Basic Information | |
---|---|
Family ID | F055529 |
Family Type | Metagenome |
Number of Sequences | 138 |
Average Sequence Length | 50 residues |
Representative Sequence | MKKNTGTTHDEPVGIVISGGHPLSEAAPRFSAYIWAPGPEDERTEGAHAA |
Number of Associated Samples | 100 |
Number of Associated Scaffolds | 138 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 16.67 % |
% of genes near scaffold ends (potentially truncated) | 27.54 % |
% of genes from short scaffolds (< 2000 bps) | 83.33 % |
Associated GOLD sequencing projects | 89 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.18 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (78.261 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil (9.420 % of family members) |
Environment Ontology (ENVO) | Unclassified (43.478 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (58.696 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 3.85% β-sheet: 0.00% Coil/Unstructured: 96.15% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.18 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 138 Family Scaffolds |
---|---|---|
PF15887 | Peptidase_Mx | 14.49 |
PF10005 | zinc-ribbon_6 | 6.52 |
PF07478 | Dala_Dala_lig_C | 4.35 |
PF06831 | H2TH | 3.62 |
PF01545 | Cation_efflux | 1.45 |
PF16916 | ZT_dimer | 1.45 |
PF08240 | ADH_N | 0.72 |
PF03848 | TehB | 0.72 |
PF00392 | GntR | 0.72 |
PF10672 | Methyltrans_SAM | 0.72 |
PF01149 | Fapy_DNA_glyco | 0.72 |
PF00155 | Aminotran_1_2 | 0.72 |
COG ID | Name | Functional Category | % Frequency in 138 Family Scaffolds |
---|---|---|---|
COG0266 | Formamidopyrimidine-DNA glycosylase | Replication, recombination and repair [L] | 4.35 |
COG0053 | Divalent metal cation (Fe/Co/Zn/Cd) efflux pump | Inorganic ion transport and metabolism [P] | 1.45 |
COG1230 | Co/Zn/Cd efflux system component | Inorganic ion transport and metabolism [P] | 1.45 |
COG3965 | Predicted Co/Zn/Cd cation transporter, cation efflux family | Inorganic ion transport and metabolism [P] | 1.45 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 78.26 % |
Unclassified | root | N/A | 21.74 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000363|ICChiseqgaiiFebDRAFT_10953513 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 749 | Open in IMG/M |
3300000956|JGI10216J12902_109187968 | Not Available | 915 | Open in IMG/M |
3300001686|C688J18823_10595912 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 705 | Open in IMG/M |
3300004114|Ga0062593_100107436 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp. | 1990 | Open in IMG/M |
3300004153|Ga0063455_101453154 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 532 | Open in IMG/M |
3300004157|Ga0062590_102684651 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
3300004480|Ga0062592_101065641 | Not Available | 744 | Open in IMG/M |
3300004643|Ga0062591_100200835 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp. | 1463 | Open in IMG/M |
3300004643|Ga0062591_101238295 | Not Available | 729 | Open in IMG/M |
3300005093|Ga0062594_100836805 | Not Available | 857 | Open in IMG/M |
3300005186|Ga0066676_10706829 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 686 | Open in IMG/M |
3300005290|Ga0065712_10025407 | All Organisms → cellular organisms → Bacteria | 1231 | Open in IMG/M |
3300005327|Ga0070658_10681971 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 892 | Open in IMG/M |
3300005328|Ga0070676_10029694 | All Organisms → cellular organisms → Bacteria | 3111 | Open in IMG/M |
3300005328|Ga0070676_11066697 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 609 | Open in IMG/M |
3300005329|Ga0070683_100097436 | All Organisms → cellular organisms → Bacteria | 2767 | Open in IMG/M |
3300005329|Ga0070683_100347334 | All Organisms → cellular organisms → Bacteria | 1413 | Open in IMG/M |
3300005331|Ga0070670_100830560 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
3300005337|Ga0070682_100217572 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1357 | Open in IMG/M |
3300005338|Ga0068868_100570804 | All Organisms → cellular organisms → Bacteria | 999 | Open in IMG/M |
