Basic Information | |
---|---|
Family ID | F055074 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 139 |
Average Sequence Length | 41 residues |
Representative Sequence | SVGNVRRVRSRRSLRGRVVNQSPRPGTIKRRNFPVKLAVGRG |
Number of Associated Samples | 101 |
Number of Associated Scaffolds | 139 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 97.84 % |
% of genes from short scaffolds (< 2000 bps) | 92.81 % |
Associated GOLD sequencing projects | 94 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.43 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (69.065 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (20.144 % of family members) |
Environment Ontology (ENVO) | Unclassified (25.180 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.799 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.29% β-sheet: 24.29% Coil/Unstructured: 71.43% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 139 Family Scaffolds |
---|---|---|
PF03030 | H_PPase | 7.91 |
PF08240 | ADH_N | 4.32 |
PF00082 | Peptidase_S8 | 2.88 |
PF00293 | NUDIX | 2.16 |
PF10162 | G8 | 2.16 |
PF02597 | ThiS | 2.16 |
PF02391 | MoaE | 1.44 |
PF13418 | Kelch_4 | 1.44 |
PF13415 | Kelch_3 | 1.44 |
PF17164 | DUF5122 | 0.72 |
PF02909 | TetR_C_1 | 0.72 |
PF02423 | OCD_Mu_crystall | 0.72 |
PF13574 | Reprolysin_2 | 0.72 |
PF13602 | ADH_zinc_N_2 | 0.72 |
PF00535 | Glycos_transf_2 | 0.72 |
PF02801 | Ketoacyl-synt_C | 0.72 |
PF16884 | ADH_N_2 | 0.72 |
PF02445 | NadA | 0.72 |
PF07676 | PD40 | 0.72 |
PF13964 | Kelch_6 | 0.72 |
PF01344 | Kelch_1 | 0.72 |
PF04545 | Sigma70_r4 | 0.72 |
PF03793 | PASTA | 0.72 |
PF07394 | DUF1501 | 0.72 |
PF10041 | DUF2277 | 0.72 |
COG ID | Name | Functional Category | % Frequency in 139 Family Scaffolds |
---|---|---|---|
COG3808 | Na+ or H+-translocating membrane pyrophosphatase | Energy production and conversion [C] | 7.91 |
COG1977 | Molybdopterin synthase sulfur carrier subunit MoaD | Coenzyme transport and metabolism [H] | 2.16 |
COG2104 | Sulfur carrier protein ThiS (thiamine biosynthesis) | Coenzyme transport and metabolism [H] | 2.16 |
COG0314 | Molybdopterin synthase catalytic subunit MoaE | Coenzyme transport and metabolism [H] | 1.44 |
COG0379 | Quinolinate synthase | Coenzyme transport and metabolism [H] | 0.72 |
COG1309 | DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA | Transcription [K] | 0.72 |
COG2423 | Ornithine cyclodeaminase/archaeal alanine dehydrogenase, mu-crystallin family | Amino acid transport and metabolism [E] | 0.72 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 69.06 % |
Unclassified | root | N/A | 30.94 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2124908045|KansclcFeb2_ConsensusfromContig540981 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 722 | Open in IMG/M |
2170459019|G14TP7Y02GHRXM | Not Available | 545 | Open in IMG/M |
3300000044|ARSoilOldRDRAFT_c029501 | Not Available | 504 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_100808184 | Not Available | 1040 | Open in IMG/M |
3300000956|JGI10216J12902_103503252 | Not Available | 602 | Open in IMG/M |
3300004114|Ga0062593_102853014 | Not Available | 552 | Open in IMG/M |
3300005093|Ga0062594_103072853 | Not Available | 522 | Open in IMG/M |
3300005164|Ga0066815_10006718 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1307 | Open in IMG/M |
3300005164|Ga0066815_10091462 | Not Available | 561 | Open in IMG/M |
3300005168|Ga0066809_10044775 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 977 | Open in IMG/M |
3300005172|Ga0066683_10193997 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1253 | Open in IMG/M |
3300005186|Ga0066676_10308705 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1048 | Open in IMG/M |
3300005329|Ga0070683_100039054 | All Organisms → cellular organisms → Bacteria | 4355 | Open in IMG/M |
3300005329|Ga0070683_100041248 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 4245 | Open in IMG/M |
3300005332|Ga0066388_107488833 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
3300005459|Ga0068867_101701049 | Not Available | 591 | Open in IMG/M |
3300005526|Ga0073909_10238868 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 803 | Open in IMG/M |
