NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F055074

Metagenome / Metatranscriptome Family F055074

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F055074
Family Type Metagenome / Metatranscriptome
Number of Sequences 139
Average Sequence Length 41 residues
Representative Sequence SVGNVRRVRSRRSLRGRVVNQSPRPGTIKRRNFPVKLAVGRG
Number of Associated Samples 101
Number of Associated Scaffolds 139

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 97.84 %
% of genes from short scaffolds (< 2000 bps) 92.81 %
Associated GOLD sequencing projects 94
AlphaFold2 3D model prediction Yes
3D model pTM-score0.43

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (69.065 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(20.144 % of family members)
Environment Ontology (ENVO) Unclassified
(25.180 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(51.799 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 4.29%    β-sheet: 24.29%    Coil/Unstructured: 71.43%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.43
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 139 Family Scaffolds
PF03030H_PPase 7.91
PF08240ADH_N 4.32
PF00082Peptidase_S8 2.88
PF00293NUDIX 2.16
PF10162G8 2.16
PF02597ThiS 2.16
PF02391MoaE 1.44
PF13418Kelch_4 1.44
PF13415Kelch_3 1.44
PF17164DUF5122 0.72
PF02909TetR_C_1 0.72
PF02423OCD_Mu_crystall 0.72
PF13574Reprolysin_2 0.72
PF13602ADH_zinc_N_2 0.72
PF00535Glycos_transf_2 0.72
PF02801Ketoacyl-synt_C 0.72
PF16884ADH_N_2 0.72
PF02445NadA 0.72
PF07676PD40 0.72
PF13964Kelch_6 0.72
PF01344Kelch_1 0.72
PF04545Sigma70_r4 0.72
PF03793PASTA 0.72
PF07394DUF1501 0.72
PF10041DUF2277 0.72

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 139 Family Scaffolds
COG3808Na+ or H+-translocating membrane pyrophosphataseEnergy production and conversion [C] 7.91
COG1977Molybdopterin synthase sulfur carrier subunit MoaDCoenzyme transport and metabolism [H] 2.16
COG2104Sulfur carrier protein ThiS (thiamine biosynthesis)Coenzyme transport and metabolism [H] 2.16
COG0314Molybdopterin synthase catalytic subunit MoaECoenzyme transport and metabolism [H] 1.44
COG0379Quinolinate synthaseCoenzyme transport and metabolism [H] 0.72
COG1309DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmATranscription [K] 0.72
COG2423Ornithine cyclodeaminase/archaeal alanine dehydrogenase, mu-crystallin familyAmino acid transport and metabolism [E] 0.72


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms69.06 %
UnclassifiedrootN/A30.94 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908045|KansclcFeb2_ConsensusfromContig540981All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium722Open in IMG/M
2170459019|G14TP7Y02GHRXMNot Available545Open in IMG/M
3300000044|ARSoilOldRDRAFT_c029501Not Available504Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_100808184Not Available1040Open in IMG/M
3300000956|JGI10216J12902_103503252Not Available602Open in IMG/M
3300004114|Ga0062593_102853014Not Available552Open in IMG/M
3300005093|Ga0062594_103072853Not Available522Open in IMG/M
3300005164|Ga0066815_10006718All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1307Open in IMG/M
3300005164|Ga0066815_10091462Not Available561Open in IMG/M
3300005168|Ga0066809_10044775All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria977Open in IMG/M
3300005172|Ga0066683_10193997All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1253Open in IMG/M
3300005186|Ga0066676_10308705All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1048Open in IMG/M
3300005329|Ga0070683_100039054All Organisms → cellular organisms → Bacteria4355Open in IMG/M
3300005329|Ga0070683_100041248All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium4245Open in IMG/M
3300005332|Ga0066388_107488833All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300005459|Ga0068867_101701049Not Available591Open in IMG/M
3300005526|Ga0073909_10238868All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium803Open in IMG/M
3300005535|Ga0070684_101051308Not Available765Open in IMG/M
3300005558|Ga0066698_10169540All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1483Open in IMG/M
3300005558|Ga0066698_10231529Not Available1271Open in IMG/M
3300005564|Ga0070664_102103791Not Available536Open in IMG/M
3300005713|Ga0066905_100233879All Organisms → cellular organisms → Bacteria1400Open in IMG/M
3300005713|Ga0066905_100685190All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia878Open in IMG/M
3300005764|Ga0066903_100144928All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3391Open in IMG/M
3300005764|Ga0066903_106979862Not Available586Open in IMG/M
3300006175|Ga0070712_100277735All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1348Open in IMG/M
3300006175|Ga0070712_101056332All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium704Open in IMG/M
3300006358|Ga0068871_101254316All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter696Open in IMG/M
3300006572|Ga0074051_11694153All Organisms → cellular organisms → Bacteria → Terrabacteria group676Open in IMG/M
3300006574|Ga0074056_11658248All Organisms → cellular organisms → Bacteria595Open in IMG/M
3300006575|Ga0074053_11133785All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium652Open in IMG/M
3300006575|Ga0074053_11932178Not Available600Open in IMG/M
3300006576|Ga0074047_11988975Not Available510Open in IMG/M
3300006580|Ga0074049_13149681All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium937Open in IMG/M