3300005338|Ga0068868_101927773 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 560 | Open in IMG/M |
3300005339|Ga0070660_101562926 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 561 | Open in IMG/M |
3300005344|Ga0070661_101184191 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 639 | Open in IMG/M |
3300005344|Ga0070661_101702617 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 534 | Open in IMG/M |
3300005353|Ga0070669_101211438 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
3300005354|Ga0070675_100357129 | All Organisms → cellular organisms → Bacteria | 1297 | Open in IMG/M |
3300005355|Ga0070671_100091323 | All Organisms → cellular organisms → Bacteria | 2550 | Open in IMG/M |
3300005364|Ga0070673_101885416 | Not Available | 567 | Open in IMG/M |
3300005434|Ga0070709_10799774 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 740 | Open in IMG/M |
3300005436|Ga0070713_102404342 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 509 | Open in IMG/M |
3300005456|Ga0070678_101023554 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 760 | Open in IMG/M |
3300005457|Ga0070662_101241522 | Not Available | 641 | Open in IMG/M |
3300005457|Ga0070662_101773388 | Not Available | 533 | Open in IMG/M |
3300005458|Ga0070681_10088887 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3041 | Open in IMG/M |
3300005539|Ga0068853_101465092 | Not Available | 661 | Open in IMG/M |
3300005543|Ga0070672_100058841 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3022 | Open in IMG/M |
3300005543|Ga0070672_100518797 | All Organisms → cellular organisms → Bacteria | 1032 | Open in IMG/M |
3300005547|Ga0070693_100221751 | All Organisms → cellular organisms → Bacteria | 1239 | Open in IMG/M |
3300005547|Ga0070693_100600817 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 794 | Open in IMG/M |
3300005564|Ga0070664_100011832 | All Organisms → cellular organisms → Bacteria | 7084 | Open in IMG/M |
3300005564|Ga0070664_102191584 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
3300005834|Ga0068851_10558541 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 692 | Open in IMG/M |
3300005841|Ga0068863_101199742 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 765 | Open in IMG/M |
3300006046|Ga0066652_100006044 | All Organisms → cellular organisms → Bacteria | 7223 | Open in IMG/M |
3300006806|Ga0079220_10259427 | All Organisms → cellular organisms → Bacteria | 1046 | Open in IMG/M |
3300006918|Ga0079216_11000615 | Not Available | 645 | Open in IMG/M |
3300009094|Ga0111539_10435873 | All Organisms → cellular organisms → Bacteria | 1526 | Open in IMG/M |
3300009098|Ga0105245_11495058 | Not Available | 726 | Open in IMG/M |
3300009156|Ga0111538_10153867 | All Organisms → cellular organisms → Bacteria | 2921 | Open in IMG/M |
3300009156|Ga0111538_12804284 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 610 | Open in IMG/M |
3300009174|Ga0105241_12559554 | Not Available | 512 | Open in IMG/M |
3300009177|Ga0105248_11285546 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 827 | Open in IMG/M |
3300009789|Ga0126307_10032217 | All Organisms → cellular organisms → Bacteria | 4037 | Open in IMG/M |
3300009789|Ga0126307_10143051 | All Organisms → cellular organisms → Bacteria | 1912 | Open in IMG/M |
3300009789|Ga0126307_10207797 | All Organisms → cellular organisms → Bacteria | 1571 | Open in IMG/M |
3300009840|Ga0126313_10010879 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5730 | Open in IMG/M |
3300009840|Ga0126313_10138772 | All Organisms → cellular organisms → Bacteria | 1825 | Open in IMG/M |
3300009840|Ga0126313_10202186 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1525 | Open in IMG/M |
3300010036|Ga0126305_10675339 | Not Available | 698 | Open in IMG/M |
3300010037|Ga0126304_10886398 | Not Available | 606 | Open in IMG/M |
3300010044|Ga0126310_10344679 | Not Available | 1042 | Open in IMG/M |
3300010045|Ga0126311_10651601 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
3300010045|Ga0126311_10860046 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 734 | Open in IMG/M |
