NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F055825

Metagenome / Metatranscriptome Family F055825

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F055825
Family Type Metagenome / Metatranscriptome
Number of Sequences 138
Average Sequence Length 46 residues
Representative Sequence MPDLNLIEHHPQRVLEAFRRGEFDQIEIIGQADEKEFFELCF
Number of Associated Samples 119
Number of Associated Scaffolds 138

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 67.39 %
% of genes near scaffold ends (potentially truncated) 93.48 %
% of genes from short scaffolds (< 2000 bps) 97.10 %
Associated GOLD sequencing projects 117
AlphaFold2 3D model prediction Yes
3D model pTM-score0.35

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.275 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil
(16.667 % of family members)
Environment Ontology (ENVO) Unclassified
(23.188 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(39.855 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 25.71%    β-sheet: 0.00%    Coil/Unstructured: 74.29%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.35
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 138 Family Scaffolds
PF01420Methylase_S 0.72
PF14690zf-ISL3 0.72
PF13432TPR_16 0.72
PF13333rve_2 0.72
PF10609ParA 0.72
PF01844HNH 0.72
PF03050DDE_Tnp_IS66 0.72

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 138 Family Scaffolds
COG0732Restriction endonuclease S subunitDefense mechanisms [V] 0.72
COG3436TransposaseMobilome: prophages, transposons [X] 0.72

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.28 %
UnclassifiedrootN/A0.72 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908032|Perma_A_C_ConsensusfromContig22930All Organisms → cellular organisms → Bacteria749Open in IMG/M
3300001213|JGIcombinedJ13530_107219442All Organisms → cellular organisms → Bacteria682Open in IMG/M
3300002122|C687J26623_10158395All Organisms → cellular organisms → Bacteria625Open in IMG/M
3300002961|JGI11641J44799_10187731All Organisms → cellular organisms → Bacteria580Open in IMG/M
3300003994|Ga0055435_10068110All Organisms → cellular organisms → Bacteria892Open in IMG/M
3300004282|Ga0066599_100841145All Organisms → cellular organisms → Bacteria650Open in IMG/M
3300004282|Ga0066599_101436878All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300005555|Ga0066692_10961039All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300005829|Ga0074479_10385922All Organisms → cellular organisms → Bacteria580Open in IMG/M
3300006224|Ga0079037_101512118All Organisms → cellular organisms → Bacteria670Open in IMG/M
3300006224|Ga0079037_101799460All Organisms → cellular organisms → Bacteria612Open in IMG/M
3300006224|Ga0079037_101995703All Organisms → cellular organisms → Bacteria580Open in IMG/M
3300006797|Ga0066659_11531378All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300006930|Ga0079303_10260523All Organisms → cellular organisms → Bacteria708Open in IMG/M
3300007521|Ga0105044_10807405All Organisms → cellular organisms → Bacteria744Open in IMG/M
3300009030|Ga0114950_11155484All Organisms → cellular organisms → Bacteria603Open in IMG/M
3300009037|Ga0105093_10558107All Organisms → cellular organisms → Bacteria644Open in IMG/M
3300009038|Ga0099829_11085846All Organisms → cellular organisms → Bacteria663Open in IMG/M
3300009089|Ga0099828_11248485All Organisms → cellular organisms → Bacteria658Open in IMG/M
3300009131|Ga0115027_10450374All Organisms → cellular organisms → Bacteria914Open in IMG/M
3300009137|Ga0066709_101752009All Organisms → cellular organisms → Bacteria876Open in IMG/M
3300009139|Ga0114949_11254156All Organisms → cellular organisms → Bacteria592Open in IMG/M
3300009143|Ga0099792_10623324All Organisms → cellular organisms → Bacteria690Open in IMG/M
3300009157|Ga0105092_10341573All Organisms → cellular organisms → Bacteria848Open in IMG/M
3300009179|Ga0115028_10732456All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria760Open in IMG/M
3300009179|Ga0115028_11580619All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300009502|Ga0114951_10080678All Organisms → cellular organisms → Bacteria1886Open in IMG/M
3300009506|Ga0118657_11637866All Organisms → cellular organisms → Bacteria755Open in IMG/M
3300009616|Ga0116111_1159398All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300009636|Ga0116112_1165723All Organisms → cellular organisms → Bacteria615Open in IMG/M
3300009698|Ga0116216_10638007All Organisms → cellular organisms → Bacteria641Open in IMG/M
3300010319|Ga0136653_10366941All Organisms → cellular organisms → Bacteria636Open in IMG/M
3300010391|Ga0136847_11911103All Organisms → cellular organisms → Bacteria1120Open in IMG/M
3300012361|Ga0137360_11140249All Organisms → cellular organisms → Bacteria674Open in IMG/M