3300005535|Ga0070684_101051308 | Not Available | 765 | Open in IMG/M |
3300005558|Ga0066698_10169540 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1483 | Open in IMG/M |
3300005558|Ga0066698_10231529 | Not Available | 1271 | Open in IMG/M |
3300005564|Ga0070664_102103791 | Not Available | 536 | Open in IMG/M |
3300005713|Ga0066905_100233879 | All Organisms → cellular organisms → Bacteria | 1400 | Open in IMG/M |
3300005713|Ga0066905_100685190 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 878 | Open in IMG/M |
3300005764|Ga0066903_100144928 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3391 | Open in IMG/M |
3300005764|Ga0066903_106979862 | Not Available | 586 | Open in IMG/M |
3300006175|Ga0070712_100277735 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1348 | Open in IMG/M |
3300006175|Ga0070712_101056332 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 704 | Open in IMG/M |
3300006358|Ga0068871_101254316 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 696 | Open in IMG/M |
3300006572|Ga0074051_11694153 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 676 | Open in IMG/M |
3300006574|Ga0074056_11658248 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
3300006575|Ga0074053_11133785 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 652 | Open in IMG/M |
3300006575|Ga0074053_11932178 | Not Available | 600 | Open in IMG/M |
3300006576|Ga0074047_11988975 | Not Available | 510 | Open in IMG/M |
3300006580|Ga0074049_13149681 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 937 | Open in IMG/M |
3300006604|Ga0074060_11944095 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 534 | Open in IMG/M |
3300006845|Ga0075421_101616804 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 704 | Open in IMG/M |
3300006854|Ga0075425_100550445 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1328 | Open in IMG/M |
3300006854|Ga0075425_101426948 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
3300006854|Ga0075425_101696086 | Not Available | 711 | Open in IMG/M |
3300006854|Ga0075425_102817563 | Not Available | 535 | Open in IMG/M |
3300006876|Ga0079217_11014787 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 608 | Open in IMG/M |
3300006881|Ga0068865_100744657 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 841 | Open in IMG/M |
3300006894|Ga0079215_11469074 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 536 | Open in IMG/M |
3300006953|Ga0074063_14174932 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 999 | Open in IMG/M |
3300006953|Ga0074063_14249149 | Not Available | 930 | Open in IMG/M |
3300007076|Ga0075435_100885804 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 778 | Open in IMG/M |
3300007076|Ga0075435_101309682 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
3300009148|Ga0105243_10640535 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1029 | Open in IMG/M |
3300009162|Ga0075423_11730953 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
3300010041|Ga0126312_10366743 | Not Available | 1022 | Open in IMG/M |
3300010043|Ga0126380_11742891 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 561 | Open in IMG/M |
3300010326|Ga0134065_10161646 | Not Available | 789 | Open in IMG/M |
3300010359|Ga0126376_13054247 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 517 | Open in IMG/M |
3300010362|Ga0126377_12918647 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 552 | Open in IMG/M |
3300010364|Ga0134066_10376354 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 534 | Open in IMG/M |
3300010373|Ga0134128_11515874 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
3300010375|Ga0105239_12685575 | Not Available | 581 | Open in IMG/M |
3300010398|Ga0126383_11461128 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 773 | Open in IMG/M |
3300010400|Ga0134122_11477391 | Not Available | 698 | Open in IMG/M |
3300010403|Ga0134123_12123967 | Not Available | 622 | Open in IMG/M |
3300011107|Ga0151490_1206805 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 848 | Open in IMG/M |
3300012507|Ga0157342_1064771 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
