Basic Information | |
---|---|
Family ID | F055709 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 138 |
Average Sequence Length | 38 residues |
Representative Sequence | DDTAAEILMKLQRHGAEHTETLRAFTRDEAEEIIRRL |
Number of Associated Samples | 120 |
Number of Associated Scaffolds | 138 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 1.45 % |
% of genes near scaffold ends (potentially truncated) | 98.55 % |
% of genes from short scaffolds (< 2000 bps) | 92.75 % |
Associated GOLD sequencing projects | 116 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.37 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (94.928 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (11.594 % of family members) |
Environment Ontology (ENVO) | Unclassified (25.362 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.623 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 49.23% β-sheet: 0.00% Coil/Unstructured: 50.77% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 138 Family Scaffolds |
---|---|---|
PF04079 | SMC_ScpB | 42.03 |
PF07883 | Cupin_2 | 15.94 |
PF01842 | ACT | 4.35 |
PF11255 | DUF3054 | 3.62 |
PF08241 | Methyltransf_11 | 3.62 |
PF02616 | SMC_ScpA | 2.90 |
PF06197 | DUF998 | 2.90 |
PF01790 | LGT | 2.17 |
PF03795 | YCII | 1.45 |
PF08734 | GYD | 1.45 |
PF13426 | PAS_9 | 0.72 |
PF00282 | Pyridoxal_deC | 0.72 |
PF01609 | DDE_Tnp_1 | 0.72 |
PF02073 | Peptidase_M29 | 0.72 |
PF02463 | SMC_N | 0.72 |
PF03992 | ABM | 0.72 |
PF08448 | PAS_4 | 0.72 |
PF00296 | Bac_luciferase | 0.72 |
PF13649 | Methyltransf_25 | 0.72 |
PF13340 | DUF4096 | 0.72 |
PF02773 | S-AdoMet_synt_C | 0.72 |
PF01797 | Y1_Tnp | 0.72 |
COG ID | Name | Functional Category | % Frequency in 138 Family Scaffolds |
---|---|---|---|
COG1386 | Chromosome segregation and condensation protein ScpB | Transcription [K] | 42.03 |
COG1354 | Chromatin segregation and condensation protein Rec8/ScpA/Scc1, kleisin family | Replication, recombination and repair [L] | 2.90 |
COG3371 | Uncharacterized membrane protein | Function unknown [S] | 2.90 |
COG0682 | Prolipoprotein diacylglyceryltransferase | Cell wall/membrane/envelope biogenesis [M] | 2.17 |
COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.45 |
COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 1.45 |
COG0076 | Glutamate or tyrosine decarboxylase or a related PLP-dependent protein | Amino acid transport and metabolism [E] | 0.72 |
COG0192 | S-adenosylmethionine synthetase | Coenzyme transport and metabolism [H] | 0.72 |
COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 0.72 |
COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.72 |
COG2309 | Leucyl aminopeptidase (aminopeptidase T) | Amino acid transport and metabolism [E] | 0.72 |
COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.72 |
COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.72 |
COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.72 |
COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.72 |
COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.72 |
COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.72 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 94.93 % |
Unclassified | root | N/A | 5.07 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2070309009|GPKNP_GG3DY5402HI70Y | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 531 | Open in IMG/M |
2124908039|B3_v_NODE_64691_len_17576_cov_15_745221 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 17626 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_100246500 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 510 | Open in IMG/M |
3300000887|AL16A1W_10275512 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 711 | Open in IMG/M |
3300000956|JGI10216J12902_104860063 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1843 | Open in IMG/M |
3300000956|JGI10216J12902_112618422 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
3300001686|C688J18823_10563257 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 728 | Open in IMG/M |
3300002568|C688J35102_120038241 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 855 | Open in IMG/M |
3300004153|Ga0063455_100848385 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 640 | Open in IMG/M |
3300004153|Ga0063455_101585779 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 515 | Open in IMG/M |
3300004479|Ga0062595_101446488 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 630 | Open in IMG/M |