3300012976|Ga0134076_10491139All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300014153|Ga0181527_1289942All Organisms → cellular organisms → Bacteria648Open in IMG/M
3300014155|Ga0181524_10278638All Organisms → cellular organisms → Bacteria772Open in IMG/M
3300014159|Ga0181530_10589293All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300014164|Ga0181532_10489152All Organisms → cellular organisms → Bacteria675Open in IMG/M
3300014165|Ga0181523_10259677All Organisms → cellular organisms → Bacteria990Open in IMG/M
3300014502|Ga0182021_12445818All Organisms → cellular organisms → Bacteria628Open in IMG/M
3300014839|Ga0182027_12072158All Organisms → cellular organisms → Bacteria543Open in IMG/M
3300014839|Ga0182027_12323706All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300015356|Ga0134073_10364413All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300016294|Ga0182041_11276916All Organisms → cellular organisms → Bacteria671Open in IMG/M
3300017938|Ga0187854_10410449All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300018017|Ga0187872_10407550All Organisms → cellular organisms → Bacteria575Open in IMG/M
3300018020|Ga0187861_10285747All Organisms → cellular organisms → Bacteria710Open in IMG/M
3300018021|Ga0187882_1030137All Organisms → cellular organisms → Bacteria2818Open in IMG/M
3300018021|Ga0187882_1238732All Organisms → cellular organisms → Bacteria706Open in IMG/M
3300018022|Ga0187864_10199947All Organisms → cellular organisms → Bacteria948Open in IMG/M
3300018030|Ga0187869_10052352All Organisms → cellular organisms → Bacteria2152Open in IMG/M
3300018030|Ga0187869_10327227Not Available735Open in IMG/M
3300018040|Ga0187862_10278203All Organisms → cellular organisms → Bacteria1065Open in IMG/M
3300018057|Ga0187858_10631936All Organisms → cellular organisms → Bacteria643Open in IMG/M
3300020015|Ga0193734_1080035All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300020180|Ga0163155_10249335All Organisms → cellular organisms → Bacteria864Open in IMG/M
3300020221|Ga0194127_10616285All Organisms → cellular organisms → Bacteria689Open in IMG/M
3300020603|Ga0194126_10536224All Organisms → cellular organisms → Bacteria713Open in IMG/M
3300021415|Ga0193694_1038743All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium667Open in IMG/M
3300022555|Ga0212088_10064140All Organisms → cellular organisms → Bacteria3737Open in IMG/M
3300025008|Ga0210029_1110874All Organisms → cellular organisms → Bacteria723Open in IMG/M
3300025376|Ga0208494_1017947All Organisms → cellular organisms → Bacteria773Open in IMG/M
3300025410|Ga0208875_1075043All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300025533|Ga0208584_1095413All Organisms → cellular organisms → Bacteria717Open in IMG/M
3300025616|Ga0208613_1130490All Organisms → cellular organisms → Bacteria565Open in IMG/M
3300025878|Ga0209584_10338431All Organisms → cellular organisms → Bacteria580Open in IMG/M
3300025906|Ga0207699_10377789All Organisms → cellular organisms → Bacteria1005Open in IMG/M
3300026456|Ga0255351_1068875All Organisms → cellular organisms → Bacteria672Open in IMG/M
(restricted) 3300027799|Ga0233416_10280915All Organisms → cellular organisms → Bacteria573Open in IMG/M
3300027877|Ga0209293_10684979All Organisms → cellular organisms → Bacteria543Open in IMG/M
3300027887|Ga0208980_10374447All Organisms → cellular organisms → Bacteria823Open in IMG/M
3300027899|Ga0209668_10841743All Organisms → cellular organisms → Bacteria618Open in IMG/M
3300027903|Ga0209488_10734122All Organisms → cellular organisms → Bacteria705Open in IMG/M
3300027905|Ga0209415_11073252All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300028032|Ga0265296_1288016All Organisms → cellular organisms → Bacteria542Open in IMG/M
3300028178|Ga0265593_1090384All Organisms → cellular organisms → Bacteria825Open in IMG/M
3300028283|Ga0268283_1102852All Organisms → cellular organisms → Bacteria826Open in IMG/M
3300028623|Ga0257141_1097798All Organisms → cellular organisms → Bacteria535Open in IMG/M
(restricted) 3300029286|Ga0247841_10707155All Organisms → cellular organisms → Bacteria609Open in IMG/M
3300029889|Ga0246001_1068362All Organisms → cellular organisms → Bacteria705Open in IMG/M
3300029998|Ga0302271_10369747All Organisms → cellular organisms → Bacteria622Open in IMG/M
3300030000|Ga0311337_11333377All Organisms → cellular organisms → Bacteria628Open in IMG/M
3300030019|Ga0311348_11258052All Organisms → cellular organisms → Bacteria550Open in IMG/M
3300030620|Ga0302046_10889656All Organisms → cellular organisms → Bacteria713Open in IMG/M
3300031232|Ga0302323_101485191All Organisms → cellular organisms → Bacteria763Open in IMG/M
3300031344|Ga0265316_11048679All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300031524|Ga0302320_12052114All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300031722|Ga0311351_10823781All Organisms → cellular organisms → Bacteria708Open in IMG/M
