWERVPPSTDPMLLMRQ*
Ga0126375_1209477223300012948Tropical Forest SoilIATWGPSTWRLDRDQIILTGRSGSWRFSESDATVWERVPLSVDPLLLVRQ*
Ga0126369_1308934913300012971Tropical Forest SoilLGFTTWRLDADGLQLSGNGGRWRFSESDATSWERIPASTDPMVLMRQ*
Ga0134076_1040576813300012976Grasslands SoilWRLDSDGLLLTGRGGSWRFSESDATTWERVPASSDPLVLMRQE*
Ga0134087_1039613223300012977Grasslands SoilDTSVADIELSTWRLDSDGLLLTGRGGSWRFSESDATTWERVPASSDPLVLMRQE*
Ga0164308_1221589123300012985SoilSVADIGLSTWRLDSDGLLLSGRGGSWRFSESDATTWERIPATSDPLVLMRQ*
Ga0164305_1057724913300012989SoilVADIGLSTWRLDSDGLLLSGRSVSWRFSESDATTWERIPATSDPLVLMRQ*
Ga0075307_110538913300014260Natural And Restored WetlandsRIVVKPGCTAEIVGLALATWRLEVNDLLLIGRGGTWRFSESDATVWERIPPSTDPMVLMRQ*
Ga0157380_1133102513300014326Switchgrass RhizosphereSTWRLDPDGLLLSGSGGTWRFSESDPTTWERIPASTDPLVLMRQ*
Ga0132258_1384254723300015371Arabidopsis RhizosphereCDTSIAGLGLATWRLDSNELLLVGRGATWRFSESDATTWERIPPSADPMVLMRQ*
Ga0132256_10349173723300015372Arabidopsis RhizosphereVLVGRGGTWRFSESDTTTWERIPPSADPMVLMRQ*
Ga0132257_10019474413300015373Arabidopsis RhizosphereSEGLLLRGRGGSWRFSESDATTWERIPASADPLVLMRQ*
Ga0182035_1151638823300016341SoilCDASVADIGLSTWRLDSDGLLLTGRGGSWRFSESDATTWERIPATSDPLVLMRQ
Ga0182040_1043318813300016387SoilDASVADIGLSTWRLDGDGLLLSGRGGSWRFSESDATTWERIPATSDPLVLMRQ
Ga0182037_1051041513300016404SoilGLLLSGRGGSWRFSESDATTWERIPATSDPLVLMRQ
Ga0182038_1125631233300016445SoilLLLSGRSGTWRFAASDSATWERIPPSTDPLLMMRQ
Ga0187777_1049428013300017974Tropical PeatlandWRLQNEELLLSGSTETWRFVESDASTWERVPPSTDPLVLMRQ
Ga0184610_107147313300017997Groundwater SedimentWRLDPDGLLLSGSGGTWRFSESDPSTWERIPASTDPVVLMRQ
Ga0184634_1047529223300018031Groundwater SedimentVAGLGLSTWRLDPDGLMLSGSGGTWRFSESDPTTWERIPASTDPVVLMRQ
Ga0184616_1022983623300018055Groundwater SedimentCDASVAGLGLSTWRLDPDGLMLSGSGGTWRFSESDPTTWERIPASTDPVVLMRQ
Ga0190272_1198470123300018429SoilRLDRDGLVLSGRGVTWRFSESDATTWERIPPSADPMVLMRQ
Ga0066667_1087473523300018433Grasslands SoilLLLTGRGGSWRFSESDATTWERVPATSDPLVLMRQ
Ga0190269_1114732613300018465SoilTWRLDPDGLLLSGSGGTWRFSERDPTTWERIPASTDPLVLMRQ
Ga0190270_1308472123300018469SoilAGLGLSTWRLDPDGLLLSGSGGTWRFSESDPTTWERIPASTDPLVLMRQ
Ga0190271_1199436523300018481SoilLEVNDLLLVGRGGTWRFSEADATVWERIPPSTDPMLLMRQ