3300012899|Ga0157299_10061283 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 875 | Open in IMG/M |
3300012902|Ga0157291_10114787 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Miltoncostaeales → Miltoncostaeaceae → Miltoncostaea → Miltoncostaea marina | 754 | Open in IMG/M |
3300012948|Ga0126375_10447055 | Not Available | 948 | Open in IMG/M |
3300012955|Ga0164298_10560839 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 776 | Open in IMG/M |
3300012958|Ga0164299_10958589 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 626 | Open in IMG/M |
3300012960|Ga0164301_10895875 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 688 | Open in IMG/M |
3300012960|Ga0164301_11478222 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 559 | Open in IMG/M |
3300012961|Ga0164302_11105226 | Not Available | 626 | Open in IMG/M |
3300012961|Ga0164302_11267045 | Not Available | 594 | Open in IMG/M |
3300012961|Ga0164302_11271920 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 593 | Open in IMG/M |
3300012988|Ga0164306_11634671 | Not Available | 557 | Open in IMG/M |
3300012989|Ga0164305_10083906 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1991 | Open in IMG/M |
3300012989|Ga0164305_11508689 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 596 | Open in IMG/M |
3300014157|Ga0134078_10153343 | Not Available | 908 | Open in IMG/M |
3300014326|Ga0157380_10834703 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 942 | Open in IMG/M |
3300014745|Ga0157377_11062135 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 618 | Open in IMG/M |
3300015371|Ga0132258_10109566 | All Organisms → cellular organisms → Bacteria | 6531 | Open in IMG/M |
3300015371|Ga0132258_11250087 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1877 | Open in IMG/M |
3300015371|Ga0132258_11363735 | All Organisms → cellular organisms → Bacteria | 1791 | Open in IMG/M |
3300015371|Ga0132258_11441414 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1739 | Open in IMG/M |
3300015371|Ga0132258_11680951 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1601 | Open in IMG/M |
3300015372|Ga0132256_100043636 | Not Available | 4132 | Open in IMG/M |
3300015372|Ga0132256_101077330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 918 | Open in IMG/M |
3300015372|Ga0132256_101630741 | Not Available | 755 | Open in IMG/M |
3300015373|Ga0132257_100235239 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2183 | Open in IMG/M |
3300015373|Ga0132257_100350552 | All Organisms → cellular organisms → Bacteria | 1784 | Open in IMG/M |
3300015373|Ga0132257_101717178 | Not Available | 805 | Open in IMG/M |
3300015373|Ga0132257_102994994 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
3300015374|Ga0132255_100564976 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1678 | Open in IMG/M |
3300015374|Ga0132255_100813367 | All Organisms → cellular organisms → Bacteria | 1393 | Open in IMG/M |
3300015374|Ga0132255_104049919 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 622 | Open in IMG/M |
3300015374|Ga0132255_104296250 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 604 | Open in IMG/M |
3300018031|Ga0184634_10062642 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1564 | Open in IMG/M |
3300018031|Ga0184634_10528091 | Not Available | 524 | Open in IMG/M |
3300018072|Ga0184635_10195061 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 808 | Open in IMG/M |
3300018073|Ga0184624_10138508 | Not Available | 1063 | Open in IMG/M |
3300018074|Ga0184640_10055832 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1643 | Open in IMG/M |
3300018077|Ga0184633_10334390 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 767 | Open in IMG/M |
3300018081|Ga0184625_10628808 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 523 | Open in IMG/M |
3300018081|Ga0184625_10655510 | Not Available | 508 | Open in IMG/M |
3300019884|Ga0193741_1010206 | All Organisms → cellular organisms → Bacteria | 2457 | Open in IMG/M |
3300020016|Ga0193696_1112813 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 693 | Open in IMG/M |