3300031726|Ga0302321_100839181All Organisms → cellular organisms → Bacteria1038Open in IMG/M
3300031834|Ga0315290_10641744All Organisms → cellular organisms → Bacteria919Open in IMG/M
3300031862|Ga0315280_10343969All Organisms → cellular organisms → Bacteria717Open in IMG/M
3300031885|Ga0315285_10652953All Organisms → cellular organisms → Bacteria686Open in IMG/M
3300031902|Ga0302322_101573545All Organisms → cellular organisms → Bacteria803Open in IMG/M
3300032018|Ga0315272_10521224All Organisms → cellular organisms → Bacteria594Open in IMG/M
3300032070|Ga0315279_10795810All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300032143|Ga0315292_10786785All Organisms → cellular organisms → Bacteria797Open in IMG/M
3300032143|Ga0315292_11020075All Organisms → cellular organisms → Bacteria686Open in IMG/M
3300032156|Ga0315295_11914956All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300032173|Ga0315268_11662450All Organisms → cellular organisms → Bacteria651Open in IMG/M
3300032177|Ga0315276_11639882All Organisms → cellular organisms → Bacteria665Open in IMG/M
3300032342|Ga0315286_10199011All Organisms → cellular organisms → Bacteria2143Open in IMG/M
3300032397|Ga0315287_12500967All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300032401|Ga0315275_11562566All Organisms → cellular organisms → Bacteria707Open in IMG/M
3300032516|Ga0315273_11207280All Organisms → cellular organisms → Bacteria952Open in IMG/M
3300032516|Ga0315273_12484327All Organisms → cellular organisms → Bacteria598Open in IMG/M
3300032770|Ga0335085_11504139All Organisms → cellular organisms → Bacteria701Open in IMG/M
3300032782|Ga0335082_11618822All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300032783|Ga0335079_11291318All Organisms → cellular organisms → Bacteria729Open in IMG/M
3300032783|Ga0335079_11367198All Organisms → cellular organisms → Bacteria704Open in IMG/M
3300032893|Ga0335069_10394527All Organisms → cellular organisms → Bacteria1625Open in IMG/M
3300033158|Ga0335077_12168826All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300033233|Ga0334722_10665048All Organisms → cellular organisms → Bacteria741Open in IMG/M
3300033402|Ga0326728_10764149All Organisms → cellular organisms → Bacteria711Open in IMG/M
3300033402|Ga0326728_11161440All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300033416|Ga0316622_100481643All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1410Open in IMG/M
3300033416|Ga0316622_102962033All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300033418|Ga0316625_101427934All Organisms → cellular organisms → Bacteria650Open in IMG/M
3300033433|Ga0326726_12364468All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300033434|Ga0316613_10683278All Organisms → cellular organisms → Bacteria703Open in IMG/M
3300033480|Ga0316620_11205187All Organisms → cellular organisms → Bacteria742Open in IMG/M
3300033482|Ga0316627_102464471All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300033485|Ga0316626_11374277All Organisms → cellular organisms → Bacteria634Open in IMG/M
3300033487|Ga0316630_11172348All Organisms → cellular organisms → Bacteria680Open in IMG/M
3300033487|Ga0316630_11316707All Organisms → cellular organisms → Bacteria645Open in IMG/M
3300033521|Ga0316616_102118500All Organisms → cellular organisms → Bacteria747Open in IMG/M
3300033521|Ga0316616_102556574All Organisms → cellular organisms → Bacteria685Open in IMG/M
3300033521|Ga0316616_104009746All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300033521|Ga0316616_104129090All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300033557|Ga0316617_101443616All Organisms → cellular organisms → Bacteria692Open in IMG/M
3300033557|Ga0316617_101579207All Organisms → cellular organisms → Bacteria664Open in IMG/M
3300033557|Ga0316617_102102274All Organisms → cellular organisms → Bacteria581Open in IMG/M
3300033557|Ga0316617_102486453All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300033755|Ga0371489_0518731All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300033797|Ga0334815_044056All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300033822|Ga0334828_076569All Organisms → cellular organisms → Bacteria861Open in IMG/M
3300033982|Ga0371487_0464276All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300034691|Ga0370488_254232All Organisms → cellular organisms → Bacteria505Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil16.67%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment12.32%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland7.25%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen4.35%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog3.62%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.62%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil3.62%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland2.90%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater2.17%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands2.17%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland2.17%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.17%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen2.17%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil2.17%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment1.45%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake1.45%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland1.45%