Ga0126371_1086176723300021560Tropical Forest SoilADIGLSTWRLDSDGLLLTGRGGSWRFSESDATTWERIPATSDPLVLMRQ
Ga0222622_1073754913300022756Groundwater SedimentPDGLLLSGSGGTWRFSESDPTTWERIPASTDPVVLMRQ
Ga0207699_1005822643300025906Corn, Switchgrass And Miscanthus RhizosphereVKQGCDSSVADVELSTWRLDSDGLLLTGRGGSWRFSESDATTWERIPASSDPLVLMRQ
Ga0207687_1074570513300025927Miscanthus RhizosphereGLSTWRLDPDGLLLSGSGGTWRFSESDPTTWERIPASTDPLVLMRE
Ga0207700_1014890113300025928Corn, Switchgrass And Miscanthus RhizosphereAGGESYKITVKQGCDPSVADVELSTWRLDSDGLLLTGRGGSWRFSESDATTWERIPASSDPLVLMRQ
Ga0207664_1133413713300025929Agricultural SoilLLLSGSGGSWRFSESDATSWERIPASTDPLVLMRQ
Ga0207690_1133062213300025932Corn RhizosphereTWRLDRDQLILTGRNGSWRFSESDATVWERVPLTVDPMLLVRQ
Ga0207709_1145198923300025935Miscanthus RhizosphereLSTWRLDPDGLLLSGSGGTWRFSESDPTTWERIPASTDPLVLMRE
Ga0207665_1035659613300025939Corn, Switchgrass And Miscanthus RhizosphereVADIGLSTWRLDSDGLLLSGRGGSWRFSESDATTWERIPATSDPLVLMRQ
Ga0207712_1126360913300025961Switchgrass RhizosphereSVADVELSTWRLDSDGLLLTGRGGSWRFSESDATTWERIPASSDPLVLMRQ
Ga0207640_1050032743300025981Corn RhizosphereDASVAGLGLSTWRLDPDGLLLSGSGGTWRFSESDPTTWERIPASTDPLVLMRQ
Ga0209240_105338323300026304Grasslands SoilLLLSGRSGSWRFSESDATTWERIPATSDPLVLMRQ
Ga0257159_102828913300026494SoilDPSVADVELSTWRLDRDGLLLTGRGGSWRFSESDATTWERIPASADPLVLMRQ
Ga0209376_135013323300026540SoilWRLDSDGLLLTGRGGSWRFSESDATTWERVPASSDPLVLMRQE
Ga0207776_103394813300027035Tropical Forest SoilLLLSGSTETWRFVESDASTWERVPPSTDPLVLMRQ
Ga0209213_106004523300027383Forest SoilAIAGLGLATWRLDSNELVLVGRGGTWRFSESDPKTWERIPPSADPMVLMRQ
Ga0209481_1002702113300027880Populus RhizosphereVTWRLEGGELVLTGRAGAWRFSESDATTWERIPPSTDPLVLMRQ
Ga0209068_1073318113300027894WatershedsWRLEANELMLIGRAGTWRFSESDASTWERIPPSTDPMLLMK
Ga0137415_1092243823300028536Vadose Zone SoilDGLLLSGRGGSWRFSESDATTWERIPATSDPLVLMRQ
Ga0307309_1001182813300028714SoilCDASVAGLGLSTWRLDPDGLLLSGSGGTWRFSESDPTTWERIPASTDPLVLMRQ
Ga0307313_1006272723300028715SoilGLSTWRLDPDGLMLSGSGGTWRFSESDPTTWERIPASTDPVVLMRQ
Ga0307280_1004094113300028768SoilRLDPDGLLLSGSGGTWRFSESDPTTWERIPASTDPLVLMRQ
Ga0307323_1018872013300028787SoilGLGLSTWRLDPDGLLLSGSGGTWRFSESDPTTWERIPASTDPVVLMRQ