3300021078|Ga0210381_10032622 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1475 | Open in IMG/M |
3300021080|Ga0210382_10347431 | Not Available | 655 | Open in IMG/M |
3300021510|Ga0222621_1132258 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 531 | Open in IMG/M |
3300022756|Ga0222622_11315684 | Not Available | 532 | Open in IMG/M |
3300022901|Ga0247788_1026593 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1028 | Open in IMG/M |
3300025915|Ga0207693_10393451 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1084 | Open in IMG/M |
3300025916|Ga0207663_10531890 | All Organisms → cellular organisms → Bacteria | 917 | Open in IMG/M |
3300025920|Ga0207649_11466341 | Not Available | 540 | Open in IMG/M |
3300025937|Ga0207669_10805943 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 779 | Open in IMG/M |
3300025944|Ga0207661_10168061 | Not Available | 1907 | Open in IMG/M |
3300025944|Ga0207661_10218503 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1683 | Open in IMG/M |
3300025944|Ga0207661_10391580 | All Organisms → cellular organisms → Bacteria | 1259 | Open in IMG/M |
3300025944|Ga0207661_11639465 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 588 | Open in IMG/M |
3300025945|Ga0207679_10072645 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2599 | Open in IMG/M |
3300025945|Ga0207679_11397308 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 642 | Open in IMG/M |
3300026078|Ga0207702_10705314 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 995 | Open in IMG/M |
3300026078|Ga0207702_10949259 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 853 | Open in IMG/M |
3300026089|Ga0207648_10259084 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1552 | Open in IMG/M |
3300026116|Ga0207674_10214759 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1872 | Open in IMG/M |
3300027560|Ga0207981_1051365 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
3300027821|Ga0209811_10050685 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1419 | Open in IMG/M |
3300028708|Ga0307295_10190953 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 578 | Open in IMG/M |
3300028712|Ga0307285_10070817 | Not Available | 893 | Open in IMG/M |
3300028715|Ga0307313_10214879 | Not Available | 597 | Open in IMG/M |
3300028715|Ga0307313_10215103 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 597 | Open in IMG/M |
3300028719|Ga0307301_10225854 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 610 | Open in IMG/M |
3300028720|Ga0307317_10006784 | All Organisms → cellular organisms → Bacteria | 3402 | Open in IMG/M |
3300028720|Ga0307317_10150817 | Not Available | 780 | Open in IMG/M |
3300028771|Ga0307320_10074466 | Not Available | 1272 | Open in IMG/M |
3300028784|Ga0307282_10061181 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1697 | Open in IMG/M |
3300028796|Ga0307287_10296260 | Not Available | 612 | Open in IMG/M |
3300028819|Ga0307296_10094879 | All Organisms → cellular organisms → Bacteria | 1596 | Open in IMG/M |
3300028819|Ga0307296_10343038 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
3300028824|Ga0307310_10220806 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_68_9 | 901 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 20.14% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 10.07% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 9.35% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 5.76% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.76% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.04% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 5.04% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.60% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.60% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.88% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.88% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 