FreshwaterEnvironmental → Aquatic → Freshwater → Pond → Sediment → Freshwater1.45%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface1.45%
Saline WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water1.45%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.45%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil1.45%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil1.45%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.45%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog1.45%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.72%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.72%
Freshwater Lake HypolimnionEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion0.72%
Freshwater Microbial MatEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat0.72%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.72%
Anoxic Lake WaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Lake Water0.72%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment0.72%
AquiferEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Aquifer0.72%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater0.72%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater0.72%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine0.72%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.72%
Mangrove SedimentEnvironmental → Aquatic → Marine → Wetlands → Sediment → Mangrove Sediment0.72%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)0.72%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil0.72%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.72%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.72%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.72%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.72%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil0.72%
Deep SubsurfaceEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface0.72%
PeatEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat0.72%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.72%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908032Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Perma_allEnvironmentalOpen in IMG/M
3300001213Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)EnvironmentalOpen in IMG/M
3300002122Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_2EnvironmentalOpen in IMG/M
3300002961Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site A1 BulkEnvironmentalOpen in IMG/M
3300003994Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2EnvironmentalOpen in IMG/M
3300004282Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Initial sedimentEnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005829Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBCEnvironmentalOpen in IMG/M
3300006224Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaGEnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006930Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWCEnvironmentalOpen in IMG/M
3300007521Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-01EnvironmentalOpen in IMG/M
3300009030Deep subsurface microbial communities from Kermadec Trench to uncover new lineages of life (NeLLi) - N075 metaGEnvironmentalOpen in IMG/M
3300009037Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009131Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1EnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009139Deep subsurface microbial communities from Kermadec Trench to uncover new lineages of life (NeLLi) - N074 metaGEnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009157Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009179Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1EnvironmentalOpen in IMG/M
3300009502Freshwater microbial communities from Finland to study Microbial Dark Matter (Phase II) - AM7a DNA metaGEnvironmentalOpen in IMG/M
3300009506Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_8EnvironmentalOpen in IMG/M
3300009616Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100EnvironmentalOpen in IMG/M
3300009636Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150EnvironmentalOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300010319Anoxic lake water microbial communities from Lake Kivu, Rwanda to study Microbial Dark Matter (Phase II) - Lake Kivu water 275m metaGEnvironmentalOpen in IMG/M