3300005178|Ga0066688_10663076 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
3300005435|Ga0070714_101141723 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 760 | Open in IMG/M |
3300005458|Ga0070681_10036636 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 4925 | Open in IMG/M |
3300005540|Ga0066697_10659868 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
3300005549|Ga0070704_100796077 | Not Available | 844 | Open in IMG/M |
3300005554|Ga0066661_10091266 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1808 | Open in IMG/M |
3300005560|Ga0066670_10931013 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 529 | Open in IMG/M |
3300005561|Ga0066699_10998484 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 580 | Open in IMG/M |
3300005713|Ga0066905_102080992 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 528 | Open in IMG/M |
3300005718|Ga0068866_10009991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 4053 | Open in IMG/M |
3300005764|Ga0066903_101443131 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1295 | Open in IMG/M |
3300006032|Ga0066696_10611769 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
3300006032|Ga0066696_10851868 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
3300006046|Ga0066652_101698258 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
3300006574|Ga0074056_11820083 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 531 | Open in IMG/M |
3300006791|Ga0066653_10524092 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 599 | Open in IMG/M |
3300006800|Ga0066660_10596096 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
3300007764|Ga0102950_1095430 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 839 | Open in IMG/M |
3300009012|Ga0066710_100101929 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3843 | Open in IMG/M |
3300009012|Ga0066710_104593772 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 516 | Open in IMG/M |
3300009088|Ga0099830_11558198 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 550 | Open in IMG/M |
3300009090|Ga0099827_10477608 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1070 | Open in IMG/M |
3300009147|Ga0114129_12116846 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 678 | Open in IMG/M |
3300009177|Ga0105248_11056724 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 917 | Open in IMG/M |
3300009789|Ga0126307_11212464 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 611 | Open in IMG/M |
3300009789|Ga0126307_11588901 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 531 | Open in IMG/M |
3300010038|Ga0126315_10836427 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
3300010041|Ga0126312_10391344 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 988 | Open in IMG/M |
3300010301|Ga0134070_10246836 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 667 | Open in IMG/M |
3300010336|Ga0134071_10260801 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 865 | Open in IMG/M |
3300010336|Ga0134071_10298883 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 808 | Open in IMG/M |
3300010360|Ga0126372_12362877 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
3300010366|Ga0126379_12726648 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 591 | Open in IMG/M |
3300010371|Ga0134125_10286855 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1828 | Open in IMG/M |
3300010373|Ga0134128_12108013 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 621 | Open in IMG/M |
3300010373|Ga0134128_12472494 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 572 | Open in IMG/M |
3300010396|Ga0134126_11446522 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 758 | Open in IMG/M |
3300010396|Ga0134126_11751883 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 681 | Open in IMG/M |
3300010398|Ga0126383_10779513 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1038 | Open in IMG/M |
3300010398|Ga0126383_10968189 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 939 | Open in IMG/M |
3300012092|Ga0136621_1033172 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2125 | Open in IMG/M |
3300012093|Ga0136632_10395188 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 620 | Open in IMG/M |
3300012198|Ga0137364_11163995 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 579 | Open in IMG/M |
3300012200|Ga0137382_11270177 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 521 | Open in IMG/M |