Ga0307323_1020730113300028787SoilRLDSDGLLLTGRGGSWRFSESDATTWERIPASSDPLVLMRQ
Ga0307284_1022273713300028799SoilESYKITVKQGCDPSVADVELSTWRLDSDGLLLTGRGGSWRFSESDATTWERIPASSDPLVLMRQ
Ga0247824_1093244923300028809SoilSTWRLDRDQLILIGRGGSWRFSESDATVWERFPLSVDPMLLVRQ
Ga0307312_1028880213300028828SoilPGCDASLAGLGLSTWRLDPDGLLLSGSGGTWRFSESDPTTWERIPASTDPLVLMRQ
Ga0318555_1031463923300031640SoilLLLFGRNETWRFVESDATTWERVPPSTDPLLLMRQ
Ga0318561_1081888813300031679SoilRLDSDGLLLSGRGGSWRFSESDATTWERIPATSDPLVLMRQ
Ga0318572_1069494323300031681SoilASVADIGLSTWRLDSDGLLLSGRGGSWRFSESDATTWERIPATSDPLVLMRQ
Ga0318500_1050092013300031724SoilGLSTWRLDSDGLLLSGRGGSWRFSESDATTWERIPATSDPLVLMRQ
Ga0318546_1012924333300031771SoilTWRLDNDELLLAGRMTWRFTESDTTTWERISPSTDPMLLMRQ
Ga0318543_1024300513300031777SoilSTWRLDSDGLLLSGPGGSWRFSESDATTWERIPATSDPLVLMRQ
Ga0318566_1060541823300031779SoilPGCDASVADAELSTWRLDQDGLLLTGRGGSWRFSESDATTWERIPASSDPLVLMRQ
Ga0318548_1027702823300031793SoilWRLDSDGLLLTGRGGSWRFSESDATTWERIPATSDPLVLMRQ
Ga0318576_1006433233300031796SoilCDASVADAELSTWRLDQDGLLLTGRGGSWRFSESDATTWERIPASSDPLVLMRQ
Ga0318550_1053520413300031797SoilALATWRLDSDELLLSGSTTWRFAESDTTTWERIPPSTDPMLLMRQ
Ga0306925_1048084123300031890SoilSDGLLLTGRGGSWRFSESDATTWERIPATSDPLVLMRQ
Ga0306925_1075748913300031890SoilSTWRLQENELLLSGGAGTWRFAESDATTWERIPPSTDPLLMMRQ
Ga0318520_1042963023300031897SoilLSTWRLDRDELLLAGRSGAWRFGESDSTTWERLPPSTDPLVLMRQ
Ga0306923_1084877613300031910SoilCDASVADIGLSTWRLDSDGLLLSGRGGSWRFSESDATTWERIPATSDPLVLMRQ
Ga0310884_1046446313300031944SoilASVAGLGLSTWRLDPDGLLLSGSGGTWRFSESDPTTWERIPASTDPLVLMRQ
Ga0306926_1271926413300031954SoilLQENELLLSGRAGTWRFAESDATTWERIPPSTDPLLMMKQ
Ga0318530_1003823333300031959SoilDGLLLTGRSGSWRFSESDATTWERIPATSDPLVLMRQ
Ga0318558_1012965533300032044SoilASVADAELSTWRLDQDGLLLTGRGGSWRFSESDATTWERIPASSDPLVLMRQ
Ga0318575_1042665923300032055SoilQENELLLSGGAGTWRFAESDATTWERIPPSTDPLLMMRQ
Ga0318575_1048901013300032055SoilLSTWRLDSDGLLLSGRGGSWRFSESDATTWERIPATSDPLVLMRQ
Ga0310889_1073650313300032179SoilSVAGLGLSTWRLDPDGLLLSGSGGTWRFSESDPTTWERIPASTDPLVLMRQ
Ga0306920_10082364713300032261SoilSDGLLLSGPGGSWRFSESDATTWERIPATSDPLVLMRQ


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.