NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F055109

Metagenome / Metatranscriptome Family F055109

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F055109
Family Type Metagenome / Metatranscriptome
Number of Sequences 139
Average Sequence Length 41 residues
Representative Sequence IPFFGGLIDGYSTKVKGLKPSKGTLNLDSFGHGYRTIWFG
Number of Associated Samples 122
Number of Associated Scaffolds 139

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 99.28 %
% of genes from short scaffolds (< 2000 bps) 94.24 %
Associated GOLD sequencing projects 116
AlphaFold2 3D model prediction Yes
3D model pTM-score0.26

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (84.173 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(13.669 % of family members)
Environment Ontology (ENVO) Unclassified
(20.863 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(41.007 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 5.88%    β-sheet: 0.00%    Coil/Unstructured: 94.12%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.26
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 139 Family Scaffolds
PF00528BPD_transp_1 33.81
PF12911OppC_N 2.16
PF00005ABC_tran 1.44
PF00106adh_short 0.72


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms84.17 %
UnclassifiedrootN/A15.83 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459015|G14TP7Y02GJ250All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → unclassified Propionibacteriales → Propionibacteriales bacterium568Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_101162790Not Available661Open in IMG/M
3300005093|Ga0062594_101540856All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria684Open in IMG/M
3300005093|Ga0062594_103074195All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium522Open in IMG/M
3300005180|Ga0066685_10380279Not Available981Open in IMG/M
3300005187|Ga0066675_10655257All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria789Open in IMG/M
3300005332|Ga0066388_102928548All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria872Open in IMG/M
3300005332|Ga0066388_105712319All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria629Open in IMG/M
3300005332|Ga0066388_107786230All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria536Open in IMG/M
3300005332|Ga0066388_108443813All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria513Open in IMG/M
3300005337|Ga0070682_100522451All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria924Open in IMG/M
3300005338|Ga0068868_101728141All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria590Open in IMG/M
3300005435|Ga0070714_101054122All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria792Open in IMG/M
3300005435|Ga0070714_102133412All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300005436|Ga0070713_101958013All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria568Open in IMG/M
3300005439|Ga0070711_100598424All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria920Open in IMG/M
3300005447|Ga0066689_10558950All Organisms → cellular organisms → Bacteria723Open in IMG/M
3300005466|Ga0070685_10407632All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria943Open in IMG/M
3300005467|Ga0070706_102058172All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria517Open in IMG/M
3300005518|Ga0070699_100095929All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae2597Open in IMG/M
3300005540|Ga0066697_10428411All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria765Open in IMG/M
3300005543|Ga0070672_100903453All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae780Open in IMG/M
3300005554|Ga0066661_10708098Not Available591Open in IMG/M
3300005614|Ga0068856_100497768All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1240Open in IMG/M
3300005617|Ga0068859_101288052All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria805Open in IMG/M
3300005618|Ga0068864_102005165All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae585Open in IMG/M
3300005713|Ga0066905_101928634All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → unclassified Propionibacteriales → Propionibacteriales bacterium547Open in IMG/M
3300005719|Ga0068861_101133686All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria753Open in IMG/M