3300012204|Ga0137374_11201871 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 531 | Open in IMG/M |
3300012350|Ga0137372_10551048 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 852 | Open in IMG/M |
3300012350|Ga0137372_10953984 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 603 | Open in IMG/M |
3300012355|Ga0137369_10826873 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 629 | Open in IMG/M |
3300012357|Ga0137384_11545991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 513 | Open in IMG/M |
3300012359|Ga0137385_11223056 | Not Available | 613 | Open in IMG/M |
3300012359|Ga0137385_11531990 | Not Available | 531 | Open in IMG/M |
3300012498|Ga0157345_1003448 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1153 | Open in IMG/M |
3300012915|Ga0157302_10251215 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 662 | Open in IMG/M |
3300012923|Ga0137359_10208187 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album | 1747 | Open in IMG/M |
3300012957|Ga0164303_10443317 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 815 | Open in IMG/M |
3300012958|Ga0164299_10279553 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1014 | Open in IMG/M |
3300012971|Ga0126369_10390835 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1426 | Open in IMG/M |
3300012971|Ga0126369_13213121 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 535 | Open in IMG/M |
3300012984|Ga0164309_10701654 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 803 | Open in IMG/M |
3300012985|Ga0164308_10458614 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1057 | Open in IMG/M |
3300012988|Ga0164306_10491975 | All Organisms → cellular organisms → Bacteria | 941 | Open in IMG/M |
3300013102|Ga0157371_10674077 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 773 | Open in IMG/M |
3300013102|Ga0157371_11621003 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 507 | Open in IMG/M |
3300013105|Ga0157369_10087326 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 3330 | Open in IMG/M |
3300013307|Ga0157372_11745416 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 716 | Open in IMG/M |
3300013501|Ga0120154_1043259 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1089 | Open in IMG/M |
3300014058|Ga0120149_1161591 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
3300014166|Ga0134079_10263344 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 751 | Open in IMG/M |
3300014488|Ga0182001_10043657 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1177 | Open in IMG/M |
3300014488|Ga0182001_10242858 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 690 | Open in IMG/M |
3300014488|Ga0182001_10452995 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
3300014497|Ga0182008_10394463 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 742 | Open in IMG/M |
3300014829|Ga0120104_1016891 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1295 | Open in IMG/M |
3300015357|Ga0134072_10480570 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 507 | Open in IMG/M |
3300015372|Ga0132256_102994314 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
3300015372|Ga0132256_103387891 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 536 | Open in IMG/M |
3300015373|Ga0132257_102165447 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 719 | Open in IMG/M |
3300016319|Ga0182033_11506676 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 607 | Open in IMG/M |
3300017961|Ga0187778_10348638 | All Organisms → cellular organisms → Bacteria | 964 | Open in IMG/M |
3300017974|Ga0187777_10919973 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 629 | Open in IMG/M |
3300018027|Ga0184605_10333115 | Not Available | 686 | Open in IMG/M |
3300018032|Ga0187788_10426426 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 561 | Open in IMG/M |
3300018061|Ga0184619_10105916 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1266 | Open in IMG/M |
3300018089|Ga0187774_11477320 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 502 | Open in IMG/M |
3300018432|Ga0190275_10336502 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1495 | Open in IMG/M |
3300018469|Ga0190270_13034667 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 531 | Open in IMG/M |
3300020010|Ga0193749_1084370 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 580 | Open in IMG/M |