3300006604|Ga0074060_11944095All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium534Open in IMG/M
3300006845|Ga0075421_101616804All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria704Open in IMG/M
3300006854|Ga0075425_100550445All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1328Open in IMG/M
3300006854|Ga0075425_101426948All Organisms → cellular organisms → Bacteria783Open in IMG/M
3300006854|Ga0075425_101696086Not Available711Open in IMG/M
3300006854|Ga0075425_102817563Not Available535Open in IMG/M
3300006876|Ga0079217_11014787All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria608Open in IMG/M
3300006881|Ga0068865_100744657All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium841Open in IMG/M
3300006894|Ga0079215_11469074All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium536Open in IMG/M
3300006953|Ga0074063_14174932All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium999Open in IMG/M
3300006953|Ga0074063_14249149Not Available930Open in IMG/M
3300007076|Ga0075435_100885804All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia778Open in IMG/M
3300007076|Ga0075435_101309682All Organisms → cellular organisms → Bacteria634Open in IMG/M
3300009148|Ga0105243_10640535All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1029Open in IMG/M
3300009162|Ga0075423_11730953All Organisms → cellular organisms → Bacteria673Open in IMG/M
3300010041|Ga0126312_10366743Not Available1022Open in IMG/M
3300010043|Ga0126380_11742891All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium561Open in IMG/M
3300010326|Ga0134065_10161646Not Available789Open in IMG/M
3300010359|Ga0126376_13054247All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes517Open in IMG/M
3300010362|Ga0126377_12918647All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium552Open in IMG/M
3300010364|Ga0134066_10376354All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium534Open in IMG/M
3300010373|Ga0134128_11515874All Organisms → cellular organisms → Bacteria738Open in IMG/M
3300010375|Ga0105239_12685575Not Available581Open in IMG/M
3300010398|Ga0126383_11461128All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium773Open in IMG/M
3300010400|Ga0134122_11477391Not Available698Open in IMG/M
3300010403|Ga0134123_12123967Not Available622Open in IMG/M
3300011107|Ga0151490_1206805All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium848Open in IMG/M
3300012507|Ga0157342_1064771All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300012899|Ga0157299_10061283All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria875Open in IMG/M
3300012902|Ga0157291_10114787All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Miltoncostaeales → Miltoncostaeaceae → Miltoncostaea → Miltoncostaea marina754Open in IMG/M
3300012948|Ga0126375_10447055Not Available948Open in IMG/M
3300012955|Ga0164298_10560839All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium776Open in IMG/M
3300012958|Ga0164299_10958589All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium626Open in IMG/M
3300012960|Ga0164301_10895875All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium688Open in IMG/M
3300012960|Ga0164301_11478222All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium559Open in IMG/M
3300012961|Ga0164302_11105226Not Available626Open in IMG/M
3300012961|Ga0164302_11267045Not Available594Open in IMG/M
3300012961|Ga0164302_11271920All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium593Open in IMG/M
3300012988|Ga0164306_11634671Not Available557Open in IMG/M
3300012989|Ga0164305_10083906All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1991Open in IMG/M
3300012989|Ga0164305_11508689All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium596Open in IMG/M
3300014157|Ga0134078_10153343Not Available908Open in IMG/M
3300014326|Ga0157380_10834703All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium942Open in IMG/M
3300014745|Ga0157377_11062135All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium618Open in IMG/M
3300015371|Ga0132258_10109566All Organisms → cellular organisms → Bacteria6531Open in IMG/M
3300015371|Ga0132258_11250087All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1877Open in IMG/M
3300015371|Ga0132258_11363735All Organisms → cellular organisms → Bacteria1791Open in IMG/M
3300015371|Ga0132258_11441414All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1739Open in IMG/M
3300015371|Ga0132258_11680951All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1601Open in IMG/M
3300015372|Ga0132256_100043636Not Available4132Open in IMG/M
3300015372|Ga0132256_101077330All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium918Open in IMG/M
3300015372|Ga0132256_101630741Not Available755Open in IMG/M
3300015373|Ga0132257_100235239All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium2183Open in IMG/M
3300015373|Ga0132257_100350552All Organisms → cellular organisms → Bacteria1784Open in IMG/M
3300015373|Ga0132257_101717178Not Available805Open in IMG/M
3300015373|Ga0132257_102994994All Organisms → cellular organisms → Bacteria615Open in IMG/M
3300015374|Ga0132255_100564976All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1678Open in IMG/M
3300015374|Ga0132255_100813367All Organisms → cellular organisms → Bacteria1393Open in IMG/M
3300015374|Ga0132255_104049919All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium622Open in IMG/M