3300005764|Ga0066903_107477080All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria564Open in IMG/M
3300005764|Ga0066903_108103029All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria538Open in IMG/M
3300005893|Ga0075278_1074287All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria536Open in IMG/M
3300006028|Ga0070717_11293025All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium663Open in IMG/M
3300006046|Ga0066652_101406023All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria653Open in IMG/M
3300006057|Ga0075026_100149089All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1199Open in IMG/M
3300006173|Ga0070716_101338577All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium580Open in IMG/M
3300006175|Ga0070712_100362188All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae1189Open in IMG/M
3300006237|Ga0097621_102299429All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria516Open in IMG/M
3300006800|Ga0066660_10942167All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria699Open in IMG/M
3300006953|Ga0074063_14103064All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1793Open in IMG/M
3300007076|Ga0075435_100732681All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria860Open in IMG/M
3300009011|Ga0105251_10597674All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium523Open in IMG/M
3300009098|Ga0105245_12807936All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → unclassified Propionibacteriales → Propionibacteriales bacterium540Open in IMG/M
3300010154|Ga0127503_11295789Not Available938Open in IMG/M
3300010301|Ga0134070_10082937All Organisms → cellular organisms → Bacteria → Terrabacteria group1104Open in IMG/M
3300010359|Ga0126376_10878312All Organisms → cellular organisms → Bacteria → Terrabacteria group884Open in IMG/M
3300010359|Ga0126376_10905844Not Available872Open in IMG/M
3300010361|Ga0126378_12779444All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → unclassified Propionibacteriales → Propionibacteriales bacterium559Open in IMG/M
3300010376|Ga0126381_101309811All Organisms → cellular organisms → Bacteria1047Open in IMG/M
3300010376|Ga0126381_104059381All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → unclassified Propionibacteriales → Propionibacteriales bacterium569Open in IMG/M
3300010376|Ga0126381_104073866All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → unclassified Propionibacteriales → Propionibacteriales bacterium568Open in IMG/M
3300010376|Ga0126381_104364839All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → unclassified Propionibacteriales → Propionibacteriales bacterium547Open in IMG/M
3300010376|Ga0126381_104589007All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300010398|Ga0126383_13603762Not Available506Open in IMG/M
3300010880|Ga0126350_11623843All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium708Open in IMG/M
3300011269|Ga0137392_10653072All Organisms → cellular organisms → Bacteria → Terrabacteria group872Open in IMG/M
3300012188|Ga0136618_10401172All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → unclassified Propionibacteriales → Propionibacteriales bacterium591Open in IMG/M
3300012199|Ga0137383_10508812Not Available882Open in IMG/M
3300012201|Ga0137365_11015464All Organisms → cellular organisms → Bacteria → Terrabacteria group601Open in IMG/M
3300012211|Ga0137377_11463953All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → unclassified Propionibacteriales → Propionibacteriales bacterium610Open in IMG/M
3300012351|Ga0137386_10388213All Organisms → cellular organisms → Bacteria → Terrabacteria group1005Open in IMG/M
3300012359|Ga0137385_10197438All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1757Open in IMG/M
3300012360|Ga0137375_11240191All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → unclassified Propionibacteriales → Propionibacteriales bacterium568Open in IMG/M
3300012362|Ga0137361_11532410All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → unclassified Propionibacteriales → Propionibacteriales bacterium588Open in IMG/M
3300012363|Ga0137390_11265765All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium684Open in IMG/M
3300012582|Ga0137358_10967188All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → unclassified Propionibacteriales → Propionibacteriales bacterium553Open in IMG/M