3300020070|Ga0206356_11403094 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2335 | Open in IMG/M |
3300020070|Ga0206356_11448996 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 602 | Open in IMG/M |
3300025909|Ga0207705_10234290 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1397 | Open in IMG/M |
3300025917|Ga0207660_11491962 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 546 | Open in IMG/M |
3300025919|Ga0207657_10122088 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2143 | Open in IMG/M |
3300025921|Ga0207652_10169153 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1961 | Open in IMG/M |
3300025929|Ga0207664_11777863 | Not Available | 539 | Open in IMG/M |
3300025934|Ga0207686_10539156 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
3300025935|Ga0207709_11778227 | Not Available | 513 | Open in IMG/M |
3300025941|Ga0207711_11731594 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 568 | Open in IMG/M |
3300025960|Ga0207651_10308011 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1320 | Open in IMG/M |
3300026315|Ga0209686_1195790 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 552 | Open in IMG/M |
3300027561|Ga0209887_1009662 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2548 | Open in IMG/M |
3300027821|Ga0209811_10444269 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 503 | Open in IMG/M |
3300027869|Ga0209579_10060446 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2007 | Open in IMG/M |
3300028138|Ga0247684_1019023 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1081 | Open in IMG/M |
3300028754|Ga0307297_10355051 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 536 | Open in IMG/M |
3300028755|Ga0307316_10144136 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 847 | Open in IMG/M |
3300028784|Ga0307282_10050069 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1864 | Open in IMG/M |
3300028787|Ga0307323_10134643 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 890 | Open in IMG/M |
3300028800|Ga0265338_10225835 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1395 | Open in IMG/M |
3300028803|Ga0307281_10340170 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 566 | Open in IMG/M |
3300028828|Ga0307312_11193976 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 503 | Open in IMG/M |
3300028885|Ga0307304_10277651 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 735 | Open in IMG/M |
3300031242|Ga0265329_10090391 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 971 | Open in IMG/M |
(restricted) 3300031248|Ga0255312_1147097 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 586 | Open in IMG/M |
3300031250|Ga0265331_10457526 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 573 | Open in IMG/M |
3300031711|Ga0265314_10452215 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 684 | Open in IMG/M |
3300031720|Ga0307469_11707676 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 607 | Open in IMG/M |
3300031753|Ga0307477_10838595 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 609 | Open in IMG/M |
3300031820|Ga0307473_10902744 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 638 | Open in IMG/M |
3300031938|Ga0308175_101480533 | Not Available | 758 | Open in IMG/M |
3300031996|Ga0308176_10949974 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 905 | Open in IMG/M |
3300031996|Ga0308176_11733923 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 666 | Open in IMG/M |
3300032002|Ga0307416_100350933 | All Organisms → cellular organisms → Bacteria | 1493 | Open in IMG/M |
3300032013|Ga0310906_10719299 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 699 | Open in IMG/M |
3300032067|Ga0318524_10434798 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 686 | Open in IMG/M |
3300033550|Ga0247829_11235782 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 619 | Open in IMG/M |
3300033803|Ga0314862_0098808 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 675 | Open in IMG/M |