3300010166|Ga0126306_10175175 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 1608 | Open in IMG/M |
3300010166|Ga0126306_10880436 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 725 | Open in IMG/M |
3300010397|Ga0134124_11187525 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 783 | Open in IMG/M |
3300010400|Ga0134122_13116965 | Not Available | 518 | Open in IMG/M |
3300010401|Ga0134121_11750120 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 646 | Open in IMG/M |
3300012212|Ga0150985_102564273 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 554 | Open in IMG/M |
3300012212|Ga0150985_117129311 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 680 | Open in IMG/M |
3300012212|Ga0150985_118528640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Hyalangium → Hyalangium minutum | 1655 | Open in IMG/M |
3300012212|Ga0150985_120487253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae | 1647 | Open in IMG/M |
3300012469|Ga0150984_102794124 | Not Available | 639 | Open in IMG/M |
3300012469|Ga0150984_104524588 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 730 | Open in IMG/M |
3300012469|Ga0150984_117484039 | Not Available | 782 | Open in IMG/M |
3300012905|Ga0157296_10047543 | All Organisms → cellular organisms → Bacteria | 995 | Open in IMG/M |
3300012955|Ga0164298_10019349 | All Organisms → cellular organisms → Bacteria | 2869 | Open in IMG/M |
3300012955|Ga0164298_11652209 | Not Available | 507 | Open in IMG/M |
3300012957|Ga0164303_10056052 | All Organisms → cellular organisms → Bacteria | 1771 | Open in IMG/M |
3300012987|Ga0164307_11435707 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 582 | Open in IMG/M |
3300013100|Ga0157373_11365487 | Not Available | 538 | Open in IMG/M |
3300013102|Ga0157371_11457082 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 533 | Open in IMG/M |
3300013104|Ga0157370_11665493 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 573 | Open in IMG/M |
3300013308|Ga0157375_11980210 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 692 | Open in IMG/M |
3300014325|Ga0163163_11266394 | Not Available | 800 | Open in IMG/M |
3300014326|Ga0157380_12595811 | Not Available | 573 | Open in IMG/M |
3300014969|Ga0157376_11393330 | Not Available | 732 | Open in IMG/M |
3300015371|Ga0132258_11603467 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 1643 | Open in IMG/M |
3300015371|Ga0132258_12069451 | All Organisms → cellular organisms → Bacteria | 1431 | Open in IMG/M |
3300015372|Ga0132256_100978597 | All Organisms → cellular organisms → Bacteria | 962 | Open in IMG/M |
3300015374|Ga0132255_101493032 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 1022 | Open in IMG/M |
3300017792|Ga0163161_10156271 | All Organisms → cellular organisms → Bacteria | 1736 | Open in IMG/M |
3300018000|Ga0184604_10379559 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 504 | Open in IMG/M |
3300018920|Ga0190273_10324182 | All Organisms → cellular organisms → Bacteria | 1043 | Open in IMG/M |
3300019356|Ga0173481_10462060 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 637 | Open in IMG/M |
3300019361|Ga0173482_10431757 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 621 | Open in IMG/M |
3300021445|Ga0182009_10016247 | All Organisms → cellular organisms → Bacteria | 2722 | Open in IMG/M |
3300022756|Ga0222622_10018534 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3496 | Open in IMG/M |
3300022756|Ga0222622_10169669 | Not Available | 1424 | Open in IMG/M |
3300025321|Ga0207656_10507902 | Not Available | 612 | Open in IMG/M |
3300025901|Ga0207688_10150201 | All Organisms → cellular organisms → Bacteria | 1376 | Open in IMG/M |
3300025901|Ga0207688_10348916 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
3300025901|Ga0207688_10949738 | Not Available | 544 | Open in IMG/M |
3300025904|Ga0207647_10142122 | All Organisms → cellular organisms → Bacteria | 1406 | Open in IMG/M |
3300025907|Ga0207645_10017224 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 4772 | Open in IMG/M |