3300012955|Ga0164298_10064468All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1817Open in IMG/M
3300012955|Ga0164298_10237633All Organisms → cellular organisms → Bacteria1090Open in IMG/M
3300012971|Ga0126369_10762517All Organisms → cellular organisms → Bacteria → Terrabacteria group1048Open in IMG/M
3300012971|Ga0126369_12991080All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → unclassified Propionibacteriales → Propionibacteriales bacterium553Open in IMG/M
3300012987|Ga0164307_10907161All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium710Open in IMG/M
3300012988|Ga0164306_11098312Not Available661Open in IMG/M
3300012989|Ga0164305_11754540Not Available559Open in IMG/M
3300013296|Ga0157374_11824185All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → unclassified Propionibacteriales → Propionibacteriales bacterium634Open in IMG/M
3300014157|Ga0134078_10210608All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium797Open in IMG/M
3300014745|Ga0157377_10427537Not Available909Open in IMG/M
3300017955|Ga0187817_11106404All Organisms → cellular organisms → Bacteria → Terrabacteria group508Open in IMG/M
3300018081|Ga0184625_10602568All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → unclassified Propionibacteriales → Propionibacteriales bacterium538Open in IMG/M
3300018089|Ga0187774_10376932All Organisms → cellular organisms → Bacteria → Terrabacteria group855Open in IMG/M
3300018429|Ga0190272_10935465All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium818Open in IMG/M
3300020006|Ga0193735_1160643All Organisms → cellular organisms → Bacteria → Terrabacteria group573Open in IMG/M
3300020581|Ga0210399_11460445All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium532Open in IMG/M
3300021073|Ga0210378_10062208All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1467Open in IMG/M
3300021478|Ga0210402_10954595All Organisms → cellular organisms → Bacteria → Terrabacteria group784Open in IMG/M
3300021560|Ga0126371_12682108Not Available604Open in IMG/M
3300021560|Ga0126371_13675813All Organisms → cellular organisms → Bacteria → Terrabacteria group517Open in IMG/M
3300022756|Ga0222622_10542337All Organisms → cellular organisms → Bacteria → Terrabacteria group835Open in IMG/M
3300025315|Ga0207697_10462618Not Available562Open in IMG/M
3300025473|Ga0208190_1120049Not Available507Open in IMG/M
3300025904|Ga0207647_10773366Not Available518Open in IMG/M
3300025906|Ga0207699_10168598All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae1463Open in IMG/M
3300025915|Ga0207693_10745554Not Available757Open in IMG/M
3300025918|Ga0207662_10723560All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium698Open in IMG/M
3300025921|Ga0207652_10567362All Organisms → cellular organisms → Bacteria1019Open in IMG/M
3300025922|Ga0207646_10123885All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium2323Open in IMG/M
3300025927|Ga0207687_10409578All Organisms → cellular organisms → Bacteria → Terrabacteria group1117Open in IMG/M
3300025928|Ga0207700_10054824All Organisms → cellular organisms → Bacteria2994Open in IMG/M
3300025928|Ga0207700_11841169Not Available531Open in IMG/M
3300025945|Ga0207679_11512991All Organisms → cellular organisms → Bacteria → Terrabacteria group615Open in IMG/M
3300026078|Ga0207702_12438340All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → unclassified Propionibacteriales → Propionibacteriales bacterium510Open in IMG/M
3300026498|Ga0257156_1051224All Organisms → cellular organisms → Bacteria → Terrabacteria group849Open in IMG/M
3300026540|Ga0209376_1293359All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium649Open in IMG/M
3300026547|Ga0209156_10223135All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium889Open in IMG/M
3300027775|Ga0209177_10018963All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1674Open in IMG/M
3300027857|Ga0209166_10045568All Organisms → cellular organisms → Bacteria2587Open in IMG/M
3300028563|Ga0265319_1124527Not Available802Open in IMG/M
3300028563|Ga0265319_1180142Not Available651Open in IMG/M
3300028712|Ga0307285_10115365All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → unclassified Propionibacteriales → Propionibacteriales bacterium718Open in IMG/M
3300028800|Ga0265338_10752736All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium670Open in IMG/M