3300033805|Ga0314864_0100229 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 706 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 11.59% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 10.14% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.70% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.35% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.62% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.62% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.62% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 3.62% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.90% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.90% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 2.90% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.90% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.90% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 2.90% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.17% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.17% |
Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 1.45% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.45% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.45% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.45% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.45% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.45% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 1.45% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.45% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.45% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.45% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.45% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.45% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.45% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.72% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.72% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.72% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.72% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.72% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.72% |
Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.72% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.72% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.72% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.72% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.72% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.72% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.72% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.72% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2070309009 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
2124908039 | Soil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Bog Site B4 | Environmental | Open in IMG/M |
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000887 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-65cm-16A)- 1 week illumina | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006574 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300007764 | Soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_D2_MG | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300012092 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ445A (23.06) | Environmental | Open in IMG/M |
3300012093 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ611 (21.06) | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Host-Associated | Open in IMG/M |
3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300013501 | Permafrost microbial communities from Nunavut, Canada - A35_65cm_0.25M | Environmental | Open in IMG/M |
3300014058 | Permafrost microbial communities from Nunavut, Canada - A3_65cm_0.25M | Environmental | Open in IMG/M |
3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
3300014488 | Bulk soil microbial communities from Mexico - San Felipe (SF) metaG | Environmental | Open in IMG/M |
3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
3300014829 | Permafrost microbial communities from Nunavut, Canada - A10_35cm_6M | Environmental | Open in IMG/M |
3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300020010 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1s2 | Environmental | Open in IMG/M |
3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
3300027561 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 (SPAdes) | Environmental | Open in IMG/M |
3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300028138 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK25 | Environmental | Open in IMG/M |
3300028754 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157 | Environmental | Open in IMG/M |
3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
3300028803 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120 | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Host-Associated | Open in IMG/M |