3300025907|Ga0207645_10230766 | All Organisms → cellular organisms → Bacteria | 1222 | Open in IMG/M |
3300025907|Ga0207645_11155120 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 521 | Open in IMG/M |
3300025912|Ga0207707_10969432 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 699 | Open in IMG/M |
3300025926|Ga0207659_10523798 | All Organisms → cellular organisms → Bacteria | 1005 | Open in IMG/M |
3300025931|Ga0207644_10023289 | All Organisms → cellular organisms → Bacteria | 4240 | Open in IMG/M |
3300025931|Ga0207644_10024798 | All Organisms → cellular organisms → Bacteria | 4120 | Open in IMG/M |
3300025931|Ga0207644_11022061 | Not Available | 694 | Open in IMG/M |
3300025940|Ga0207691_10092373 | All Organisms → cellular organisms → Bacteria | 2710 | Open in IMG/M |
3300025940|Ga0207691_10336786 | All Organisms → cellular organisms → Bacteria | 1292 | Open in IMG/M |
3300025940|Ga0207691_11668818 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 516 | Open in IMG/M |
3300025941|Ga0207711_10199518 | All Organisms → cellular organisms → Bacteria | 1825 | Open in IMG/M |
3300025942|Ga0207689_10437873 | Not Available | 1092 | Open in IMG/M |
3300025945|Ga0207679_10006640 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 7321 | Open in IMG/M |
3300026023|Ga0207677_12013625 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 537 | Open in IMG/M |
3300026142|Ga0207698_10730360 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
3300028381|Ga0268264_10060592 | All Organisms → cellular organisms → Bacteria | 3172 | Open in IMG/M |
3300031548|Ga0307408_100640380 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 949 | Open in IMG/M |
3300031824|Ga0307413_10617128 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 890 | Open in IMG/M |
3300031852|Ga0307410_10578979 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 934 | Open in IMG/M |
3300031901|Ga0307406_11428895 | Not Available | 607 | Open in IMG/M |
3300031911|Ga0307412_12305316 | Not Available | 502 | Open in IMG/M |
3300031938|Ga0308175_100030423 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 4455 | Open in IMG/M |
3300031938|Ga0308175_100140993 | All Organisms → cellular organisms → Bacteria | 2297 | Open in IMG/M |
3300031938|Ga0308175_100834780 | All Organisms → cellular organisms → Bacteria | 1010 | Open in IMG/M |
3300031938|Ga0308175_101484202 | Not Available | 757 | Open in IMG/M |
3300031938|Ga0308175_101748324 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 696 | Open in IMG/M |
3300031939|Ga0308174_10350367 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1177 | Open in IMG/M |
3300031939|Ga0308174_11765813 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 532 | Open in IMG/M |
3300031996|Ga0308176_10241051 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Stigmatella → Stigmatella aurantiaca | 1727 | Open in IMG/M |
3300032002|Ga0307416_100251982 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 1719 | Open in IMG/M |
3300032005|Ga0307411_10073680 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 2324 | Open in IMG/M |
3300032074|Ga0308173_10022572 | All Organisms → cellular organisms → Bacteria | 4247 | Open in IMG/M |
3300032074|Ga0308173_10176424 | All Organisms → cellular organisms → Bacteria | 1753 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 9.42% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 8.70% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 7.25% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 6.52% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.80% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 5.07% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 5.07% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 4.35% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 3.62% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.62% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.90% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.90% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 