3300028828|Ga0307312_10826542All Organisms → cellular organisms → Bacteria → Terrabacteria group614Open in IMG/M
3300028884|Ga0307308_10262931All Organisms → cellular organisms → Bacteria827Open in IMG/M
3300031448|Ga0272438_1248823All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium705Open in IMG/M
3300031450|Ga0272433_10414738All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → unclassified Propionibacteriales → Propionibacteriales bacterium588Open in IMG/M
3300031640|Ga0318555_10322685All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium836Open in IMG/M
3300031719|Ga0306917_11009669All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → unclassified Propionibacteriales → Propionibacteriales bacterium649Open in IMG/M
3300031720|Ga0307469_11201212All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium717Open in IMG/M
3300031723|Ga0318493_10042526Not Available2118Open in IMG/M
3300031726|Ga0302321_102514333All Organisms → cellular organisms → Bacteria601Open in IMG/M
3300031744|Ga0306918_10069579All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2410Open in IMG/M
3300031748|Ga0318492_10620708All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → unclassified Propionibacteriales → Propionibacteriales bacterium577Open in IMG/M
3300031751|Ga0318494_10314128All Organisms → cellular organisms → Bacteria → Terrabacteria group905Open in IMG/M
3300031751|Ga0318494_10568097Not Available662Open in IMG/M
3300031763|Ga0318537_10123577All Organisms → cellular organisms → Bacteria → Terrabacteria group962Open in IMG/M
3300031765|Ga0318554_10457310All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium723Open in IMG/M
3300031897|Ga0318520_10877813All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → unclassified Propionibacteriales → Propionibacteriales bacterium564Open in IMG/M
3300031941|Ga0310912_11089930All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → unclassified Propionibacteriales → Propionibacteriales bacterium610Open in IMG/M
3300031954|Ga0306926_12215772Not Available611Open in IMG/M
3300032008|Ga0318562_10855388All Organisms → cellular organisms → Bacteria → Terrabacteria group520Open in IMG/M
3300032041|Ga0318549_10435346All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → unclassified Propionibacteriales → Propionibacteriales bacterium591Open in IMG/M
3300032042|Ga0318545_10101532All Organisms → cellular organisms → Bacteria1008Open in IMG/M
3300032063|Ga0318504_10255893All Organisms → cellular organisms → Bacteria → Terrabacteria group825Open in IMG/M
3300032064|Ga0318510_10137555All Organisms → cellular organisms → Bacteria → Terrabacteria group956Open in IMG/M
3300032065|Ga0318513_10106961All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1313Open in IMG/M
3300032090|Ga0318518_10047083All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2038Open in IMG/M
3300032180|Ga0307471_102625638All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → unclassified Propionibacteriales → Propionibacteriales bacterium638Open in IMG/M
3300033475|Ga0310811_10354345All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1643Open in IMG/M
3300033502|Ga0326731_1087612All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium718Open in IMG/M
3300033550|Ga0247829_10749012All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → unclassified Propionibacteriales → Propionibacteriales bacterium813Open in IMG/M
3300033758|Ga0314868_016742All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium769Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil13.67%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil9.35%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere8.63%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil7.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil7.91%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil7.19%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil5.04%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.16%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.16%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.16%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere2.16%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.44%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.44%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.44%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.44%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.44%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil1.44%
RockEnvironmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock1.44%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.44%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.44%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.72%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.72%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.72%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.72%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand0.72%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.72%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.72%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.72%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.72%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.72%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.72%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.72%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.72%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.72%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.72%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.72%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.72%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.72%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.72%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.72%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.72%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.72%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.72%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.72%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter0.72%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.72%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459015Litter degradation PV4EngineeredOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005180Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005447Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138EnvironmentalOpen in IMG/M
3300005466Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005893Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_202EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006057Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006953Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009011Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaGHost-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300010154Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010880Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300012188Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ330 (21.06)EnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300014157Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300018089Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300020006Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2EnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redoEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300025315Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)Host-AssociatedOpen in IMG/M
3300025473Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025904Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026498Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-AEnvironmentalOpen in IMG/M
3300026540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes)EnvironmentalOpen in IMG/M
3300026547Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes)EnvironmentalOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300027857Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028563Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaGHost-AssociatedOpen in IMG/M
3300028712Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139EnvironmentalOpen in IMG/M
3300028800Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaGHost-AssociatedOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300031448Rock endolithic microbial communities from Victoria Land, Antarctica - Knobhead nordEnvironmentalOpen in IMG/M
3300031450Rock endolithic microbial communities from Victoria Land, Antarctica - University Valley sudEnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031726Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031763Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032042Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032064Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17EnvironmentalOpen in IMG/M
3300032065Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300033475Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YCEnvironmentalOpen in IMG/M
3300033502Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF9FY SIP fractionEnvironmentalOpen in IMG/M
3300033550Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4EnvironmentalOpen in IMG/M
3300033758Tropical peat soil microbial communities from peatlands in Loreto, Peru - SR_AEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
4PV_034382302170459015Switchgrass, Maize And Mischanthus LitterNDLVDAHSAKVEGFKVSKATLNLDTFGHGYRTIWFT
INPhiseqgaiiFebDRAFT_10116279023300000364SoilPFFGDLIDGYSDQVKGLKPSKGTLNLDSFGHGFRTIWFG*
Ga0062594_10154085613300005093SoilGYIIPFFRDLLDGYAANVKGLSPSKGTQNLDSYGHGFRTIWFD*
Ga0062594_10307419523300005093SoilYIIPFFNDLVDAYSSKVQGFKPSKGTLNLDSFGNGYTTIWFA*
Ga0066685_1038027923300005180SoilMFNNLVDAYSTKVAGFNQGSKATLNLDSFGHGYRNIWFA*
Ga0066675_1065525723300005187SoilQQTEYNAGGYIVPCFGGLIDGYSAKVKGLKPSKGTLNLDSFGNGYRSIWFA*
Ga0066388_10292854823300005332Tropical Forest SoilIPFFGGLIDGYATKVKGLVPSKGTLNLDSFGHGYRTIWFG*
Ga0066388_10571231923300005332Tropical Forest SoilIPFFGGLIDGYATKVKGLVPSKGTLNLDSFGHGYRTIWFA*
Ga0066388_10778623013300005332Tropical Forest SoilYIIPFFGGLIDAYAANVKGLKPSKGTLNLDSFGHGFRTIWFG*
Ga0066388_10844381313300005332Tropical Forest SoilEYDIGGYIIPYFNALIDGYASNVKGLSPSKGTLNLASFGHGYRTIWFA*
Ga0070682_10052245113300005337Corn RhizosphereFFNNLVDSYSTKVSGFVPGKSTQNLDSFGHGYRTIWFNA*
Ga0068868_10172814123300005338Miscanthus RhizosphereEYDIGGYIIPYFNALIDGYGSNVKGLSPSKGTLNLASFGHGFRTIWFA*
Ga0070714_10105412223300005435Agricultural SoilIIPFFNNLVDSYSSKVSGFVPGKSTQNLDSFGHGYRTIWFNA*
Ga0070714_10213341223300005435Agricultural SoilQGGYIIPMFNNLVDAYSTKVGGFNNGSKATLNLDSFGHGYRSIYFTA*
Ga0070713_10195801313300005436Corn, Switchgrass And Miscanthus RhizosphereNVGGYIIPCFGGLIDGYSTKVKGLKPNKGTLNLNYFGYGYRTIWFA*
Ga0070711_10059842413300005439Corn, Switchgrass And Miscanthus RhizosphereYIIPFFNNLVDSYSTKVSGFVPGKSTQNLDSFGHGYRTIWFS*
Ga0066689_1055895013300005447SoilQGGYIIPMFNNLVDAYATKVGGFNNGSKATLNLDSFGHGYRSIYFTA*
Ga0070685_1040763223300005466Switchgrass RhizosphereIPFFNNLVDSFNSKVKGFEAGRGTLNLDAFGHGFRTIWFES*
Ga0070706_10205817223300005467Corn, Switchgrass And Miscanthus RhizosphereIPFFGGLIDGYSTRVQGLKPSKGTLNLDSFGHGYRTIWFG*
Ga0070699_10009592943300005518Corn, Switchgrass And Miscanthus RhizosphereMFNNLVDAYSTKVGGLNNGSKATLNLDSFGHGYRSIYFTA*
Ga0066697_1042841113300005540SoilIAIEHEMQQTEYNAGGYIVPCFGGLIDGYSAKVKGLKPSKGTLNLDSFGNGYRSIWFA*
Ga0070672_10090345313300005543Miscanthus RhizosphereNQGGYIIPFFNNLIDAYSAKVTGFQPNRGTLNLDSFGRGYTAISFA*
Ga0066661_1070809823300005554SoilVDAYSTKVAGFNQGSKATLNLDSFGHGFRNIWFA*
Ga0066654_1066907313300005587SoilNLLDAYSSKVVGFQPGKGTLNLDAFGHGFRTISFA*
Ga0068856_10049776833300005614Corn RhizosphereIPFFNNLVDSYSSKVSGFIPGKSTQNLDSFGHGYRTIWFNA*
Ga0068859_10128805223300005617Switchgrass RhizosphereYDLGGYIIPFFRDLLDGYAANVKGLSPSKGTQNLDSYGHGFRTIWFD*
Ga0068864_10200516523300005618Switchgrass RhizospherePFFNNLIDAYSAKVTGFQPNRGTLNLDSFGRGYTAISFA*
Ga0066905_10192863423300005713Tropical Forest SoilIIPFFNNLIDGYAANVAGLEPSKGTLNLDSFGRGFRTIGFSS*
Ga0068861_10113368613300005719Switchgrass RhizosphereYIIPFFNNLVDSFNSKVKGFEAGRGTLNLDAFGHGFRTIWFES*
Ga0066903_10747708013300005764Tropical Forest SoilDLIDGYSNRVQGLKPSKGTLNLDSFGHGFRTIWFG*
Ga0066903_10810302923300005764Tropical Forest SoilFGGLIDGYSTKVKGLKPSKGTLNLDSFGHGYRTIWFG*
Ga0075278_107428713300005893Rice Paddy SoilFFNNLVDAHSSKVEGFKVSKATLNLDTFGHGFRTIWFA*
Ga0070717_1129302513300006028Corn, Switchgrass And Miscanthus RhizosphereGYIIPFFNNLVDGYSSRIKGFQVTKATQNLDSFAHGYRTIWFS*
Ga0066652_10140602313300006046SoilFGGLIDGYSTRVKGLKPSKGTLNLDSFGHGYRTIWFG*
Ga0075026_10014908923300006057WatershedsFQDLVDAYTRRVSGFMAGKGTLNLDSFGHGFRTIWFG*
Ga0070716_10133857713300006173Corn, Switchgrass And Miscanthus RhizosphereVDSYSNKVSGFVPGKSTQNLDSFGHGYRTIWFNA*
Ga0070712_10036218833300006175Corn, Switchgrass And Miscanthus RhizosphereEYNYGGYIIPFFNDLVDAYSSKVAGFEPSKGTLNLTSFGNGYTTIWFT*
Ga0097621_10229942923300006237Miscanthus RhizosphereIIPFFNNLVDSYSTKVSGFVPGKSTQNLDSFGHGYRTIWFS*