3300031248 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH5_T0_E5 | Environmental | Open in IMG/M |
3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Host-Associated | Open in IMG/M |
3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Host-Associated | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
3300033803 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_0_10 | Environmental | Open in IMG/M |
3300033805 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_10 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
GPKNP_01960010 | 2070309009 | Soil | DDDTAAEILMKLQRHGAEHTETLRAFTREEAEAIIRRL |
B3_v_00296230 | 2124908039 | Soil | MPHEVAFEITTKLQARGGESTETLRAFTREEAEQIIRRL |
INPhiseqgaiiFebDRAFT_1002465002 | 3300000364 | Soil | PTDEVALEIITKLQRHGAEVTETLRAFTRDEAEEIIRKL* |
AL16A1W_102755123 | 3300000887 | Permafrost | VAMEILMKLNRYGAEHTETLRAFTRDEAEEIVRKL* |
JGI10216J12902_1048600633 | 3300000956 | Soil | AIEILMKLNRYGAEHTETLRAFTREEAEEIVRKL* |
JGI10216J12902_1126184221 | 3300000956 | Soil | APDDGVAVEILMKLQRYGAEHTETLRAFTREEAEEIVKRL* |
C688J18823_105632573 | 3300001686 | Soil | DDDVAIEILMKLNRYGAEHTETLRAFTRTEAEEIVRKL* |
C688J35102_1200382411 | 3300002568 | Soil | FEAPDDGLAVEILMKLQRFGAEHTETLRAFTRDEAEEIIRRL* |
Ga0063455_1008483851 | 3300004153 | Soil | APTDEVALEIITKLQRHGAEVTETLRAFTRDEAEEIIRKL* |
Ga0063455_1015857792 | 3300004153 | Soil | APTDEVALEIITKLQRHGAEVTETLRAFTRDEAEQIIRKL* |
Ga0062595_1014464881 | 3300004479 | Soil | IFEAETDEAALEIITKLQRTGSAETETLRAFTRDEAEAIIRKL* |
Ga0066688_106630761 | 3300005178 | Soil | EAPDDELAVEIVLRLQRFGAEHTETLRAFTRNEAEEIIRRL* |
Ga0070714_1011417231 | 3300005435 | Agricultural Soil | PDDETAAEIILKLQRHGAEHTETLRAFTRDEAEEIIRKL* |
Ga0070681_100366366 | 3300005458 | Corn Rhizosphere | APDDDTALEIVTKLSHHGAEQTETLRAFTRDEAEDIIKKL* |
Ga0066697_106598681 | 3300005540 | Soil | DDETAAEIILKLQRHGAEHTETLRAFTREEAEEIIRKL* |
Ga0070704_1007960771 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | EIFEAPNDEIAVEILLKLQRFGAEHTETLRAFTRDDAEEIIRRL* |
Ga0066661_100912664 | 3300005554 | Soil | DEVAVEILMKLQRYGAEHTETLRAFTRQEAEEIVKRL* |
Ga0066670_109310131 | 3300005560 | Soil | AIEILMKLNRYGAEHTETLRAFTREEAEGIVRKL* |
Ga0066699_109984841 | 3300005561 | Soil | VAIEILMKLNRYGAEHTETLRAFTREEAEEIVRKL* |
Ga0066905_1020809921 | 3300005713 | Tropical Forest Soil | ALEIVTKLSHHGAEQTETLRAFTRDEAEDIIKKL* |
Ga0068866_100099911 | 3300005718 | Miscanthus Rhizosphere | DVAIEILMKLNRYGAEHTETLRAFTRTEAEEIVRKL* |
Ga0066903_1014431313 | 3300005764 | Tropical Forest Soil | TAAEILMKLQRHGAEHTETLRAFTRDEAEAIIRRL* |
Ga0066696_106117693 | 3300006032 | Soil | DDETATEIILKLQRHGAEHTETLRAFTRDEAEAIIRRL* |
Ga0066696_108518682 | 3300006032 | Soil | DETAAEIIMKLQRHGAEHTETLRAFTREEAEEIIRKL* |
Ga0066652_1016982582 | 3300006046 | Soil | PDDEVAIEILMKLNRYGAEHTETLRAFTREEAEEIVRKL* |
Ga0074056_118200832 | 3300006574 | Soil | DDDVAIEILMKLNRYGAEHTETLRAFTRAEAEEIVRKL* |
Ga0066653_105240921 | 3300006791 | Soil | DDTAAEILMKLQRHGAEHTETLRAFTRDEAEEIIRRL* |
Ga0066660_105960961 | 3300006800 | Soil | DDEVAIEILMKLNRYGAEHTETLRAFTREEAEEIVRKL* |
Ga0102950_10954302 | 3300007764 | Soil | DDETALEIMTRLGRHGAEQTETLRAFTRQEAEEIIKKL* |
Ga0066710_1001019295 | 3300009012 | Grasslands Soil | ETAAEIIMKLQRHGAEHTETLRAFTRDEAEEIIRRV |
Ga0066710_1045937721 | 3300009012 | Grasslands Soil | DDEVAIEILMKLQRHGAEQTETLRAFTREEAEDIVKRL |
Ga0099830_115581981 | 3300009088 | Vadose Zone Soil | FEAPDDDVAVEILMKLQRYGAEHTETLRGFTREEAEAIVRKL* |
Ga0099827_104776081 | 3300009090 | Vadose Zone Soil | DAPDDDVAMEILMKLNRYGAEHTETLRAFTRGEAEEIIRRL* |
Ga0114129_121168461 | 3300009147 | Populus Rhizosphere | DDDVAIEILMKLNRYGAEHTETLRAFTRDEAEEIVRKL* |
Ga0105248_110567243 | 3300009177 | Switchgrass Rhizosphere | TAAEILMKLQRHGAEHTETLRGFTREEAEAIVKRL* |
Ga0126307_112124642 | 3300009789 | Serpentine Soil | DDETAAEILLKLQRFGAEHTETLRAFTREEAEAIVRRL* |
Ga0126307_115889012 | 3300009789 | Serpentine Soil | DDETAIEILMKLQQFGAEHTETLRAFTREEAEEIIRRI* |
Ga0126315_108364272 | 3300010038 | Serpentine Soil | AVEILMKLQRFGAEHTETLRAFTRDEAEEIIRRL* |
Ga0126312_103913443 | 3300010041 | Serpentine Soil | VAMEIIMRLNRFAAEHTETLRAFTREEAAEIIRRI* |
Ga0134070_102468363 | 3300010301 | Grasslands Soil | EAPDDDVAVEILMKLQRYGAEHTETLRAFTRDEAEQIVRKL* |
Ga0134071_102608013 | 3300010336 | Grasslands Soil | AVEILMKLQRYGAEHTETLRGFTREEAEEIVKRL* |
Ga0134071_102988831 | 3300010336 | Grasslands Soil | DDETATEIILKLQRHGAEHTETLRAFTRDEAEEIIRRL* |
Ga0126372_123628771 | 3300010360 | Tropical Forest Soil | PDDETALQIVTQLAHHGAEQTETLRAFTRDEAEEIIKKL* |