3300010391Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406EnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012976Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300014153Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaGEnvironmentalOpen in IMG/M
3300014155Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaGEnvironmentalOpen in IMG/M
3300014159Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaGEnvironmentalOpen in IMG/M
3300014164Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaGEnvironmentalOpen in IMG/M
3300014165Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaGEnvironmentalOpen in IMG/M
3300014502Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014839Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300015356Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300017938Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150EnvironmentalOpen in IMG/M
3300018017Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40EnvironmentalOpen in IMG/M
3300018020Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100EnvironmentalOpen in IMG/M
3300018021Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_150EnvironmentalOpen in IMG/M
3300018022Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40EnvironmentalOpen in IMG/M
3300018030Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100EnvironmentalOpen in IMG/M
3300018040Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150EnvironmentalOpen in IMG/M
3300018057Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150EnvironmentalOpen in IMG/M
3300020015Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m1EnvironmentalOpen in IMG/M
3300020180Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.SP4.G1EnvironmentalOpen in IMG/M
3300020221Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015036 Kigoma Deep Cast 100mEnvironmentalOpen in IMG/M
3300020603Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015035 Kigoma Deep Cast 150mEnvironmentalOpen in IMG/M
3300021415Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s1EnvironmentalOpen in IMG/M
3300022555Alinen_combined assemblyEnvironmentalOpen in IMG/M
3300025008Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-21 (SPAdes)EnvironmentalOpen in IMG/M
3300025376Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA10M (SPAdes)EnvironmentalOpen in IMG/M
3300025410Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH25Aug08 (SPAdes)EnvironmentalOpen in IMG/M
3300025533Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 deep-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025616Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA6M (SPAdes)EnvironmentalOpen in IMG/M
3300025878Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026456Peat soil microbial communities from Stordalen Mire, Sweden - H.B.S.T-25.r2EnvironmentalOpen in IMG/M
3300027799 (restricted)Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_0_MGEnvironmentalOpen in IMG/M
3300027877Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300027887Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site A1 BulkEnvironmentalOpen in IMG/M
3300027899Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300028032Groundwater microbial communities from a municipal landfill in Southern Ontario, Canada - Pumphouse #1EnvironmentalOpen in IMG/M
3300028178Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2011_5_24_36mEnvironmentalOpen in IMG/M
3300028283Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2013_06_06_36mEnvironmentalOpen in IMG/M
3300028623Metatranscriptome of saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2011_1_27_36m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029286 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_18mEnvironmentalOpen in IMG/M
3300029889Peat microbial communities from Marcell Experimental Forest bog in Minnesota, USA - MG_T3F_30cmEnvironmentalOpen in IMG/M
3300029998Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N1_1EnvironmentalOpen in IMG/M
3300030000I_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300030019II_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300030620Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111EnvironmentalOpen in IMG/M
3300031232Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3EnvironmentalOpen in IMG/M
3300031344Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaGHost-AssociatedOpen in IMG/M
3300031524Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3EnvironmentalOpen in IMG/M
3300031722II_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300031726Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1EnvironmentalOpen in IMG/M
3300031834Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0EnvironmentalOpen in IMG/M