Ga0066660_1094216723300006800SoilDIVHEMQTIEYIYGGYVIPFFNDLVDSYSTKVAGFKPSKATLNLDSFGHGYRTIWFT*
Ga0074063_1410306413300006953SoilYFGALIDGHSSKVQGLVPSKGTLNLDGFGHGYRTIWFA*
Ga0075435_10073268113300007076Populus RhizosphereEYNIGGYIIPFFGDLIDGYSSRVKGLKPSKGTLNLDSFGHGFRSIYFG*
Ga0105251_1059767413300009011Switchgrass RhizosphereIIPFFNDLVDAYSSKVQGFKPSKGTLNLDSFGNGYTTIWFA*
Ga0105245_1280793613300009098Miscanthus RhizosphereLLDGYAANVKGLSPSKGTQNLDSYGHGFRTIWFD*
Ga0127503_1129578923300010154SoilDLIDGYAANVKGLKPSKGTLNLDSFGHGFRSIWFG*
Ga0134070_1008293713300010301Grasslands SoilIIPCFGGLIDGYSTKVKGLVPSKGTLNLDSFGHGFRTIWFA*
Ga0126376_1087831213300010359Tropical Forest SoilLIDGYSAKVKGLKPSKGTLNLDSFGHGFRTIWFG*
Ga0126376_1090584413300010359Tropical Forest SoilIPFFGGLIDAYAANVKGLKPSKGTLNLDSFGHGFRTIWFG*
Ga0126378_1277944423300010361Tropical Forest SoilFNDLIDGYAANVQGLKPSKGTLNLDSFGHGYRTIWFS*
Ga0126381_10130981113300010376Tropical Forest SoilFNDLIDGYSSKVKGLKPSKGTLNLDSFGHGFRTIWFG*
Ga0126381_10405938123300010376Tropical Forest SoilFGGLIDGYSTKVKGLKPSKGTLNLDSFGHGFRTIWFS*
Ga0126381_10407386623300010376Tropical Forest SoilGGLIDAYAANVKGLKPSKGTLNLDSFGHGFRTIWFG*
Ga0126381_10436483923300010376Tropical Forest SoilGYIIPCFGGLIDGYATKVKGLKPSKGTLNLDSFGHGFRTIWFG*
Ga0126381_10458900713300010376Tropical Forest SoilIIPFFGDLIDGYSDKVKGLRPSKGTLNLDSFGHGFRTIWLG*
Ga0126383_1360376223300010398Tropical Forest SoilIPFFNDLVDAYSKKVNGFVASKGTLNLDSFGHGFRTIWFS*
Ga0126350_1162384313300010880Boreal Forest SoilLEYDIGGYVIPFFNDLVDGYSSQVKGLLPSKGTLNLDGFGHGYRTIWFG*
Ga0137392_1065307213300011269Vadose Zone SoilPFFGGLIDGYSVRVQGLKPSKGTLNLDSFGHGYRTIWFG*
Ga0136618_1040117223300012188Polar Desert SandKLEYEYGGYIIPFFGSLIDGYSPEVQGFSPSRGTLNLASYGHGYRTIWFG*
Ga0137383_1050881213300012199Vadose Zone SoilIPFFGGLIDGYSAKVKGFKPSKGTLNLDSFGHGYRTIWFG*
Ga0137365_1101546423300012201Vadose Zone SoilFFGGLIDGYSDKVKGFKPSKGTLNLDSFGHGYRTIWFG*
Ga0137377_1146395313300012211Vadose Zone SoilIPFFGGLIDAYSTRVKGLKPSKGTLNLDSFGHGYRTIWFG*
Ga0137386_1038821323300012351Vadose Zone SoilFGGLIDAYSTRVKGLKPSKGTLNLDSFGHGFRTIWFG*
Ga0137385_1019743813300012359Vadose Zone SoilIPCFGGLIDGYTAKVKGLKPSKGTLNLDSFGHGYRTIWFG*
Ga0137375_1124019113300012360Vadose Zone SoilYIIPFFGNLIDGYAANVAGLSPSKGTLNLAGFGQGYRTIWFS*
Ga0137361_1153241023300012362Vadose Zone SoilIIPFFGGLIDGYSTRVMGLKPSKGTLNLDSFGHGYRTIWFG*
Ga0137390_1126576523300012363Vadose Zone SoilGYIIPFFNDLVDGYSRQVKGLQPSKGTLNLDSFGHGYRTIWFG*
Ga0137358_1096718813300012582Vadose Zone SoilNVGGYIIPCFGGLIDGYTAKVKGLKPSKGTLNLDSFGHGYRTIWFG*
Ga0164298_1006446833300012955SoilYIIPFFNDLVDAYSSKVQGFQPSKGTLNLDSFGNGYTTIWFG*
Ga0164298_1023763323300012955SoilFFNNLIDAYSSKVTGFVPSKGTLNLDAFGHGYRTIWFA*
Ga0126369_1076251723300012971Tropical Forest SoilIPFFGGLIDGYAANVKGLKPSKGTLNLDSFGHGFRTIWFS*
Ga0126369_1299108013300012971Tropical Forest SoilPFFGGLIDGYAANVKGLKPSKGTLNLDSFGHGFRSIWFG*
Ga0164307_1090716113300012987SoilIIPFFNDLVDAYSSKVQGFQPSKGTLNLDSFGNGYTTIWFG*
Ga0164306_1109831223300012988SoilGGLIDGYSTKVKGLKPSKGTLNLDSFGHGYRTIWFG*
Ga0164305_1175454013300012989SoilPFFNNLVDSYSTKVTGFKVGKAPQNLDSFGHGYRTIWFT*
Ga0157374_1182418513300013296Miscanthus RhizosphereIIPFFGNLIDGYSSKVQGLAPSKGTLNLDSFGHGFRTIWFA*
Ga0134078_1021060813300014157Grasslands SoilEYNAGGYIVPCFGGLIDGYSAKVKGLKPSKGTLNLDSFGNGYRSIWFA*
Ga0157377_1042753713300014745Miscanthus RhizosphereLVDSFNSKVKGFEAGRGTLNLDAFGHGFRTIWFES*
Ga0187817_1110640423300017955Freshwater SedimentMLEYDIGGYIIPFFNDLIDGYADSFKGLRPSKGTLNLDSFGHGYRTIWFG
Ga0184625_1060256823300018081Groundwater SedimentFFGNLLDGYAANVAGFVPSKGTLNLDSFGHGFRTIWFT
Ga0187774_1037693223300018089Tropical PeatlandYIIPYFNDLIDGYAANVKGLKPSKGTLNLDSFGHGYRTIWFS
Ga0190272_1093546523300018429SoilSRIEIQHEMQQLEYDLGGYIIPYFGSLIDGYSAKLAGLSPSKGTLNLAGFGHGFRTIWFA
Ga0193735_116064323300020006SoilPFFNDLVDAYSTKVSGFAVSKGTLNLDSFGHGFRTIWFS
Ga0210399_1146044523300020581SoilPFFGDLIDGYAANLKGLKPSKGTLNLDSFGHGFRTIWFS
Ga0210378_1006220813300021073Groundwater SedimentNLLDGYASNVAGLVPSKGTLNLDTFGHGYRTIWFS
Ga0210402_1095459513300021478SoilYDQGGYIIPFFQDLVDAYSKRVSGFIAGKETLSLDSFGHGFRTIWFG
Ga0126371_1268210823300021560Tropical Forest SoilFNDLIDGYSDKVKGLRPSKGTLNLDYFGHGFSSIWFG
Ga0126371_1367581323300021560Tropical Forest SoilGLIDGYAANVKGLKPSKGTLNLDSFGHGFRTIWFS
Ga0222622_1054233713300022756Groundwater SedimentDIGGYIIPFFNNLIDGYGANVAGFSPSKGTLNLASFGHGYRTIWFSS