2.88% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.16% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.16% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.16% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.16% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.44% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.44% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.44% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.44% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.44% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.72% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.72% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.72% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.72% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.72% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.72% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.72% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.72% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.72% |
Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.72% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2124908045 | Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011 | Environmental | Open in IMG/M |
2170459019 | Litter degradation MG4 | Engineered | Open in IMG/M |
3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis soil old | Host-Associated | Open in IMG/M |
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005164 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAC | Environmental | Open in IMG/M |
3300005168 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC | Environmental | Open in IMG/M |
3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006572 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006574 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006575 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006576 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006580 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006604 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300011107 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Host-Associated | Open in IMG/M |
3300012899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2 | Environmental | Open in IMG/M |
3300012902 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S169-409C-1 | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
3300019884 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s2 | Environmental | Open in IMG/M |
3300020016 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1 | Environmental | Open in IMG/M |
3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
3300021510 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coex | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300022901 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S156-409C-4 | Environmental | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027560 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC (SPAdes) | Environmental | Open in IMG/M |
3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300028708 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152 | Environmental | Open in IMG/M |
3300028712 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139 | Environmental | Open in IMG/M |
3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
KansclcFeb2_16401900 | 2124908045 | Soil | SVGRVRRVRARRSLRGRVVSQAPRPGTVKRRGFPVKLAVGR |
4MG_01595350 | 2170459019 | Switchgrass, Maize And Mischanthus Litter | VRSRRSLRGRVVKQTPRPGTIKRRNFPVRLKVGRG |
ARSoilOldRDRAFT_0295011 | 3300000044 | Arabidopsis Rhizosphere | HCAVGRISRVRSRRSLRGRVVKQTPRPGTIKRRNFPVRLSVGRG* |
INPhiseqgaiiFebDRAFT_1008081841 | 3300000364 | Soil | VRSRRSLRGRVVSQNPRPGAIKRRNFPVRLAVGRL* |
JGI10216J12902_1035032523 | 3300000956 | Soil | VGQVSRVRSRRSLRGRVVKQTPRPGTIKRRNFPVRLKVGRG* |
Ga0062593_1028530141 | 3300004114 | Soil | GRVRKARSRRSLRGRVINQSPRPGSLRRRGFPVKLVVGRR* |
Ga0062594_1030728531 | 3300005093 | Soil | AHCSVGNVRRVRSRRSLRGRVVNQSPRPGTIKRRNFPVRLAVGRG* |
Ga0066815_100067182 | 3300005164 | Soil | AHCSVGRVRRARARRSLVGRVVKQTPRPGTIKRRNFPVALVVGRR* |
Ga0066815_100914622 | 3300005164 | Soil | AHCSVGNIRRVRSRRSLRGRVVSQNPRPGTIKRRNFPVKLAVGRS* |
Ga0066809_100447753 | 3300005168 | Soil | GRVRGVRSKRALRGRVVAQTPRPGAVRRQGFPVKLLVGRR* |
Ga0066683_101939973 | 3300005172 | Soil | HCSLGKVRHVRSRRSLRGRVVSQSPRAGSTRRLNFPVMLAVGRG* |
Ga0066676_103087052 | 3300005186 | Soil | CSIGRVSRVRSRRSLYGRVVNQAPRPGAIKRRGFPVKLAVGRP* |