2.90% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.90% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.17% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.17% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 2.17% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.17% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.17% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 2.17% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.45% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.45% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.45% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.45% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.45% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.45% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.72% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.72% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.72% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.72% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.72% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.72% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.72% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.72% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.72% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.72% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012905 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2 | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
ICChiseqgaiiFebDRAFT_109535131 | 3300000363 | Soil | GDTPHSAAIHMKKNTGTTHNEPVGIVISGGHPLSEAAPRFSAYIWAPGPEEERTQEAHAA |
JGI10216J12902_1091879682 | 3300000956 | Soil | MMKKSTHASSDEPVGIVISGGRSSSEPAPRFSAYIWAPAPEEESVAEVQA |
C688J18823_105959121 | 3300001686 | Soil | MKKKSAPKHDEPVGIVISGGHPHSEAAPRFSAYIWAPGPEDESTEEVQAA* |
Ga0062593_1001074361 | 3300004114 | Soil | MKYSSTNVAKDEPVGIIISGGRSRAESAPRFSAYIWAPGPEEESVED |
Ga0063455_1014531541 | 3300004153 | Soil | MKQTSHAQVDEPVGIVISGGHAPEIAPRFSAYMWAPGPEDEVTAEVHAA* |
Ga0062590_1026846512 | 3300004157 | Soil | MKKTSGAKHEEPVGIVISGGHQRSEAAPRFSAYIWAPGPEDESTEDVQAA* |
Ga0062592_1010656411 | 3300004480 | Soil | MKKSTDTTREEPVGIVISGGHPSSEAATRFSAYIWAPAPEEESTEEVQAA* |
Ga0062591_1002008353 | 3300004643 | Soil | MKYSSTNVAKDEPVGIIISGGRSRAESAPRFSAYIWAPGPEEESVEDARAI* |
Ga0062591_1012382952 | 3300004643 | Soil | MKKNSSTTHDEPVGIVISGGHPLSETAPRFSAYIWAPGPEDERTEGAQAA* |
Ga0062594_1008368051 | 3300005093 | Soil | MKKNTGTTHNEPVGIVISGGHPLSEAAPRFSAYIWAPGPEEERTQEAHAA* |
Ga0066676_107068291 | 3300005186 | Soil | MKKTASATHDEPVGIVISGGHPLSEAAPRFSAYIWAPGPEDERTEGVHAA* |
Ga0065712_100254072 | 3300005290 | Miscanthus Rhizosphere | MKQSTDTTRDEPVGIVISGGHPSSEAATRFSAYIWAPAPEEESTEEVQAA* |
Ga0070658_106819711 | 3300005327 | Corn Rhizosphere | MKQSTDSTRDEPVGIVISGGHASSEAATRFSAYVWAPGPEDESTEEVQAA* |
Ga0070676_100296943 | 3300005328 | Miscanthus Rhizosphere | MKKNTRTTHDEPVGIVISGGHSLIEATPRFSAYIWAPGPEDERTEGAHAA* |
Ga0070676_110666972 | 3300005328 | Miscanthus Rhizosphere | MKKTSGAKQDEPVGIVISGGHQRSEAAPRFSAYIWAPGPEDESTEDVQAA* |
Ga0070683_1000974362 | 3300005329 | Corn Rhizosphere | MKQSTDTTRDEPVGIVISGGHPSSEAATRFLAYVWAPGPEDESTEEVQAA* |
Ga0070683_1003473341 | 3300005329 | Corn Rhizosphere | MKKNTGTTHDEPVGIVISGGHPLSEAAPRFSAYIWAPGPEDERTEGAHAA* |
Ga0070670_1008305601 | 3300005331 | Switchgrass Rhizosphere | MKQTSYVEVEEPVGIVILGGPVPDTTPRFSAYMWAPGPEDEVIEEVQAA* |
Ga0070682_1002175721 | 3300005337 | Corn Rhizosphere | MKKNTGTTHDEPVGIVISGGHTLSEAAPRFSAYIWAPGPEEERKQEAHAA* |
Ga0068868_1005708041 | 3300005338 | Miscanthus Rhizosphere | MKKNTGTTHDEPVGIVISGGHSLIEATPRFSAYIWAPGPEDERTEGAHAA* |
Ga0068868_1019277731 | 3300005338 | Miscanthus Rhizosphere | SSTTHDEPVGIVISGGHPLSETAPRFSAYIWAPGPEDERTEGAQAA* |
Ga0070660_1015629261 | 3300005339 | Corn Rhizosphere | NTGTTHDEPVGIVISGGHPLSEAAPRFSAYIWSPGPEDARTEGAHAA* |
Ga0070661_1011841911 | 3300005344 | Corn Rhizosphere | HMKKNTGTTHNEPVGIVISGGHTLSEAAPRFSAYIWAPGPEEERKQEAHAA* |
Ga0070661_1017026172 | 3300005344 | Corn Rhizosphere | MKKNTGTTHDEPVGIVISGGHSLIEATPRFSAYIWAPGPEDERTEGVHAA* |
Ga0070669_1012114382 | 3300005353 | Switchgrass Rhizosphere | FRRHHHFSEFHMKKTSFIEVEEPVGIVISGGPVPDTTPRFSAYMWAPGPEDDVLDEVQAA |
Ga0070675_1003571292 | 3300005354 | Miscanthus Rhizosphere | MKKNTGTTHDEPVGIVISGGHSLIEATPRFSAYIWAPGPEDERTEGTHAA* |