Ga0126379_127266481 | 3300010366 | Tropical Forest Soil | DELAVEILMKLQRFGAEHTETLRAFTRDEAEEIIRRL* |
Ga0134125_102868554 | 3300010371 | Terrestrial Soil | VALEIITKLQRHGAEATETLRAFTRDEAEAIIRKL* |
Ga0134128_121080132 | 3300010373 | Terrestrial Soil | DDDTALEIVTKLSHHGAEQTETLRAFTRDEAEDIIKKL* |
Ga0134128_124724941 | 3300010373 | Terrestrial Soil | DDEVAIEILMKLNRYGAEHTETLRAFTREEAEGIVRKL* |
Ga0134126_114465221 | 3300010396 | Terrestrial Soil | SVAMEILMKLNRYGAEHTETLPAFTREEAEEIVRKL* |
Ga0134126_117518831 | 3300010396 | Terrestrial Soil | LEAETDEAALEIITKLQRTGSAETETLRAFTRDEAEAIIRKL* |
Ga0126383_107795131 | 3300010398 | Tropical Forest Soil | DTAAEILMKLQRHGAEHTETLRAFTRDEAEAIVKRL* |
Ga0126383_109681893 | 3300010398 | Tropical Forest Soil | AQDDETATEIILKLQRHGAEHTETLRAFTRDEAEEIIRRI* |
Ga0136621_10331724 | 3300012092 | Polar Desert Sand | DDERAVEILMKLQRYGAEHTETLRAFTREEAEAIIRRL* |
Ga0136632_103951882 | 3300012093 | Polar Desert Sand | VEIFEAPNDDIALEILMKLQRFGAEHSETLRAFTRDEAEQIVRKL* |
Ga0137364_111639952 | 3300012198 | Vadose Zone Soil | DTAAEILMKLQRHGAEHTETLRAFTRDEAEEIIRRL* |
Ga0137382_112701772 | 3300012200 | Vadose Zone Soil | ETAAEIILKLQRHGAEHTETLRAFTRDEAEEIIRKL* |
Ga0137374_112018711 | 3300012204 | Vadose Zone Soil | IFEAPTDDIAIEVVMKLNRYGAEQTETLRAFTREEAEEIVRKL* |
Ga0137372_105510482 | 3300012350 | Vadose Zone Soil | DDTAVEILLKLQRYGAEHTETLRAFTRDEAEAIIRKL* |
Ga0137372_109539841 | 3300012350 | Vadose Zone Soil | DVAVEILMKLQRYGAEHTETLRAFTRSEAEAIVKKL* |
Ga0137369_108268731 | 3300012355 | Vadose Zone Soil | APDDDIAVEILLKLQRYGAEHTETLRAFTRDEAEEIIRKL* |
Ga0137384_115459912 | 3300012357 | Vadose Zone Soil | ALEIVTKLSHHGAEQTETLRAFTRDEAEGIIKKL* |
Ga0137385_112230561 | 3300012359 | Vadose Zone Soil | ETAAEIILKLQRHGAEHTETLRAFTRNEAEEIIRKL* |
Ga0137385_115319901 | 3300012359 | Vadose Zone Soil | EVFEAPDDGIALEIITKLGRHGAEETETLRAFTRDEAEEIIRRL* |
Ga0157345_10034481 | 3300012498 | Arabidopsis Rhizosphere | TPDDDTALEIVTKLSHHGAEQTETLRAFTRDEAEAIVRRL* |
Ga0157302_102512151 | 3300012915 | Soil | AIEILMKLNRYGAEHTETLRAFTREEAEGIIRRL* |
Ga0137359_102081871 | 3300012923 | Vadose Zone Soil | PDDETALEIITKLQRHGGEETETLRAFTREEAEAIIRKL* |
Ga0164303_104433173 | 3300012957 | Soil | AIEILMKLNRYGAEHTEALRAFTREEAAGIVRRL* |
Ga0164299_102795531 | 3300012958 | Soil | NDDVAIEIVMKLNRYGAEHTETLRAFTREEAEEIVRKL* |
Ga0126369_103908351 | 3300012971 | Tropical Forest Soil | PDDDTALEIVTKLSHHGAEQTETLRAFTRDEAEDIIRKL* |
Ga0126369_132131212 | 3300012971 | Tropical Forest Soil | ALEIVTKLSHHGAEQTETLRAFTRDEAENIIKKL* |
Ga0164309_107016541 | 3300012984 | Soil | PDDDTAAEILMKLQRHGAEHTETLRAFTRDEAEAIVRRL* |
Ga0164308_104586141 | 3300012985 | Soil | PDDDTALEIVTKLSHHGAEQTETLRAFTRDQAEGIIKKL* |
Ga0164306_104919753 | 3300012988 | Soil | DDVAIEILMKLNRYGAEHTETLRAFTRAEAEEIVRKL* |
Ga0157371_106740771 | 3300013102 | Corn Rhizosphere | DDETALEIITKLGRHGAEETETLRAFTRDEAEQIIRRL* |
Ga0157371_116210033 | 3300013102 | Corn Rhizosphere | DEALEIITKLQRHGAEETETLRAFTRDEAEEIIRKL* |
Ga0157369_100873266 | 3300013105 | Corn Rhizosphere | DDTALEIVTKLSHHGAEQTETLRAFTRDEAEDIIKKL* |
Ga0157372_117454163 | 3300013307 | Corn Rhizosphere | DDETALAIITRLGSHGAEETETLRAFTREEAEEIIRKL* |
Ga0120154_10432593 | 3300013501 | Permafrost | VAMEILMKLNRYGAEHTETLRAFTREEAEEIVRKL* |
Ga0120149_11615911 | 3300014058 | Permafrost | EVAMEILMKLNRYGAEHTETLRAFTRDEAEAIIRRL* |
Ga0134079_102633441 | 3300014166 | Grasslands Soil | DETATEIILKLQRHGAEHTETLRAFTRDEAEAIIRRL* |
Ga0182001_100436571 | 3300014488 | Soil | DEIAIEILMKLQRHGAEQTETLRAFTREEAEDIVKRL* |
Ga0182001_102428582 | 3300014488 | Soil | ETAAEILMKLQRHGAEHTETLRAFTRDEAEAIIRKL* |
Ga0182001_104529951 | 3300014488 | Soil | EQAVEILMKLQRYGAEHTETLRAFTRDEAEEIIRRL* |
Ga0182008_103944631 | 3300014497 | Rhizosphere | SDETAAEIVMKLQRHGAEHTETLRAFTREEAEEIIRKI* |
Ga0120104_10168912 | 3300014829 | Permafrost | APDDETALEIITKLGRHGAEETETLRAFTRDEAEEIIRRL* |
Ga0134072_104805701 | 3300015357 | Grasslands Soil | DDETAAEIIMKLQRHGAEHTETLRAFTRDEAEEIIRKV* |
Ga0132256_1029943142 | 3300015372 | Arabidopsis Rhizosphere | DDELAVEILMKLQRFGAEHTETLRAFTRDEAEEIIRRL* |
Ga0132256_1033878911 | 3300015372 | Arabidopsis Rhizosphere | DDATALEIITKLGRHGAEETETLRAFTRDEAEEIIRRL* |
Ga0132257_1021654471 | 3300015373 | Arabidopsis Rhizosphere | DDTVAAEILLRLQRHGAEHTETLRAFTREEAEEIIRRL* |
Ga0182033_115066761 | 3300016319 | Soil | DAPNDETAVEILLKLQRFGAEHTETLKAFTREEAEEIIRRV |
Ga0187778_103486381 | 3300017961 | Tropical Peatland | DDEVALEIVTKLQQYGGDHTETLRAFKRVEAEAIIRKL |