Ga0070683_1000390541 | 3300005329 | Corn Rhizosphere | SVGRVTRVRSRRSLRGRVVKQTPRPGTIKRRNFPVRLKVGRG* |
Ga0070683_1000412481 | 3300005329 | Corn Rhizosphere | SVGRVRRVRARRSLRGRVVRQSPRPGTIKRRNFPVKLAVGRG* |
Ga0066388_1074888331 | 3300005332 | Tropical Forest Soil | CSVGRVRRVRSRRSLRGRVVNQAPRPGTVKRRGFPVSLAVGRG* |
Ga0068867_1017010492 | 3300005459 | Miscanthus Rhizosphere | RAHCSVGNVRRVRSRRSLVGRVVSQNPRPGAIKRRNFPVKLAVGRR* |
Ga0073909_102388682 | 3300005526 | Surface Soil | AHCSVGNVRRVRSRRSLRGHVVNQSPRPGTIKRRNFPVKLAVGRG* |
Ga0070684_1010513081 | 3300005535 | Corn Rhizosphere | HCSVGSVRRVISRRSLVGRVVRQSPRPGSIRRRGFPVNLWVGRR* |
Ga0066698_101695401 | 3300005558 | Soil | AHCSVGRVRRVRSRRSLWGRVVNQAPRPGAIRRQGFPVKLAVGRS* |
Ga0066698_102315291 | 3300005558 | Soil | SVGRVRRARARRSLRGRVVRQTPRPGTIRRRGFPVALVVGRR* |
Ga0070664_1021037912 | 3300005564 | Corn Rhizosphere | GQVSRVRSRRSLRGRVVKQTPRPGTIKRQNFPVRLKVGRG* |
Ga0066905_1002338791 | 3300005713 | Tropical Forest Soil | RAHCTVGRVSRVRSRRSLRGRVVRQIPRPGTIKRRNFPVRLSVGRG* |
Ga0066905_1006851902 | 3300005713 | Tropical Forest Soil | VGRVRRVVSRRSLRGRVVSQSPRPGAVRRRGFPVSLRVGRG* |
Ga0066903_1001449285 | 3300005764 | Tropical Forest Soil | GRVRRVRARRSLRGRVVNQSPRPGTIKRRNFPVKLAIGRR* |
Ga0066903_1069798622 | 3300005764 | Tropical Forest Soil | VRARRSLRGRVVSQNPRPGAVKRRNFPVKLAIGRL* |
Ga0070712_1002777351 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | RRARARRSLRGRIVKQTPRPGTIKRRNFPVALVVGR* |
Ga0070712_1010563322 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | SVGNVRRVRSRRSLRGRVVNQSPRPGTIKRRNFPVKLAVGRG* |
Ga0068871_1012543162 | 3300006358 | Miscanthus Rhizosphere | CSVGNVRRVRSRRSLRGRVVNQSPRPGTIKRRNFPVRLKVGRG* |
Ga0074051_116941531 | 3300006572 | Soil | CSVGRVRRVRARRSLRGRVVNQSPRPGTIKRRNFPVKLAVGRR* |
Ga0074056_116582481 | 3300006574 | Soil | HCSVGNVRRVRSRRSLRGRVVNQSPRPGAIKRRNFPVKLAVGRG* |
Ga0074053_111337852 | 3300006575 | Soil | RRARRSLRGRVVNQVPRPGTIRRRGFPVSLAIGRR* |
Ga0074053_119321782 | 3300006575 | Soil | RVRARRSLRGRVVNQSPRPGTVKRRNSPVKLAVGRP* |
Ga0074047_119889751 | 3300006576 | Soil | CSVGRVRRVRSRRSLRGRVVNQAPRPGTIKRRNFPVKLAVGRG* |
Ga0074049_131496811 | 3300006580 | Soil | AAHCSVGQIRRARARRSLRGRVVNQSPRPGTIKRRNFPVRLVVGRR* |
Ga0074060_119440952 | 3300006604 | Soil | GRVRRVRARRSLRGRVVNQSPRPGTIKRRNFPVKLAVGRR* |
Ga0075421_1016168041 | 3300006845 | Populus Rhizosphere | RANCRVGTVRRVRSRRSLRGRVVAQNPRPGAIRRAGFPVNLRVGRG* |
Ga0075425_1005504451 | 3300006854 | Populus Rhizosphere | AHCSVGNVRRVRSRRSLRGRVVNQAPRPGTVKRRNFPVKLAVGRG* |
Ga0075425_1014269481 | 3300006854 | Populus Rhizosphere | SVGNVRRVRSRRSLRGRVVNQSPRPGTVKRRNFPVKLAIGRR* |
Ga0075425_1016960862 | 3300006854 | Populus Rhizosphere | VRSRRSLRGRVVNQNPRPGSIRRRGFPVNLAIGRR* |
Ga0075425_1028175632 | 3300006854 | Populus Rhizosphere | RSRRSLRGRVVSQNPRPGTIKRRNFPVKLAVGRS* |
Ga0079217_110147873 | 3300006876 | Agricultural Soil | RVGTVRRVRSRRQLRGRVVGQSPRGGAVRRVGFRVNLRVGRG* |
Ga0068865_1007446572 | 3300006881 | Miscanthus Rhizosphere | GNVRRVRSRRSLRGRVVSQNPRPGTIKRRNFPVKLAVGRS* |
Ga0079215_114690741 | 3300006894 | Agricultural Soil | RRCRVGTIRRVRSRRNRIGRVVGQSPRGGAVRRVGFRVNLRVGRR* |
Ga0074063_141749322 | 3300006953 | Soil | VGRVRRARARRSLRGRVVNQSPRPGTIKRRNFPVKLVVGRR* |
Ga0074063_142491491 | 3300006953 | Soil | NVRRVRSRRSLVGRVVSQNPRPGAIKRRNFPVKLAVGRR* |
Ga0075435_1008858041 | 3300007076 | Populus Rhizosphere | NVRRVRSRRSLRGRVVNQSPRPGTVKRRNFPVKLAVGRG* |
Ga0075435_1013096821 | 3300007076 | Populus Rhizosphere | RVRSRRSLRGRVVNQAPRPGTVKRRNFPVKLAVGRG* |
Ga0105243_106405352 | 3300009148 | Miscanthus Rhizosphere | VRARRSLRGRVVNQSPRPGTIKRRNFPVKLAVGRL* |
Ga0075423_117309532 | 3300009162 | Populus Rhizosphere | RVRARRSLRGRVVNQSPRPGTIKRRNFPVKLAVGRP* |
Ga0126312_103667432 | 3300010041 | Serpentine Soil | VGTVRRVRTRRSLRGRVVGQSPRPGAVRRVGFPVNLRVGRG* |
Ga0126380_117428912 | 3300010043 | Tropical Forest Soil | AHCSVGRIRRVAARRSLRGRVVNQSPRPGTVKRRGFPVRMAVGR* |
Ga0134065_101616462 | 3300010326 | Grasslands Soil | RRVRSRRSLRGRVVNQAPRPGTIKRRGFPVKLAVGRG* |
Ga0126376_130542472 | 3300010359 | Tropical Forest Soil | VRRVRARRSLRGRVVNQSPRPGTIKRRNFPVKLAIGRR* |
Ga0126377_129186472 | 3300010362 | Tropical Forest Soil | VGRIRRVAARRSLRGRVVNQSPRPGTVKRRGFPVKMAVGR* |