Ga0070671_1000913232 | 3300005355 | Switchgrass Rhizosphere | MKKNTGTTHDEPVGIVISGGHPLIEATPRFSAYIWAPGPEDERTEGAHTA* |
Ga0070673_1018854161 | 3300005364 | Switchgrass Rhizosphere | MKHSTETTLDEPVGIVISGGRSSSEIAPRFSAYIWAPAPEEESEAEVQAA*STEV |
Ga0070709_107997742 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | HDEPVGIVISGGHALSEATPRFSAYIWAPGPEDERTEGAHAA* |
Ga0070713_1024043421 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | PFRGHSALPCYHMKKTTGTTHDEPVGIVISGGHPLTEATPRFSAYIWAPGPEDERTEGAHAA* |
Ga0070678_1010235542 | 3300005456 | Miscanthus Rhizosphere | MKKNTGTTHDEPVGIVISGGHSLIEATPRFSAYIWAPGPEDERTE |
Ga0070662_1012415222 | 3300005457 | Corn Rhizosphere | MMKKSTVTSLDEPVGIVISGGRSSSEAAPRFSAYIWAPAPEEESSDEVQAA* |
Ga0070662_1017733881 | 3300005457 | Corn Rhizosphere | MKKTSGPTHDEPVGIVISGGHPHSEPAPRFSAYIWAPGPEDETTEEVQAA* |
Ga0070681_100888871 | 3300005458 | Corn Rhizosphere | THDEPVGIVISGGHTLSEAAPRFSAYIWAPGPEEERTQEAHVV* |
Ga0068853_1014650922 | 3300005539 | Corn Rhizosphere | MKKNTGTTHNEPVGIVISGGHTLSEAAPRFSAYIWAPGPEEERTQEAHVV* |
Ga0070672_1000588412 | 3300005543 | Miscanthus Rhizosphere | MKKTSFIEVEEPVGIVISGGPVPDTTPRFSAYMWAPGPEDDVLDEVQAA* |
Ga0070672_1005187971 | 3300005543 | Miscanthus Rhizosphere | GAKQDEPVGIVISGGHQRSEAAPRFSAYIWAPGPEDESTEDVQAA* |
Ga0070693_1002217512 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKNTGTTHNEPVGIVISGGHSLSEAAPRFSAYIWAPGPEEERTQEAHAA* |
Ga0070693_1006008172 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKSTDATLNEPVGIVISGGHASSEAAPRFSAYIWAPAPSEEVTDEVQAA* |
Ga0070664_1000118326 | 3300005564 | Corn Rhizosphere | MHTSMKKSTDATLNEPVGIVISGGHASSEAAPRFSAYIWAPAPGEEVSEEVQAA* |
Ga0070664_1021915842 | 3300005564 | Corn Rhizosphere | TSYVEVEEPVGIVISGGPVPDTTPRFSAYMWAPGPEDEVIEEVQAA* |
Ga0068851_105585411 | 3300005834 | Corn Rhizosphere | MKQTWYVEVEEPVGIVISGGPVPDTTPRFSAYVWAPGPEDDVIEEVQAA* |
Ga0068863_1011997421 | 3300005841 | Switchgrass Rhizosphere | HYMKQSTDTTRDEPVGIVISGGHPSSEAATRFSAYIWAPAPEEESTEEVQAA* |
Ga0066652_1000060445 | 3300006046 | Soil | MKQSTDATLDEPVGIVISGGRSPVEAAPRFSAYIWAPAPDEETVEEVQAA* |
Ga0079220_102594272 | 3300006806 | Agricultural Soil | MKKNTGTTHNEPVGIVISGGHSLSEAAPRFSAYIWAPGPEEERTQESHAA* |
Ga0079216_110006152 | 3300006918 | Agricultural Soil | MKQTSHAQADEPVGIVISGGHSPQIEPRFTAYMWAPGPEDEVTEEVQAA* |
Ga0111539_104358732 | 3300009094 | Populus Rhizosphere | MKKSTDTTRDEPVGIVISGGHPSSEAATRFSAYIWAPAPEEESTGEVQAA* |
Ga0105245_114950582 | 3300009098 | Miscanthus Rhizosphere | MKQSTDTTRDEPVGIVISGGHPSSEAATRFSAYIWAPAPEEESTEK |
Ga0111538_101538673 | 3300009156 | Populus Rhizosphere | MKKSTDTARDEPVGIVISGGHPSSEAATRFSAYIWAPAPEAESTEEVQAA* |
Ga0111538_128042842 | 3300009156 | Populus Rhizosphere | MMKKGTVTSLDEPVGIVISGGRSSSEAAPRFLAYIWAPGPEEESSDEVQAA* |
Ga0105241_125595542 | 3300009174 | Corn Rhizosphere | MKKNTGTTHDEPVGIVISGGHPLSEAAPRFSAYIWAPGPEEERTQEAHAA* |
Ga0105248_112855461 | 3300009177 | Switchgrass Rhizosphere | MKKNTRTTHDEPVGIVISGGHSLIEATPRFSAYIWAPGPEDERTEGTHAA* |
Ga0126307_100322174 | 3300009789 | Serpentine Soil | MKHSSDTSQEEPMGIVISGGHALAEPAPRFLAYIWAPAPEEEITEEVQAV* |
Ga0126307_101430512 | 3300009789 | Serpentine Soil | MMKKSTVTSLDEPVGIVISGGRSSSEAAPRFLAYIWAPAPEEESSDEVQAA* |
Ga0126307_102077972 | 3300009789 | Serpentine Soil | MKYSSDTSSDEPVGIVISGGHSVAEPATRFSAYIWAPAPDEEIAEEVQAA* |
Ga0126313_100108792 | 3300009840 | Serpentine Soil | MKHSSDTSQEEPMGIVISGGHSLAEPAPRFSAYIWAPAPEEEITEEVQAA* |
Ga0126313_101387722 | 3300009840 | Serpentine Soil | MKKSPDATLDEPVGIVISGGHSSAEAAPRFSAYIWAPAPEEESTEEVQAA* |
Ga0126313_102021862 | 3300009840 | Serpentine Soil | MMKHSTDTTSDEPVGIVISGGRTSSEVAPRFSAYIWAPAPEEESEAEVQAA* |
Ga0126305_106753392 | 3300010036 | Serpentine Soil | MMKHSTDTTLDEPVGIVISGGRTSSEVAPRFSAYIWAPAPEEESEAEVQAA* |
Ga0126304_108863982 | 3300010037 | Serpentine Soil | MIKKSTDTTLDEPVGIVISGGRSSSEAETRFSAYIWAPAPEEESSEEVQAA* |
Ga0126310_103446792 | 3300010044 | Serpentine Soil | MKHSSDTSQEEPMGIVISGGHSLAEPAPRFSAYIWAPAPDEEITEEVQAA* |
Ga0126311_106516011 | 3300010045 | Serpentine Soil | SQDEPVGIVISGGQVPMESAPRFSAFIWAPAPDEDIAGDVRAA* |