Ga0187777_109199732 | 3300017974 | Tropical Peatland | DDETALEIMTRLGRHGAEATETLRAFTREEAESIIKKL |
Ga0184605_103331151 | 3300018027 | Groundwater Sediment | EVAVEILMKLQRFGAEHTETLRAFTREEAENIVKRL |
Ga0187788_104264261 | 3300018032 | Tropical Peatland | SVALEIITKLGSGGAEETETLRAFTREEAEEIIRRL |
Ga0184619_101059163 | 3300018061 | Groundwater Sediment | DDETAAEIILKLQRHGAEHTETLRAFTRDEAEEIIRKL |
Ga0187774_114773201 | 3300018089 | Tropical Peatland | EAPDDETALEIVTKLGQRGGEETETLRAFTRDEAEDIIKKL |
Ga0190275_103365021 | 3300018432 | Soil | EDAVEILMKLQRFAAEHTETLRAFTREEAEQIVKAS |
Ga0190270_130346671 | 3300018469 | Soil | FECPDDDKAAEILMKLQRHGAEHTETLRGFTREEAEAIIRRL |
Ga0193749_10843702 | 3300020010 | Soil | APSDEIALEIITKLQRHGAEETETLRAFTRDEAEAIIRKL |
Ga0206356_114030941 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | DTDEAALEIITKLQRTGSAETETLRAFTRDEAEEIIRKL |
Ga0206356_114489962 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | VLVKDPDDDTAAEILMKLQRHGAEHTETLRAFTRDEAEAIVKRL |
Ga0207705_102342901 | 3300025909 | Corn Rhizosphere | VEIFEAETDEAALEIITLLQRTGSAETETLRAFTRDEAEEIIRKL |
Ga0207660_114919621 | 3300025917 | Corn Rhizosphere | TDEAALEIITKLQRTGSAETETLRAFTRDEAEEIIRKL |
Ga0207657_101220881 | 3300025919 | Corn Rhizosphere | FEAETDEAALEIITLLQRAGSAETETLRAFTRDEAEEIIRKL |
Ga0207652_101691531 | 3300025921 | Corn Rhizosphere | EAPDDDTALEIVTKLSHHGAEQTETLRAFTRDEAEDIIKKL |
Ga0207664_117778631 | 3300025929 | Agricultural Soil | ETALEIVTKLGQAGGEDTETLRAFTREEAEEIIRKL |
Ga0207686_105391562 | 3300025934 | Miscanthus Rhizosphere | NDEIAVEILLKLQRFGAEHTETLRAFTRDDAEEIIRRL |
Ga0207709_117782272 | 3300025935 | Miscanthus Rhizosphere | RRPTTRSVEILLKLQRFGAEHTETLRAFTRDDAEEIIRRL |
Ga0207711_117315941 | 3300025941 | Switchgrass Rhizosphere | TAAEILMKLQRHGAEHTETLRGFTREEAEAIVKRL |
Ga0207651_103080113 | 3300025960 | Switchgrass Rhizosphere | EAPDDDTALEIVTKLSHHGAEQTETLRAFTRDQAEGIIKKL |
Ga0209686_11957902 | 3300026315 | Soil | EAPDDDTALEIVTKLSHHGAEQTETLRAFTRDEAEGIIKKL |
Ga0209887_10096621 | 3300027561 | Groundwater Sand | DDDVAMEILMKLNRYGAEHTETLRAFSRDEAEEIVRKL |
Ga0209811_104442691 | 3300027821 | Surface Soil | PDDDTAAEILMKLQRHGAEHTETLRAFTRDEAEAIVRRL |
Ga0209579_100604464 | 3300027869 | Surface Soil | APDDDTALEIVTKLSHHGAEQTETLRAFTREEAEEIIKKL |
Ga0247684_10190233 | 3300028138 | Soil | TAAEILMKLQRHGAEHTETLRAFTRDEAEAIVRRL |
Ga0307297_103550512 | 3300028754 | Soil | DTAAEILMKLQRHGAEHTETLRAFTRDEAEAIVKRL |
Ga0307316_101441361 | 3300028755 | Soil | DETAAEIILKLQRHGAEHTETLRAFTRDEAEEIIRKL |
Ga0307282_100500694 | 3300028784 | Soil | DETALEIITKLGRHGAEETETLRAFTRDEAEEIIKRL |
Ga0307323_101346433 | 3300028787 | Soil | TAAEIILKLQRHGAEHTETLRAFTRDEAEEIIRKL |
Ga0265338_102258351 | 3300028800 | Rhizosphere | FEAPDDEIALEIVTKLQHFGGDHTETLRAFTRDEAEAIIRKL |
Ga0307281_103401701 | 3300028803 | Soil | PDDDIAIEILMKLNRYGAEHTETLRAFTREEAEGIVRKL |
Ga0307312_111939762 | 3300028828 | Soil | VAVEILMKLQRYGAEHTETLRGFTREEAEEIVKRL |
Ga0307304_102776513 | 3300028885 | Soil | YDDVAIEILMKLNRYGAEHTETLRAFTRGEAEEIIRKL |
Ga0265329_100903911 | 3300031242 | Rhizosphere | VFEAPDDEIALEIVTKLQHFGGDHTETLRAFTRDEAEAIIRKL |
(restricted) Ga0255312_11470973 | 3300031248 | Sandy Soil | EAPDDATALEIITRLGQGGGEDTETLRAFTRDEAEEIIRRL |
Ga0265331_104575261 | 3300031250 | Rhizosphere | DEIALEIVTKLQHFGGDHTETLRAFTREEAEAIIRKL |
Ga0265314_104522152 | 3300031711 | Rhizosphere | QVFEAPDDEVALEIVQKLQQFGGAHAETLRAFTREEAEGIIRRL |
Ga0307469_117076762 | 3300031720 | Hardwood Forest Soil | FEAPDDETALEIITKLQRHGAEETETLRAFTRDEAEMIIRRL |
Ga0307477_108385951 | 3300031753 | Hardwood Forest Soil | DVALEIVTRLQQYGAEQTETLRAFTREEAAEIIRRL |
Ga0307473_109027441 | 3300031820 | Hardwood Forest Soil | DDETAFEIVSRLQGHGAEQTETLRAFTREEAEGIIKKL |
Ga0308175_1014805331 | 3300031938 | Soil | APDDEVAVEILLKLQRFGAEQTETLRAFTREEAEDIIRRL |
Ga0308176_109499741 | 3300031996 | Soil | EAALEIITKLQRTGSAETETLRAFTRDEAEEIIRKL |
Ga0308176_117339233 | 3300031996 | Soil | DEAALEIITKLQRTGSAETETLRAFTREEAEEIIRKL |
Ga0307416_1003509333 | 3300032002 | Rhizosphere | APDDDTAAEILMKLQRHGAEHTETLRAFTRDEAEAIIRRL |
Ga0310906_107192992 | 3300032013 | Soil | EAPDDEKAAEILMRLQRHGAEHTETLRGFTREEAESIIRRL |
Ga0318524_104347981 | 3300032067 | Soil | VFEAPNDSVALEIITKLGSGGAEETETLRAFTREEAEEIIRRL |
Ga0247829_112357821 | 3300033550 | Soil | TAAEILMKLQRHGAEHTETLRAFTRDEAEAIIRRL |
Ga0314862_0098808_3_125 | 3300033803 | Peatland | APDDETALEIVTRLGRHGAEQTETLRAFTREEAEEIIKKL |
Ga0314864_0100229_577_705 | 3300033805 | Peatland | FEAPDDDTALEIVTKLSHHGAEQTETLRAFTRDEAEIIIKKL |
⦗Top⦘ |