Ga0134066_103763542 | 3300010364 | Grasslands Soil | VRSRRSLRGRVVNQAPRPGTIKRRGFPVKLAVGRG* |
Ga0134128_115158741 | 3300010373 | Terrestrial Soil | RAHCSVGSVRRGLSRRSLVGRVVKQTPGPGALRRRGFPVNLVVGRR* |
Ga0105239_126855752 | 3300010375 | Corn Rhizosphere | IRRVRSKHSLRGRVVKQSPRPGTIKRRNFPVSLALGRG* |
Ga0126383_114611282 | 3300010398 | Tropical Forest Soil | CSVGNVRRVRSRRSLRGRVVSQKPRPGSVKRRNFPVKLAIGRS* |
Ga0134122_114773911 | 3300010400 | Terrestrial Soil | HCSVGNVRRVRSRRSLVGRVVSQNPRPGAIKRRNFPVKLAVGRR* |
Ga0134123_121239671 | 3300010403 | Terrestrial Soil | CSVGNVRRVRSRRSLVGRVVSQNPRPGAIKRRNFPVKLAVGRR* |
Ga0151490_12068051 | 3300011107 | Soil | AHCSVGNVRRVRSRRSLRGRVVSQNPRPGTIKRRNFPVKLAVGRS* |
Ga0157342_10647711 | 3300012507 | Arabidopsis Rhizosphere | RRVRSRRSLRGRVVSQNPRPGTIKRRNFPVKLAVGRS* |
Ga0157299_100612831 | 3300012899 | Soil | VRSRRTLRGRVVSQSPRVGAIKRRNFPVSLAVGRG* |
Ga0157291_101147872 | 3300012902 | Soil | VGRVRRVRSRRALRSRVVGQSPRAGAIKRRGFPVSLLVGRG* |
Ga0126375_104470551 | 3300012948 | Tropical Forest Soil | HCTVGRVRRQRSRRQLVGRVVKQTPRAGALKRRGFPVALVVGRR* |
Ga0164298_105608392 | 3300012955 | Soil | GQVRRVRSRRSLRGRVVNQSPRPGTIKRRNFPVRLAVGRG* |
Ga0164299_109585892 | 3300012958 | Soil | HCSVGRVRRVRARRSLRGRVVNQSPRPGTIKRRNFPVKLAVGRL* |
Ga0164301_108958751 | 3300012960 | Soil | HCSVGRVRRVRSRRSLRGRVVNQSPRPGTIKRRNFPVKLAVGRG* |
Ga0164301_114782221 | 3300012960 | Soil | HCSVGNVRRVRSRRSLRGHVVNQSPRPGTIKRRNFPVKLAVGRG* |
Ga0164302_111052262 | 3300012961 | Soil | RVRRARARRSLVGRVVKQTPRPGTIKRRNFPVALVVGRR* |
Ga0164302_112670452 | 3300012961 | Soil | SVGQVRRVRSKRSLRGRVVNQSPRPGAVRRVNFPVKLAVGRG* |
Ga0164302_112719201 | 3300012961 | Soil | VGQVRRVRSRRSLRGRVVNQSPRPGTIKRRNFPVKLAVGRG* |
Ga0164307_107862281 | 3300012987 | Soil | HCSVGRIRRAHARRSLRGRVVNQSPRPGTIKRRNFPVKLVVGRR* |
Ga0164306_116346711 | 3300012988 | Soil | VRSRRSLRGRVVNQSPPPGTVKRRNFPVKLAVGRG* |
Ga0164305_100839063 | 3300012989 | Soil | VGNVRRVRARRSLRGRVVNQSPRPGTIKRRNFPVKLAVGRS* |
Ga0164305_115086891 | 3300012989 | Soil | GNVRRVRSRRSLRGRVVNQSPRPGTIKRRNFPVKLAVGRP* |
Ga0134078_101533432 | 3300014157 | Grasslands Soil | GRVRRVGARRSLRGRVVNQSPRPGTIKRRNFPVKLAIGRR* |
Ga0157380_108347031 | 3300014326 | Switchgrass Rhizosphere | RAAHCSVGNVRRVRSRRSLRGRVVNQSPRPGTIKRRNFPVRLAVGRL* |
Ga0157377_110621353 | 3300014745 | Miscanthus Rhizosphere | SVGNVRRVRSRRSLSGRVVSQSPRPSALRRRGFPVELAVGRR* |
Ga0132258_101095663 | 3300015371 | Arabidopsis Rhizosphere | RRVRARRSLRGRVVNQSPRPGTVKRRNFPVKLAIGRR* |
Ga0132258_112500871 | 3300015371 | Arabidopsis Rhizosphere | NVRRVRSRRSLRGRVVNQNPRPGTVKRRNFPVKLAVGRG* |
Ga0132258_113637352 | 3300015371 | Arabidopsis Rhizosphere | CSVGNVRRVRSRRSLRGRVVSQNPRPGVIKRRNFPVKLAIGRS* |
Ga0132258_114414141 | 3300015371 | Arabidopsis Rhizosphere | TRVRSRRSLRGRVVKQTPRAGTVKRRNFPVALKVGRS* |
Ga0132258_116809513 | 3300015371 | Arabidopsis Rhizosphere | HCSVGRVTRVRSRRSLRGRVVKQTPRPGTIKRRNFPVALKVGRG* |
Ga0132256_1000436362 | 3300015372 | Arabidopsis Rhizosphere | VGRIRRVRARRSLRGRVVNQSPRPGTIKRRNFPVKLAIGRR* |
Ga0132256_1010773302 | 3300015372 | Arabidopsis Rhizosphere | SVGRIRRVRARRSLRGRVVNQSPRPGTIKRRNFPVKLAIGRR* |
Ga0132256_1016307411 | 3300015372 | Arabidopsis Rhizosphere | GTVRRVRTRRSLRGRVVGQNPRPGAIRARGFHVNLRVGRR* |
Ga0132257_1002352392 | 3300015373 | Arabidopsis Rhizosphere | IRRVRARRSLRGRVVNQSPRPGTIKRRNFPVKLAIGRR* |
Ga0132257_1003505524 | 3300015373 | Arabidopsis Rhizosphere | VGHVRRVRSRRSLRGRVVSQNPRPGVIKRRNFPVKLAIGRS* |
Ga0132257_1017171782 | 3300015373 | Arabidopsis Rhizosphere | CSVGRVRRVRARRSLRGRVVNQSPRPGTVKRRNFPVKLAIGRR* |
Ga0132257_1029949942 | 3300015373 | Arabidopsis Rhizosphere | VGNVRRVRSRRSLRGRVVNQNPRPGTVKRRNFPVKLAVGRG* |
Ga0132255_1005649761 | 3300015374 | Arabidopsis Rhizosphere | AHCSVGKVRRVRARRSLCGRVVSQSPKPRVVKRRNFPVKLAIGRR* |
Ga0132255_1008133673 | 3300015374 | Arabidopsis Rhizosphere | AHCAVGRVRRARARRSLVGRVVKQTPRPGTIKRRNFPVALVVGRR* |
Ga0132255_1040499191 | 3300015374 | Arabidopsis Rhizosphere | RRVRSRRSLRGRVVNQSPRPGTIKRRNFPVKLAVGRG* |
Ga0132255_1042962502 | 3300015374 | Arabidopsis Rhizosphere | GRVTRVRSRRSLRGRVVKQTPRPGTIKRRNFPVKLKVGRG* |
Ga0184634_100626423 | 3300018031 | Groundwater Sediment | VGNVRRVRSRRSLRGRVVSQNPRPGTIKRRNFPVKLAVGRG |