3300015374|Ga0132255_104296250All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium604Open in IMG/M
3300018031|Ga0184634_10062642All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1564Open in IMG/M
3300018031|Ga0184634_10528091Not Available524Open in IMG/M
3300018072|Ga0184635_10195061All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium808Open in IMG/M
3300018073|Ga0184624_10138508Not Available1063Open in IMG/M
3300018074|Ga0184640_10055832All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1643Open in IMG/M
3300018077|Ga0184633_10334390All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium767Open in IMG/M
3300018081|Ga0184625_10628808All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium523Open in IMG/M
3300018081|Ga0184625_10655510Not Available508Open in IMG/M
3300019884|Ga0193741_1010206All Organisms → cellular organisms → Bacteria2457Open in IMG/M
3300020016|Ga0193696_1112813All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria693Open in IMG/M
3300021078|Ga0210381_10032622All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1475Open in IMG/M
3300021080|Ga0210382_10347431Not Available655Open in IMG/M
3300021510|Ga0222621_1132258All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium531Open in IMG/M
3300022756|Ga0222622_11315684Not Available532Open in IMG/M
3300022901|Ga0247788_1026593All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1028Open in IMG/M
3300025915|Ga0207693_10393451All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1084Open in IMG/M
3300025916|Ga0207663_10531890All Organisms → cellular organisms → Bacteria917Open in IMG/M
3300025920|Ga0207649_11466341Not Available540Open in IMG/M
3300025937|Ga0207669_10805943All Organisms → cellular organisms → Bacteria → Terrabacteria group779Open in IMG/M
3300025944|Ga0207661_10168061Not Available1907Open in IMG/M
3300025944|Ga0207661_10218503All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1683Open in IMG/M
3300025944|Ga0207661_10391580All Organisms → cellular organisms → Bacteria1259Open in IMG/M
3300025944|Ga0207661_11639465All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium588Open in IMG/M
3300025945|Ga0207679_10072645All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium2599Open in IMG/M
3300025945|Ga0207679_11397308All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium642Open in IMG/M
3300026078|Ga0207702_10705314All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia995Open in IMG/M
3300026078|Ga0207702_10949259All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium853Open in IMG/M
3300026089|Ga0207648_10259084All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1552Open in IMG/M
3300026116|Ga0207674_10214759All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1872Open in IMG/M
3300027560|Ga0207981_1051365All Organisms → cellular organisms → Bacteria753Open in IMG/M
3300027821|Ga0209811_10050685All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1419Open in IMG/M
3300028708|Ga0307295_10190953All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium578Open in IMG/M
3300028712|Ga0307285_10070817Not Available893Open in IMG/M
3300028715|Ga0307313_10214879Not Available597Open in IMG/M
3300028715|Ga0307313_10215103All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium597Open in IMG/M
3300028719|Ga0307301_10225854All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium610Open in IMG/M
3300028720|Ga0307317_10006784All Organisms → cellular organisms → Bacteria3402Open in IMG/M
3300028720|Ga0307317_10150817Not Available780Open in IMG/M
3300028771|Ga0307320_10074466Not Available1272Open in IMG/M
3300028784|Ga0307282_10061181All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1697Open in IMG/M
3300028796|Ga0307287_10296260Not Available612Open in IMG/M
3300028819|Ga0307296_10094879All Organisms → cellular organisms → Bacteria1596Open in IMG/M
3300028819|Ga0307296_10343038All Organisms → cellular organisms → Bacteria815Open in IMG/M
3300028824|Ga0307310_10220806All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_68_9901Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil20.14%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil10.07%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere9.35%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment5.76%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere5.76%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.04%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere5.04%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.60%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil3.60%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.88%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere2.88%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere2.88%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.16%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil2.16%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.16%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.16%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.44%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.44%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.44%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.44%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.44%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.72%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.72%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.72%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.72%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.72%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.72%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.72%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.72%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.72%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter0.72%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908045Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011EnvironmentalOpen in IMG/M