Ga0126311_108600462 | 3300010045 | Serpentine Soil | MKHSSDTSQDEPVGIVISGGHSLAESTPRFSAYIWAPAPDEEISEEVQAA* |
Ga0126306_101751751 | 3300010166 | Serpentine Soil | PFRGRTLSAFHMKHSSDTSQEEPMGIVISGGHALAEPAPRFLAYIWAPAPEEEITEEVQAV* |
Ga0126306_108804361 | 3300010166 | Serpentine Soil | MKQTSDTSQDEPVGIVISGGHPLSQAAPRFSAYIWAPAPEDEITEEVQAA* |
Ga0134124_111875251 | 3300010397 | Terrestrial Soil | MKKNTGTTYDEPVGIVISGGHPLSEAAPRFSAYIWAPGPEDERTEGAHAA* |
Ga0134122_131169652 | 3300010400 | Terrestrial Soil | MKKNSRTAHDEPVGIVISGGHPHSEAAPRFSAYIWAPGPEDEKAEGAAAA* |
Ga0134121_117501202 | 3300010401 | Terrestrial Soil | VGIVISGGHPHSEAAPRFSAYIWAPGPEDETTEEVQAA* |
Ga0150985_1025642731 | 3300012212 | Avena Fatua Rhizosphere | PFRGHSAFSGIHMKKNTGTTHDEPVGIVISGGHPLSEAAPRFSAYIWAPGPEDERTEGAQAA* |
Ga0150985_1171293112 | 3300012212 | Avena Fatua Rhizosphere | MKQAPHTKQDEPVGIVIFGGHAPEIAPRFSAYVWAPGPDDESSEDVQAG* |
Ga0150985_1185286401 | 3300012212 | Avena Fatua Rhizosphere | PFRGRPAFHRYHMKKKSASKHDEPVGIVISGGHPHSEAAPRFSAYIWAPGPEDESTEEVQAA* |
Ga0150985_1204872531 | 3300012212 | Avena Fatua Rhizosphere | PFRGHPAFKCYHMKKNSGVTHDEPVGIVISGGRPLSEAAPRFSAYIWAPGPEDERTEGAHAA* |
Ga0150984_1027941241 | 3300012469 | Avena Fatua Rhizosphere | MKKNSVATHDEPVGIVISGGHPLSEAAPRFSAYIWAPGPEDERTEGAHAA* |
Ga0150984_1045245881 | 3300012469 | Avena Fatua Rhizosphere | FRGHSAFSGIHMKKNTGTTHDEPVGIVISGGHPLSEAAPRFSAYIWAPGPEDERTEGAQAA* |
Ga0150984_1174840392 | 3300012469 | Avena Fatua Rhizosphere | MKQTSHIEVDEPVGIVISGGPVPETAPRFSAYMWAPGPEDDVIDEVQAA* |
Ga0157296_100475432 | 3300012905 | Soil | MMKKSTVTSLDEPVGIVISGGRSSSEAAPRFLAYIWAPGPEEESSDEVQAA* |
Ga0164298_100193493 | 3300012955 | Soil | MKKNTGTTHDEPVGIVISGGHPLSEATPRFSAYIWAPGPEDERTEGAHAA* |
Ga0164298_116522091 | 3300012955 | Soil | MKKNRGTTHDEPVGIVISGGHALSEAAPRFSAYIWAPGPEEERTQEEHAA* |
Ga0164303_100560523 | 3300012957 | Soil | MKKNTGTTHDEPVGIVISGGHPLSKATPRFSAYIWAPGPEDERTEGAHAA* |
Ga0164307_114357071 | 3300012987 | Soil | MKKNTGTTHDEPVGIVISGGHALSEAAPRFSAYIWAPGPEEERTQEEHAA* |
Ga0157373_113654871 | 3300013100 | Corn Rhizosphere | MKQSTEMPLREPVGIVISGGHSASEAAPRFSAYVWAPAPDEEAPKEVHAA* |
Ga0157371_114570822 | 3300013102 | Corn Rhizosphere | CYHMKKNTGTTHDEPVGIVISGGHPLSEAAPRFSAYIWAPGPEDERTEGAHTA* |
Ga0157370_116654932 | 3300013104 | Corn Rhizosphere | MKQTSFVEVEEPVGIVISGGPVPDTTPRFSAYVWAPGPEDDVIEEVQAA* |
Ga0157375_119802102 | 3300013308 | Miscanthus Rhizosphere | MKKNTGTTHDEPVGIVISGGHSLVEATPRFSAYIWAPGPEDERTEGAHAA* |
Ga0163163_112663941 | 3300014325 | Switchgrass Rhizosphere | MKQTSYVQVEEPVGIVISGGPIPDTTPRFSAYVWAPGPEDDVIEEVQAA* |
Ga0157380_125958112 | 3300014326 | Switchgrass Rhizosphere | MMKKSTVASLDEPVGIVISGGRSSSEAAPRFLAYIWAPGPEEESGDEVQAA* |
Ga0157376_113933301 | 3300014969 | Miscanthus Rhizosphere | MKKNTGTTHDEPVGIVISGGHPLSEAAPRFSAYIWAPGPEDERTEGTHAA* |
Ga0132258_116034673 | 3300015371 | Arabidopsis Rhizosphere | MKKNIGTTHDEPVGIVISGGHPLSEAAPRFSAYIWAPGPDDERTEGVQAA* |
Ga0132258_120694512 | 3300015371 | Arabidopsis Rhizosphere | MKKTSYIEVEEPVGIVISGGPIPETTPRFSAYMWAPGPEDDDLDEVQAA* |
Ga0132256_1009785972 | 3300015372 | Arabidopsis Rhizosphere | MKKNTGTTHDEPVGIVISGGHPLSEAAPRFSAYIWAPGPEDERTE |
Ga0132255_1014930321 | 3300015374 | Arabidopsis Rhizosphere | MKKNTGTTHDEPVGIVISGGHPLSEAAPRFSAYIWAPGPDDERTEGVQAA* |
Ga0163161_101562712 | 3300017792 | Switchgrass Rhizosphere | MKKNTRTTHDEPVGIVISGGHSLIEATPRFSAYSWAPRPEDERTEGAHAA |
Ga0184604_103795591 | 3300018000 | Groundwater Sediment | PSQPFIMKHSSDTSRDEPVGIVISGGHSLAESTPRFSAYIWAPAPDEEISEEVQAA |
Ga0190273_103241822 | 3300018920 | Soil | MKQTSYAQLDEPVGIVISGGHSPEIPPRFSAYMWAPGPEDEVIEEVQAA |
Ga0173481_104620602 | 3300019356 | Soil | MKKSTDTTREEPVGIVISGGHPSSEAATRFSAYIWAPAPEEESTEEVQAA |
Ga0173482_104317571 | 3300019361 | Soil | GTTHDEPVGIVISGGHTLSEAAPRFSAYIWAPGPEEERKQEAHAA |
Ga0182009_100162473 | 3300021445 | Soil | MKKNQTIMHDEPVGIVISGGHPLSETAPRFSAYIWAPGPEDERTRDVHAA |
Ga0222622_100185343 | 3300022756 | Groundwater Sediment | MKQSTDTTRDEPVGIVISGGHPSSEAATRFLAYVWAPGPEDESTEEVQAA |
Ga0222622_101696692 | 3300022756 | Groundwater Sediment | MKKNSGPKHDEPVGIVISGGHPHSEAAPRFSAYIWAPGPEDESTEEVQAA |
Ga0207656_105079021 | 3300025321 | Corn Rhizosphere | MKKNSSTTHDEPVGIVISGGHPLSETAPRFSAYIWAPGPEDE |