3300031862Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_40EnvironmentalOpen in IMG/M
3300031885Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36EnvironmentalOpen in IMG/M
3300031902Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2EnvironmentalOpen in IMG/M
3300032018Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_middleEnvironmentalOpen in IMG/M
3300032070Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_20EnvironmentalOpen in IMG/M
3300032143Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0EnvironmentalOpen in IMG/M
3300032156Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0EnvironmentalOpen in IMG/M
3300032173Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_topEnvironmentalOpen in IMG/M
3300032177Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0EnvironmentalOpen in IMG/M
3300032342Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0EnvironmentalOpen in IMG/M
3300032397Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0EnvironmentalOpen in IMG/M
3300032401Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0EnvironmentalOpen in IMG/M
3300032516Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033233Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottomEnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300033416Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D5_CEnvironmentalOpen in IMG/M
3300033418Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_AEnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300033434Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_CT_bEnvironmentalOpen in IMG/M
3300033480Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_BEnvironmentalOpen in IMG/M
3300033482Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_CEnvironmentalOpen in IMG/M
3300033485Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D5_AEnvironmentalOpen in IMG/M
3300033487Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D6_AEnvironmentalOpen in IMG/M
3300033521Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_BEnvironmentalOpen in IMG/M
3300033557Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_BEnvironmentalOpen in IMG/M
3300033755Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB26FY SIP fractionEnvironmentalOpen in IMG/M
3300033797Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-2-SEnvironmentalOpen in IMG/M
3300033822Peat soil microbial communities from Stordalen Mire, Sweden - 714 S1 5-9EnvironmentalOpen in IMG/M
3300033982Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB22AY SIP fractionEnvironmentalOpen in IMG/M
3300034691Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_04D_16EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
Perma_A_C_040643702124908032SoilMIDLNIIEYHPQRVLEAFRRGEFDQIEIIGQADEKEFFELCFKEKILEALA
JGIcombinedJ13530_10721944213300001213WetlandMDLQIIEHHPQRVLAALRRGEFDALEIVGEADEKEFFERLFREKLL
C687J26623_1015839513300002122SoilMNVSFVESHPQRVLEAFRRGDFDELEVIGQADEKEFFELCFQKKMLESLA
JGI11641J44799_1018773123300002961WetlandMFSLNLIEHHPQRVLEAFRRGEFDQIEIIGQADEKEFFELCFKEKLLPALAKEMPTARKKEE
Ga0055435_1006811023300003994Natural And Restored WetlandsMELIEHHQQQVLEAFRSGEFDQIEIIGHADEKEFFELCLKEKMLEALADEM
Ga0066599_10084114513300004282FreshwaterMFNLNIIEHHPQRVLAAFRRGEFDQIEIIGQADEKEFFELC
Ga0066599_10143687823300004282FreshwaterMLNLNLIEHHPQRVLAAFRRGEFDQIEIIGQADEKEFFELC
Ga0066692_1096103923300005555SoilMLNLDLIEHHPQRVLEAFRRGEFDQIEIIGQADEKEFF
Ga0074479_1038592223300005829Sediment (Intertidal)MDLTIIEHHPRRVLEAFRRGEFDQIEIIGEADEKEFFELCFREK
Ga0079037_10151211833300006224Freshwater WetlandsMDRELVEPHPRLVLEAFRRGAFDGLEVLGQADEKAFFE
Ga0079037_10179946013300006224Freshwater WetlandsMNLALVEPHPRRVLEAFRQGQFDGIEIIGRADEKA
Ga0079037_10199570323300006224Freshwater WetlandsMNLEIIEHHQQQVLEAFSQGKFDQIEIIGEADEKEFFELCFREKILA
Ga0066659_1153137823300006797SoilMPDLTIIEHHPQRVLEAFRRGEFDQIEIIGQADEKEFF
Ga0079303_1026052323300006930Deep SubsurfaceMDRELVEPHPRLVLEAFRRGAFDGLEVLGQADEKAFFELCFR
Ga0105044_1080740523300007521FreshwaterVNLELVEPHPRRVLEAFRRGEFDGLEILGQADEKAFF*
Ga0114950_1115548413300009030Deep SubsurfaceMNLDIIEHHPRKVLEAFRRGEFDQIEIIGQADEKEFFELCFKEKILSALAGNMPTNRKK
Ga0105093_1055810713300009037Freshwater SedimentMQIIEHHPQRVLDALRRGEFDALEIVGEADERAFFQRLF
Ga0099829_1108584613300009038Vadose Zone SoilMPDLTIIEHHPHRVLEAFRRGEFDQIEIIGQADEKEFFE
Ga0099828_1124848523300009089Vadose Zone SoilMPDLTLIEHHPRRVLEAFRRGEFDQIEIIGQADEKRVL*
Ga0115027_1045037413300009131WetlandMNLELIEPHPRRVLEAFRRGEFDDLEVLGQADEKAFFELG
Ga0066709_10175200913300009137Grasslands SoilMDIAIVEPHPRRVLDAFRNGQFDDLEIIGQADEKEFFELCFKEKILESL
Ga0114949_1125415613300009139Deep SubsurfaceMNLDIIEHHPRKVLEAFRRGEFDQIEIIGQADEKEFFELCFKEKILSA
Ga0099792_1062332423300009143Vadose Zone SoilMTDLSFIEYHPHRVLEAFRRGDFDQIEIIGQADEKEFFELCFAEKILHA
Ga0105092_1034157313300009157Freshwater SedimentMSLEIIEHHQQHVLEAFSQGEFDQIEIIGEADEKEFFELCFREKI
Ga0115028_1073245613300009179WetlandMNLELVEPHPRRVLEAFRRGEFDDLEVLGQADEKTFFEL