Ga0207697_1046261813300025315Corn, Switchgrass And Miscanthus RhizosphereFFNDLVDAYSSKVQGFKPSKGTLHLDSFGNGYTTIWFG
Ga0208190_112004923300025473PeatlandDLMDAYSSRVAGLNPNKGTLPLDYFGHGFRNIWFT
Ga0207647_1077336623300025904Corn RhizosphereNDLVDAYSTKVQGFEPSKGTLNLTYFGNGYTTIWFA
Ga0207699_1016859833300025906Corn, Switchgrass And Miscanthus RhizosphereFGGLIDGYAAKVKGLKPSKGTLNLDSFGHGYRTIWFG
Ga0207693_1074555423300025915Corn, Switchgrass And Miscanthus RhizosphereFFNNLVDAYSSKVSGFVQNTRSTQNLNSFGNGFRTIWFT
Ga0207662_1072356013300025918Switchgrass RhizosphereFKNLVDAHSAKVQGFKVSKATLNLDTFGHGYRTIWFT
Ga0207652_1056736223300025921Corn RhizosphereGYVIPFFNNLVDSYSSKVSGFVPGKSTQNLDSFGHGYRTIWFS
Ga0207646_1012388513300025922Corn, Switchgrass And Miscanthus RhizosphereIPFFGGLIDGYSTKVKGLKPSKGTLNLDSFGHGYRTIWFG
Ga0207687_1040957813300025927Miscanthus RhizosphereIEYNIGGYIIPFFGDLIDGYSSRVKGLKPSKGTLNLDSFGHGFRSIYFG
Ga0207700_1005482413300025928Corn, Switchgrass And Miscanthus RhizosphereCFGGLIDGYTAKVKGLKPSKGTLNLDSFGHGYRTIWFG
Ga0207700_1184116923300025928Corn, Switchgrass And Miscanthus RhizosphereYIIPFFNDLVDGFSTKVSGFQPSKGTLNLDSFGHGYRTIWFG
Ga0207679_1151299123300025945Corn RhizosphereFNNLIDGYGANVSGFTPSKGTLNLASFGHGFRTIWFND
Ga0207702_1243834013300026078Corn RhizosphereNLIDAYSSKVTGFVPSKGTLNLDAFGHGYRTIWFA
Ga0257156_105122413300026498SoilAEYNAGGYIIPCFGGLIDGYSTKVKGLKPSKGTLNLDSFGHGHRTIWFG
Ga0209376_129335913300026540SoilMFNNLVDAYSTKVAGFNQGSKATLNLDSFGHGYRNIWFA
Ga0209156_1022313513300026547SoilQQTEYNAGGYIVPCFGGLIDGYSAKVKGLKPSKGTLNLDSFGNGYRSIWFA
Ga0209177_1001896333300027775Agricultural SoilFNDLVDSYSTKVAGFKPSKATLNLDSFGHGFRTIWFT
Ga0209166_1004556843300027857Surface SoilNDLIDGYSNSVKGLRPSKGTLNLDSFGHGYRTMWFG
Ga0265319_112452713300028563RhizosphereFFNNLLDAYSAKVAGFQPSKGTLNLDAFGHGYRTIWFA
Ga0265319_118014213300028563RhizosphereYIIPFFNNLLDAYSAKVAGFQPSKGTLNLDAFGHGYRTIWFA
Ga0307285_1011536523300028712SoilEYDIGGYIIPFFNNLIDGYGANVAGFSPSKGTLNLASFGHGYRTIWFSS
Ga0265338_1075273613300028800RhizospherePFFNNLLDAYSAKVAGFQPSKGTLNLDAFGHGYRTIWFA
Ga0307312_1082654213300028828SoilGLIDGYTAKVKGLKPSKGTLNLDSFGHGYRTIWFG
Ga0307308_1026293113300028884SoilYIIPFFNNLLDAYSAKVTGFVPSKGTLNLDAFGHGYRTIWFA
Ga0272438_124882313300031448RockGGYVIPFYGDLVDAASSKIKGLVPSKGTLNLDGYGRGYRTIWFG
Ga0272433_1041473823300031450RockFGSLVDGYAANVAGLSPSKGTLNLASYGHGYRTIWFS
Ga0318555_1032268523300031640SoilMQQAEYNVGGYIIPCFGGLIDGYAANVKGLKPSKGTLNLDSFGHGYRTIWFS
Ga0306917_1100966913300031719SoilGYIIPCFGGLIDGYSTKVKGLKPSKGTLNLDSFGHGYRTIWFG
Ga0307469_1120121223300031720Hardwood Forest SoilIIPFFNDLVDAYSSKVAGFEPSKGTLNLTSFGNGYTTIWFT
Ga0318493_1004252613300031723SoilGGLIDGYSTKVKGLKPSKGTLNLDSFGHGYRTIWFG
Ga0302321_10251433313300031726FenTGGYIIPFNNNLIDAYSSKVTGFQKNRGTLNLDSFGRNYADVSFA
Ga0306918_1006957943300031744SoilGLIDGYSTKVKGLKPSKGTLNLDSFGHGYRTIWFG
Ga0318492_1062070823300031748SoilGYIIPCFGGLIDGYAAKVKGLKPSKGTLNLDSFGHGYRTIWFG
Ga0318494_1031412823300031751SoilFGGLIDGYSAKVKGLVPSKGTLNLDSFGHGFRTIWFG
Ga0318494_1056809713300031751SoilFGGLIDAYAANVKGLKPSKGTLNLDSFGHGYRTIWFG
Ga0318537_1012357713300031763SoilIIPCFGGLIDGYSTKVKGLKPSKGTLNLDSFGHGYRTIWFA
Ga0318554_1045731013300031765SoilIIPFFGGLIDGYSAKVKGLVPSKGTLNLDSFGHGFRTIWFG
Ga0318520_1087781323300031897SoilIPCFGGLIDGYSTKVKGLKPSKGTLNLDSFGHGFRTIWFG
Ga0310912_1108993013300031941SoilAEYNVGGYIIPCFGGLIDGYAANVKGLKPSKGTLNLDSFGHGFRTIWFS
Ga0306926_1221577213300031954SoilGLIDGYAANVKGLKPSKGTLNLDSFGHGYRTIWFG
Ga0318562_1085538823300032008SoilGGLIDGYAANVKGLKPSKGTLNLDSFGHGFRTIWFS
Ga0318549_1043534623300032041SoilIPFFGGLIDAYAANVKGLKPSKGTLNLDSFGHGYRTIWFG
Ga0318545_1010153213300032042SoilPFFGGLIDGYAANVKGLKPSKGTLNLDSFGHGFRTIWFG
Ga0318504_1025589313300032063SoilIPFFGGLIDGYSAKVKGLKPSKGTLNLDSFGHGFRTIWFG
Ga0318510_1013755513300032064SoilNVGGYIIPCFGGLIDGYAANVKGLKPSKGTLNLDSFGHGFRTIWFS
Ga0318513_1010696113300032065SoilFFGGLLDGYAASVKGLKPSKGTLNLDSFGHGFRTIWFG
Ga0318518_1004708313300032090SoilEYNVGGYIIPCFGGLIDGYAAKVKGLKPSKGTLNLDSFGHGYRTIWFG
Ga0307471_10262563813300032180Hardwood Forest SoilIIPFFNDLVDAYSSKVSGFKASKGTLNLDSFGHGFRTIWFG
Ga0310811_1035434533300033475SoilPFFGGLIDGYAAKVKGLKPSKGTLNLDSFGHGYRTIWFG
Ga0326731_108761223300033502Peat SoilNLVDAHSAKVEGFKVSKATLNLDTFGHGYRTIWFA
Ga0247829_1074901213300033550SoilDLGGYIIPFFRDLLDGYAANVKGLSPSKGTQNLDSYGHGFRTIWFD
Ga0314868_016742_3_1133300033758PeatlandGNLLDGYGANVNGLLPSKGTLNLDTFGHGYRNIWFS

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.