Ga0207688_101502012 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MMKKSTVASLDEPVGIVISGGHQRSEAAPRFSAYIWAPGPEDESTEDVQAA |
Ga0207688_103489161 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | HYMKQSTDTTRDEPVGIVISGGHPSSEAATRFSAYIWAPAPEEESTEEVQAA |
Ga0207688_109497381 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKNTGTTHNEPVGIVISGGHPLSEAAPRFSAYIWAPGPEEERTQEAHAA |
Ga0207647_101421222 | 3300025904 | Corn Rhizosphere | MKKNTGTTYDEPVGIVISGGHPLSEAAPRFSAYIWAPGPEDERTEGAHAA |
Ga0207645_100172244 | 3300025907 | Miscanthus Rhizosphere | MKKNTRTTHDEPVGIVISGGHSLIEATPRFSAYIWAPGPEDERTEGAHAA |
Ga0207645_102307663 | 3300025907 | Miscanthus Rhizosphere | MKKTSGAKQDEPVGIVISGGHQRSEAAPRFSAYIWAPGPEDESTEDVQAA |
Ga0207645_111551201 | 3300025907 | Miscanthus Rhizosphere | IVISGGHPSSEAATRFSAYIWAPAPEEESTEEVQAA |
Ga0207707_109694322 | 3300025912 | Corn Rhizosphere | MKKNTGTTHNEPVGIVISGGHTLSEAAPRFSAYIWAPGPEEERTQEAHVV |
Ga0207659_105237982 | 3300025926 | Miscanthus Rhizosphere | MKKNTGTTHDEPVGIVISGGHSLVEATPRFSAYIWAPGPEDERTEGAHAA |
Ga0207644_100232892 | 3300025931 | Switchgrass Rhizosphere | MKQSTDTTRDEPVGIVISGGHPSSEAATRFSAYIWAPAPEEESTEEVQAA |
Ga0207644_100247982 | 3300025931 | Switchgrass Rhizosphere | MKKNTGTTHDEPVGIVISGGHPLIEATPRFSAYIWAPGPEDERTEGARTA |
Ga0207644_110220611 | 3300025931 | Switchgrass Rhizosphere | GHSAFRGIHMKKNSGTTHDEPVGIVISGGHPLSETAPRFSAYIWAPGPEDERTGGAQAA |
Ga0207691_100923732 | 3300025940 | Miscanthus Rhizosphere | MKKNTGTTHDEPVGIVISGGHSLIEATPRFSAYIWAPGPEDERTEGAHAA |
Ga0207691_103367861 | 3300025940 | Miscanthus Rhizosphere | MKKTSFIEVEEPVGIVISGGPVPDTTPRFSAYMWAPGPEDDVLDEVQAA |
Ga0207691_116688181 | 3300025940 | Miscanthus Rhizosphere | TSGAKQDEPVGIVISGGHQRSEAAPRFSAYIWAPGPEDESTEDVQAA |
Ga0207711_101995182 | 3300025941 | Switchgrass Rhizosphere | MKKNTGTTHDEPVGIVISGGHSLIEATPRFSAYIWAPGPEDERTEGTHAA |
Ga0207689_104378732 | 3300025942 | Miscanthus Rhizosphere | MMKKSTVASLDEPVGIVISGGRSSSEAAPRFLAYIWAPGPEEESGDEVQAA |
Ga0207679_100066403 | 3300025945 | Corn Rhizosphere | MHTSMKKSTDATLNEPVGIVISGGHASSEAAPRFSAYIWAPAPGEEVSEEVQAA |
Ga0207677_120136252 | 3300026023 | Miscanthus Rhizosphere | STDSTRDEPVGIVISGGHASSEAATRFSAYVWAPGPEDESTEEVQAA |
Ga0207698_107303602 | 3300026142 | Corn Rhizosphere | MKKNTGTTHDEPVGIVISGGHSLIEATPRFSAYIWAPGPEDERMEGTHAA |
Ga0268264_100605922 | 3300028381 | Switchgrass Rhizosphere | MKKNTGTTHDEPVGIVISGGHPLSEAAPRFSAYIWAPGPEDERTEGAHAA |
Ga0307408_1006403802 | 3300031548 | Rhizosphere | MKHSSDFSHDEPVGIVISGGQSGTDAVPRFSAYIWAPAPEEESTEEAQAA |
Ga0307413_106171282 | 3300031824 | Rhizosphere | MKQTSHAQADEPVGIVISGGHTPESTPRFSAYMWAPGPEDEVLEEIQAA |
Ga0307410_105789792 | 3300031852 | Rhizosphere | MKHSSDFSYDEPVGIVISGGQTGGEAVPRFSAYIWAPAPEDESTEEAQAA |
Ga0307406_114288952 | 3300031901 | Rhizosphere | MKSRSDASHEEPMGIVISGGHALVEPAPRFSAYIWAPAPEEESTEEIVAA |
Ga0307412_123053161 | 3300031911 | Rhizosphere | MKHSSDFSYDEPVGIVISGGQTGGETVPRFSAYIWAPAPEDESTEEAQAA |
Ga0308175_1000304236 | 3300031938 | Soil | MKKSTTNTHDEPVGIVISGGHPLSEAAPRFSAYIWAPGPEDERTQEVHAA |
Ga0308175_1001409932 | 3300031938 | Soil | MKKTTGTTHDEPVGIVISGGHPLIEATPRFSAYIWAPGPEDERTEGAHAA |
Ga0308175_1008347802 | 3300031938 | Soil | MKKSTDATLNEPVGIVISGGHASSEATPRFSAYIWAPAPGEEVTEEVQAA |
Ga0308175_1014842022 | 3300031938 | Soil | MKQNTDATLDEPVGIVISGGRSSSEAEPRFSAYIWAPAPEEESAEEVQAA |
Ga0308175_1017483241 | 3300031938 | Soil | RGHSALPCYHMKKNTGTTHDEPVGIVISGGHSLIEATPRFSAYIWAPGPEDERTEGAHAA |
Ga0308174_103503672 | 3300031939 | Soil | MKQAPLTQHDEPVGIVIFGGHAPEIAPRFSAYVWAPGPDDESSEDVQAA |
Ga0308174_117658132 | 3300031939 | Soil | RTFTMKQHTDATLDEPVGIVISGGRSASEAEPRFSAYIWAPAPEEESAEEVQAV |
Ga0308176_102410513 | 3300031996 | Soil | FRSYHMKKSTTNTHDEPVGIVISGGHPLSEAAPRFSAYIWAPGPEDERTQEVHAA |
Ga0307416_1002519822 | 3300032002 | Rhizosphere | MKNRSDASHEEPMGIVISGGHALVEQAPRFSAYIWAPAPEEESTGEAVAA |
Ga0307411_100736801 | 3300032005 | Rhizosphere | PGTNFLLRLSIMKHSSDFSHDEPVGIVISGGQSGTDAVPRFSAYIWAPAPEEESTEEAQA |
Ga0308173_100225724 | 3300032074 | Soil | MKQHTDATLDEPVGIVISGGRSASEAEPRFSAYIWAPAPEEESAEEVQAV |
Ga0308173_101764242 | 3300032074 | Soil | MKQNTDATLDEPVGIVISGGRWSSEAEPRFSAYIWAPAPEEESAEEVQAA |
⦗Top⦘ |