Ga0115028_1158061913300009179WetlandMSLELIEPHPRRVLEAFREGDFDGIEIIGRADEKAFFELCFREKL
Ga0114951_1008067823300009502FreshwaterLNLEIIEPRQQWVLEAFRRGEFDQLEVIGAADEKEFFEWCFQEKILAALA*
Ga0118657_1163786623300009506Mangrove SedimentMDLILIEPHPRRVLDSFRQGEFDELEIIGQADEKEFFELCLRENL
Ga0116111_115939823300009616PeatlandMPDLNLIEHHPQRVLEAFRRGEFDQIEIIGQADEKEFFELCF
Ga0116112_116572323300009636PeatlandMFDLNIVEHHPQRVLEAFRRGEFDQIEIVGQADEKEFFELCFKEKILEALAK
Ga0116216_1063800723300009698Peatlands SoilMNLEIIEHHQQQVLEAFSRGEFDQIEIIGEADEKE
Ga0136653_1036694123300010319Anoxic Lake WaterMDLRVIEHHPQRVLDALRRGEFDALEIVGEADERDFFERLFREKL
Ga0136847_1191110313300010391Freshwater SedimentVIDLHLIEHHPQRVLAAFRRGHFDQIEIIGQADEKEFFELCFTEKILEALAK
Ga0137360_1114024923300012361Vadose Zone SoilMDLSFVEPHPQRVLEAFRAGQFDDLEIIGQADEKEFF
Ga0134076_1049113923300012976Grasslands SoilMLNLDLIEHHPQRVLEAFRRGEFDQIEIIGQADEKEFFELCFQEKMLADLAK
Ga0181527_128994213300014153BogMPDIDFIEYHPQRVLEAFRLGEFDQIEIIGQADEKEFF
Ga0181524_1027863833300014155BogMPDLNLIEHHPQRVLEAFRRGEFDQIEIIGQADEKEFF
Ga0181530_1058929313300014159BogMPDLDLIEYHPQRVLEAFRSGEFDQIEIIGQADEKEF
Ga0181532_1048915223300014164BogMPDLNLIEHHPQRVLEAFRRGEFDQIEIVGQADEKE
Ga0181523_1025967733300014165BogMPDLDLIEHHPQRVLEAFRRGEFDQIEIIGQADEKEFFELCFK
Ga0182021_1244581823300014502FenMLNLNLIEHHPQRVLAALRRGEFDQIEIIGQADEKEFFELCFKEKLLPALAKEMPTARKKEEV
Ga0182027_1207215813300014839FenMPDIDLIEYHPQRVLEAFRRGEFDQIEIIGQADEKEFFELC
Ga0182027_1232370613300014839FenMPDLNLIEHHPQRVLEAFRRGEFDQIEIIGQADEKEFFELCFQEK
Ga0134073_1036441313300015356Grasslands SoilMPDLTIIEHHPQRVLEAFRRGEFDQIEIIGQADEKE
Ga0182041_1127691623300016294SoilMEIIEPHQQAVLEAFRRGEFDQIEIIGHADEKEFFELCLKEKMLEALAKEMPTERKKE
Ga0187854_1041044913300017938PeatlandMPDIDLIEHHPQRVLEAFRRGEFDQIEIIGQADEKEFFELCF
Ga0187872_1040755023300018017PeatlandMFNLNLIEPHPQRVLEAFRRGEFDPLEIIGQADEKEFFELCFQEKILATLAKEMPTARKKEE
Ga0187861_1028574723300018020PeatlandMNLEIIEHHQQWVLEAFRQGEFDQLEIIGEADEKEFF
Ga0187882_103013713300018021PeatlandMFNLNLIEPHPQRVLEAFRRGEFDPLEIIGQADEKE
Ga0187882_123873213300018021PeatlandMFDLNIVEHHPQRVLEAFRRGEFDQIEIIGQADEKEFFELCFKEKILE
Ga0187864_1019994713300018022PeatlandMPDLHLIEHHPQRVLEAFRRGEFDQIEIIGQADEKEFFEL
Ga0187869_1005235213300018030PeatlandMLDLNLIEPHPQRVLEAFPRGEFDQIEVVGQADEKEFFELCFKEKI
Ga0187869_1032722723300018030PeatlandMPDLNLIEHHPHRVLEAFRRGEFDQIEIIGQADEKEFFELLTAQSKKIA
Ga0187862_1027820333300018040PeatlandMFNLNLIEPHPQRVLEAFRRGEFDPLEIIGQADEKEFFELCFQ
Ga0187858_1063193633300018057PeatlandMLDLNLIEPHPQRVLEAFPRGEFDQIEVVGQADEKEFFELCF
Ga0193734_108003513300020015SoilMISLQIIEHHPQRVLEAFRRGEFDQIEVIGEADEKEFFEHALL
Ga0163155_1024933523300020180Freshwater Microbial MatVNLELVEPHPRRVLEAFRRGEFDGLEILGQADEKAFF
Ga0194127_1061628523300020221Freshwater LakeMNLQLIEYHPQRVLEALRRGDFDDVEIIGEADEKEFFELLFREKMLDQLAA
Ga0194126_1053622413300020603Freshwater LakeMPELQLIEHHPQRVLEAFRRGEFDQIEIIGQADEKDFFELCQRERLL
Ga0193694_103874323300021415SoilMFNLNLIEHHPKRVLEAFRRGEFDQIEIIGQSPPST
Ga0212088_1006414043300022555Freshwater Lake HypolimnionLNLEIIEPRQQWVLEAFRRGEFDQLEVIGAADEKEFFEWCFQEKILAALA
Ga0210029_111087423300025008AquiferMHLQIIEHHPQRVREALRRGEFDALEIVGEADEKEFFERLFRTKLLEALAATMPTKR
Ga0208494_101794723300025376FreshwaterLNLEIIEHHQQWVLEAFRRGEFDQIEVIGEADEKEFFELCFKEKLLAALA
Ga0208875_107504323300025410FreshwaterMNLEIIEHHQQQVLEAFSQGEFDQIEIIGEADEKEFFELCFREKIL
Ga0208584_109541323300025533Arctic Peat SoilMFSLNLIEHHPQRVLEAFRRGEFDQIEIIGQADEKEFFELCFQEKILVALAKELPTARKK
Ga0208613_113049023300025616FreshwaterVPDLNLIEHHPQRVLEAFRRGEFDQIEIIGQADEKEFFELCFK
Ga0209584_1033843113300025878Arctic Peat SoilMLNLNLIEHHPQRVLAAFRRGEFDQIEIIGQADEKEFFELCF
Ga0207699_1037778923300025906Corn, Switchgrass And Miscanthus RhizosphereVELIEHHQQQVLEAFRRGEFDQIEIIGYADEKQFFEVCFREKIL
Ga0255351_106887513300026456SoilMPDIDLIEYHPQRVLEAFRRGEFDQIEIIGQADEKEFFELCFREKML
(restricted) Ga0233416_1028091513300027799SedimentVADLQLIEYHPQRVLEAFRRGEFDQLEIIGQADEKEFFELCLKEKI
Ga0209293_1068497923300027877WetlandMDRELVEPHPRLVLEAFRRGAFDGLEVLGQADEKAFFELCF
Ga0208980_1037444713300027887WetlandMNLEIIEHHQQQVLEAFGQGEFDQIEIIGEADEKEFFELCFGEKILARLAES
Ga0209668_1084174323300027899Freshwater Lake SedimentMVSLNLIEHHPQRVLEAFRRGEFDQIEIIGQADEKEFFELCFKEKLLPALAKEMPTARKK
Ga0209488_1073412223300027903Vadose Zone SoilMTDLSFIEYHPHRVLEAFRRGDFDQIEIIGQADEKEFFELCFAEKILHALAKEMPTAR
Ga0209415_1107325213300027905Peatlands SoilMNLEIIEHHQQQVLEAFSQGEFDQIEIIGEADEKEFFELCLREKILARLAASMPTARKKE
Ga0265296_128801613300028032GroundwaterMADLAIIEHHPQRVLEAFRRGEFDQIEIIGEADEKEFFELCF
Ga0265593_109038413300028178Saline WaterMFNLNIIEHRPQRVLEAFRRGEFDQIEIIGQADEKEFFELCFQEKILGALAKDMP
Ga0268283_110285223300028283Saline WaterMDLRVIEHHPQRVLEALRRGEFDALEIVGEADERDFFERLFREKLLARLAATM
Ga0257141_109779813300028623MarineMFNLNLIEHHPQRVLEAFRRGEFDQIEIIGQADDKEFFELCFQEKIVAALAKDMPTARKKVVPGSSGGY
(restricted) Ga0247841_1070715523300029286FreshwaterMDLQIIEHHPKLVLEALRRGEFDALEILGEADEKEFFERLFREKLLEK