Ga0184634_105280911 | 3300018031 | Groundwater Sediment | AHCTVGNVRRVRSRRSLRGRVVSQNPRPGTIKRRNFPVKLAVGRR |
Ga0184635_101950611 | 3300018072 | Groundwater Sediment | HCSVGRVRRVRARRSLRGRVVNQSPRPGTIKRRNFPVKLAVGRR |
Ga0184624_101385082 | 3300018073 | Groundwater Sediment | RRVRARRSLRGRVVSQNPRPGAIKRRNFPVKLAIGRR |
Ga0184640_100558321 | 3300018074 | Groundwater Sediment | VGNVRRVRARRSLRGRVVNQSPRPGTIKRRNFPVKLAVGRP |
Ga0184633_103343902 | 3300018077 | Groundwater Sediment | AAHCSVGNVRRVRSRRSLRGRVVNQSPRPGTIKRRNFPVRLAVGRL |
Ga0184625_106288081 | 3300018081 | Groundwater Sediment | RRAHCSVGNVRRVRSRRSLRGRVVSQNPRPGTIKRRNFPVKLAVGRG |
Ga0184625_106555101 | 3300018081 | Groundwater Sediment | VRRVRARRSLRGRVVNQAPRPGTIRRRGFPVNLAVGRR |
Ga0193741_10102064 | 3300019884 | Soil | KVRKRRCSVGRVRRIRVRRSLRGKVIGQSLRAGTVKRRNVPVKLSVGSR |
Ga0193696_11128131 | 3300020016 | Soil | RVRSRRSLRGRVVNQAPRPGTIKRRNFPVKLAVGRS |
Ga0210381_100326221 | 3300021078 | Groundwater Sediment | VRSRRSLRGRVVNQSPRPGTIKRQNFPVKLAVGRV |
Ga0210382_103474311 | 3300021080 | Groundwater Sediment | AAHCSVGRVRRVRSRRSLRGRVVKQSPRPGTIKRRNFPVKLAVGRS |
Ga0222621_11322581 | 3300021510 | Groundwater Sediment | HCSVGNVRRVRSRRSLRGRVVNQSPRPGTIKRRNFPVRLAVGRL |
Ga0222622_113156841 | 3300022756 | Groundwater Sediment | VRARRSLRGRVVHQSPRPGTIKRRNFPVKLAIGRR |
Ga0247788_10265932 | 3300022901 | Soil | CSVGRVRHVRSRRTLRGRVVSQSPRVGAIKRRNFPVSLAVGRG |
Ga0207693_103934512 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | SVGNVRRVRSRRSLRGRVVSQNPRPGTIKRRNFPVKLAVGRP |
Ga0207663_105318903 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | SVGRVRRVRARRSLRGRVVNQSPRPGTIKRRNFPVKLAIGRR |
Ga0207649_114663412 | 3300025920 | Corn Rhizosphere | AAHCSVGRVRHVRSRRSLRGRVVNQSPRPGTIKRRNFPVKLAVGRS |
Ga0207669_108059431 | 3300025937 | Miscanthus Rhizosphere | SVGNVRRVRSRRSLRGRVVNQSPRPGTIKRRNFPVRLAVGRG |
Ga0207661_101680612 | 3300025944 | Corn Rhizosphere | HCSVGRVRRVRARRSLRGRVVRQSPRPGTIKRRNFPVKLAVGRG |
Ga0207661_102185033 | 3300025944 | Corn Rhizosphere | SVGRVTRVRSRRSLRGRVVKQTPRPGTIKRRNFPVRLKVGRG |
Ga0207661_103915801 | 3300025944 | Corn Rhizosphere | VRRVRSRRSLRGRVVNQSPRPGTVKRRNFPVKLAVGRG |
Ga0207661_116394651 | 3300025944 | Corn Rhizosphere | RVRRVRSRRSLYGRVVNQSPRPRTVKRRGFPVKLAVGRR |
Ga0207679_100726451 | 3300025945 | Corn Rhizosphere | VRSRRSLRGRVVKQTPRPGTIKRQNFPVRLKVGRG |
Ga0207679_113973082 | 3300025945 | Corn Rhizosphere | VGNVRRVRSRRSLRGRVVNQTPRPGTIKRRNFPVKLAVGRG |
Ga0207702_107053141 | 3300026078 | Corn Rhizosphere | RVRARRSLRGRVVHQSPRPGTIKRRNFPVKLAVGRG |
Ga0207702_109492592 | 3300026078 | Corn Rhizosphere | RRAHCSVGKVRRVRARRSLRGRVVNQSPRPGTIKRRNFPVKLAIGRR |
Ga0207648_102590841 | 3300026089 | Miscanthus Rhizosphere | HCSVGNVRRVRSRRSLVGRVVSQNPRPGAIKRRNFPVKLAVGRR |
Ga0207674_102147591 | 3300026116 | Corn Rhizosphere | VRARRSLRGRVVRQSPRPGTIKRRNFPVKLAVGRG |
Ga0207981_10513651 | 3300027560 | Soil | HCSVGNVRRVRSRRSLRGRVVNQTPRPGTIKRRNFPVKLGVGRG |
Ga0209811_100506851 | 3300027821 | Surface Soil | GNIRRVRSRRSLRGRVVNQSPRPGTIKRRNFPVKLAVGRS |
Ga0307295_101909531 | 3300028708 | Soil | RAHCSVGNVRRVRSRRSLRGRVVSQNPRPGTIKRRNFPVKLAVGRG |
Ga0307285_100708171 | 3300028712 | Soil | RRAHCSVGNVRRVRSRRSLRGRVVSQNPRPGTIKRRNFPVKLAIGRR |
Ga0307313_102148791 | 3300028715 | Soil | AHCSVGNVRRVRARRSLRGRVVKQSPRPGTVKRRNFPVKLAIGRR |
Ga0307313_102151031 | 3300028715 | Soil | VRRVRSRRSLRGRVVNQSPRPGTIKRRNFPVKLAVGRG |
Ga0307301_102258543 | 3300028719 | Soil | RRAHCTVGNVRRVRSRRSLRGRVVSQNPRPGTIKRRNFPVKLAVGRG |
Ga0307317_100067846 | 3300028720 | Soil | VRSRRSLRGRVVNQSPRPGTIKRRNFPVKLAVGRG |
Ga0307317_101508172 | 3300028720 | Soil | SVGRVRRVRSRRSLRGRVVKQSPRPGTIKRRNFPVKLAVGRS |
Ga0307320_100744662 | 3300028771 | Soil | RVRSRRSLRGRVVSQNPRPGTIKRRNFPVKLAIGRR |
Ga0307282_100611811 | 3300028784 | Soil | RVRRVRARRSLRGRVVNQSPRPGTIKRRNFPVKLAVGRR |
Ga0307287_102962601 | 3300028796 | Soil | CSVGNVRRVRSRRSLRGRVVSQNPRPGTIKRRNFPVKLAVGRR |
Ga0307296_100948791 | 3300028819 | Soil | RVRARRSLRGRVVHQSPRPGTIKRRNFPVKLAIGRR |
Ga0307296_103430382 | 3300028819 | Soil | VRARRSLRGRVVNQSPRPGTIKRRNFPVKLAVGRR |
Ga0307310_102208061 | 3300028824 | Soil | VGRVRRVRARRSLRGRVVNQSPRPATIKRRNFPVKLAVGRG |
⦗Top⦘ |