Ga0246001_106836233300029889PeatMPDIDLIEYHPQRVLEAFRRGEFDQIEIIGQADEKEFFELCFK
Ga0302271_1036974713300029998BogMFNLNIIEHHPQRVLAASRRGEFDQIEIIGQADEKEFFELCFQEKILVALAQEM
Ga0311337_1133337713300030000FenMFNLNIIEHHPQRVLAAFRRGEFDQIEIIGQADEKEFFELCFQEKIFVALAQEMPTARK
Ga0311348_1125805213300030019FenMPDIDLIEYHPQRVLEAFRRGEFDQIEIIGQADEKEFF
Ga0302046_1088965623300030620SoilMTHLTLIEHHPRAVLEAFRRGEFDSFEWLGEADEREFFELLFREKMLPALAESM
Ga0302323_10148519123300031232FenMNLEIIEHHQQQVLEAFSQGEFDQIEIIGEADEKEFFELCFREKILARLAE
Ga0265316_1104867923300031344RhizosphereMPDLNLIEHHPQRVLDAFRRGEFDQIEIVGQADEKEFFEL
Ga0302320_1205211423300031524BogMPDLNLIEHHPQRVLEAFRRGEFDQIEIIGQADEKEFFEL
Ga0311351_1082378113300031722FenMFNLNIIEHHPQRVLAAFRRGEFDQIEIIGQADEKEFFELCFQEKILVAL
Ga0302321_10083918123300031726FenMFNLNIIEHHPQRVLAASRRGEFDQIEIIGQADEKEFFELCFQEKILVALAQEMPTARK
Ga0315290_1064174423300031834SedimentMNLELVEPHPRRVLEAFRRGEFDDLEVLGQADEKAFFELCFRE
Ga0315280_1034396913300031862SedimentMDLRVIEHHPQRVLEALRRGEFDALEIVGEADERDFFERLF
Ga0315285_1065295313300031885SedimentMDLRVIEHHPQRVLEALRRGEFDALEIVGEADERDFFE
Ga0302322_10157354513300031902FenMIDLNIIEHHPQRVLEAFRRGEFDQIEIIGQADEKEFFELCFQEKILEKLAQ
Ga0315272_1052122413300032018SedimentMNLNIVEHHPQRVLEAFRRGEFDQIEIIGQADEKEFFELCIKE
Ga0315279_1079581023300032070SedimentMELIEHHQQRVVEAFRRGEFDQIEIIGQADEKQFFELC
Ga0315292_1078678513300032143SedimentMNLDLVEPHPRRVLEAFRRGEFDDLEVLGQADEKAFFE
Ga0315292_1102007513300032143SedimentLNLEIIEHRQQWVLEAFRRGEFDQIEVIGEADEKEFF
Ga0315295_1191495623300032156SedimentMADLEIIEHHPQRVMEAFRRGEFDQIEIIGEADEKEFFELCLREKI
Ga0315268_1166245013300032173SedimentMFNLNIIEHHPQRVLEAFRRGEFDQIEIIGQADEK
Ga0315276_1163988213300032177SedimentMFSLNLIEHHPQRVLEAFRRGEFDQIEIIGQADEKEFF
Ga0315286_1019901153300032342SedimentMDLELVEPHPRRVLEAFRRGEFDGLEVLGQADEQAFFELGFREKLL
Ga0315287_1250096713300032397SedimentMLSLNLIEHHPQRVLEAFRRGEFDQIEIIGQADEKEFFELCFK
Ga0315275_1156256613300032401SedimentMDLQIIEHHPQLVLEALRRGEFDALEIVGEADEKEFFDRLFR
Ga0315273_1120728013300032516SedimentMDLQVIEHHPQRVLDALRRGEFDAVEIVGEADEKEFFERLFREKLLEALAATMPTD
Ga0315273_1248432713300032516SedimentMDLQIIEHHPQRVLEALRRGEFDALEIVGEADEREFFERLFREKLLEALAAT
Ga0335085_1150413923300032770SoilMLDLQIIEHHPQRVLEAFRRGEFDQLEIIGEADEKEFFE
Ga0335082_1161882213300032782SoilMADLRLIEYHPQRVLEAFRRGEFDQLEIIGQADEKEFFELCLKEKILDALAEA
Ga0335079_1129131823300032783SoilMNLEIIEHHQQQVLDAFSQGEFDQIEIIGEADEKEFFELCFREKILTR
Ga0335079_1136719823300032783SoilMNLEIIEHHQQQVLEAFSRGEFDQIEIIGEADEKEFFELCFREK
Ga0335069_1039452713300032893SoilMNLEIIEHHQQQVLEAFSQGQFDQIEIIGEADEKEFFELCFREKILARLAQSMPTARKKGFFRNSLGIFHSRI
Ga0335077_1216882613300033158SoilMELIEHHQQRVLEAFRRGEFDQIEIIGEADEKQFF
Ga0334722_1066504813300033233SedimentMNLEIIEHHQQQVLEAFRQGDFDQIEMIGEADEKEFFELCFREKILARLAEQMPTERKKE
Ga0326728_1076414923300033402Peat SoilMLDLNIVEHHPQRVLEAFRRGDFDQIEIVGQADEKEFFELCFKEKILEA
Ga0326728_1116144013300033402Peat SoilMPDLNLIEHHPQRVLEAFRRGEFDQIEIIGQADEKEFFELCFQEKML
Ga0316622_10048164333300033416SoilMDRELVEPHPRRVLEAFRRGAFDGLEVLGQADEKAFFALCFREK
Ga0316622_10296203313300033416SoilMDLSLIEHQPQRVLEDFRRGEFDQIEVIGEADEKEFFELCF
Ga0316625_10142793413300033418SoilMELIEHHQQAVLEAFRRGEFDQIEIIGHADEKQFFELCFQ
Ga0326726_1236446823300033433Peat SoilMLSLNLIEHHPQRVLEAFRRGEFDQIEIIGQADEKEFFELCFKEKLLPAL
Ga0316613_1068327813300033434SoilMNLEIIEHHQPQVLEAFSQGEFDQIEIIGEADEKEFFELCFREKILGRLAESMPTARK
Ga0316620_1120518713300033480SoilMELIEHHPQRVLEAFRRGEFDQIEIIGQADEKQFFELCLKEKILTDLAEEMPTARKKE
Ga0316627_10246447123300033482SoilMDLSLIEHQPQRVLEDFRRGEFDQIEIIGEADEKEFFELCIR
Ga0316626_1137427723300033485SoilMDLSLIEHQPQRVLEDFRQGEFDQIEIIGEADEKEFFELCFREKI
Ga0316630_1117234813300033487SoilMDLSLIEHQPQRVLEDFRRGEFDQIEVIGEADEKEFFELCFREKILDPLAER
Ga0316630_1131670713300033487SoilMDLSLIEYQPQRVLEDFRQGEFDQIEIIGEADEKEFFELCFREKILSALAEPMPSARKKVEVP
Ga0316616_10211850013300033521SoilMELIEHHQQAVVEAFRRGEFDQIEIIGHADEKEFFELCFREKILEA
Ga0316616_10255657423300033521SoilMDLELVEPHPRRVLEAFRQGDFDGLEILGQADEKAFFE
Ga0316616_10400974613300033521SoilMNVEIIEHRQQWVLDAFRQGEFDQIEVIGEADEKEFFELCFQEKILAALAKAM
Ga0316616_10412909013300033521SoilMNLELVEPHPRRVLEAFRRGEFDDLEVLGQADEKA
Ga0316617_10144361613300033557SoilMDLELVEPHPRRVLEAFRQGDLDGLEILGQADEKAFFE
Ga0316617_10157920713300033557SoilMNLEIIEHHQPQVLEALSQGEFDQIEIIGEADEKEF
Ga0316617_10210227413300033557SoilMNLEIIEHHQQQVLEAFSQGQFDQIEIIGEADEKEFFELCFRE
Ga0316617_10248645323300033557SoilMSLTLIEPHPRQVLEAFRQGDFDDLEIIGRADEKEFFELA
Ga0371489_0518731_385_5253300033755Peat SoilMPDLHLIEHHPQRVLEAFRRGEFDQIEIIGQADEKEFFELCFREKML
Ga0334815_044056_430_5583300033797SoilMDLHVIEHHPQRVLDALRRGEFDALEIVGEADEREFFERLFRE
Ga0334828_076569_3_1463300033822SoilMPDIDLIEYHPQRVLEAFRRGEFDQIEIIGQADEKEFFELCFREKMLD
Ga0371487_0464276_2_1123300033982Peat SoilMPDLHLIEHHPQRVLDAFRRGEFDQIEIIGQADEKEF
Ga0370488_254232_1_1803300034691Untreated Peat SoilMANLSLIEYHPQAVLEAFRRGEFDQIEIIGQADEKEFFELCFKEKILDALAKEMPTDRKK

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.