2170459019Litter degradation MG4EngineeredOpen in IMG/M
3300000044Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis soil oldHost-AssociatedOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005164Soil and rhizosphere microbial communities from Laval, Canada - mgLACEnvironmentalOpen in IMG/M
3300005168Soil and rhizosphere microbial communities from Laval, Canada - mgLPCEnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006572Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006574Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006575Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006576Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006580Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006604Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006876Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200EnvironmentalOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300006953Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300010041Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104AEnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010364Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011107Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300012507Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610Host-AssociatedOpen in IMG/M
3300012899Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2EnvironmentalOpen in IMG/M
3300012902Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S169-409C-1EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300014157Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300018031Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1EnvironmentalOpen in IMG/M
3300018072Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2EnvironmentalOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300018074Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2EnvironmentalOpen in IMG/M
3300018077Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1EnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300019884Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s2EnvironmentalOpen in IMG/M
3300020016Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1EnvironmentalOpen in IMG/M
3300021078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redoEnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300021510Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coexEnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300022901Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S156-409C-4EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027560Soil and rhizosphere microbial communities from Laval, Canada - mgLPC (SPAdes)EnvironmentalOpen in IMG/M
3300027821Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028708Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152EnvironmentalOpen in IMG/M
3300028712Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139EnvironmentalOpen in IMG/M
3300028715Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203EnvironmentalOpen in IMG/M
3300028719Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182EnvironmentalOpen in IMG/M
3300028720Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357EnvironmentalOpen in IMG/M
3300028771Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028796Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
KansclcFeb2_164019002124908045SoilSVGRVRRVRARRSLRGRVVSQAPRPGTVKRRGFPVKLAVGR
4MG_015953502170459019Switchgrass, Maize And Mischanthus LitterVRSRRSLRGRVVKQTPRPGTIKRRNFPVRLKVGRG
ARSoilOldRDRAFT_02950113300000044Arabidopsis RhizosphereHCAVGRISRVRSRRSLRGRVVKQTPRPGTIKRRNFPVRLSVGRG*
INPhiseqgaiiFebDRAFT_10080818413300000364SoilVRSRRSLRGRVVSQNPRPGAIKRRNFPVRLAVGRL*
JGI10216J12902_10350325233300000956SoilVGQVSRVRSRRSLRGRVVKQTPRPGTIKRRNFPVRLKVGRG*
Ga0062593_10285301413300004114SoilGRVRKARSRRSLRGRVINQSPRPGSLRRRGFPVKLVVGRR*
Ga0062594_10307285313300005093SoilAHCSVGNVRRVRSRRSLRGRVVNQSPRPGTIKRRNFPVRLAVGRG*
Ga0066815_1000671823300005164SoilAHCSVGRVRRARARRSLVGRVVKQTPRPGTIKRRNFPVALVVGRR*
Ga0066815_1009146223300005164SoilAHCSVGNIRRVRSRRSLRGRVVSQNPRPGTIKRRNFPVKLAVGRS*
Ga0066809_1004477533300005168SoilGRVRGVRSKRALRGRVVAQTPRPGAVRRQGFPVKLLVGRR*
Ga0066683_1019399733300005172SoilHCSLGKVRHVRSRRSLRGRVVSQSPRAGSTRRLNFPVMLAVGRG*
Ga0066676_1030870523300005186SoilCSIGRVSRVRSRRSLYGRVVNQAPRPGAIKRRGFPVKLAVGRP*
Ga0070683_10003905413300005329Corn RhizosphereSVGRVTRVRSRRSLRGRVVKQTPRPGTIKRRNFPVRLKVGRG*
Ga0070683_10004124813300005329Corn RhizosphereSVGRVRRVRARRSLRGRVVRQSPRPGTIKRRNFPVKLAVGRG*
Ga0066388_10748883313300005332Tropical Forest SoilCSVGRVRRVRSRRSLRGRVVNQAPRPGTVKRRGFPVSLAVGRG*
Ga0068867_10170104923300005459Miscanthus RhizosphereRAHCSVGNVRRVRSRRSLVGRVVSQNPRPGAIKRRNFPVKLAVGRR*
Ga0073909_1023886823300005526Surface SoilAHCSVGNVRRVRSRRSLRGHVVNQSPRPGTIKRRNFPVKLAVGRG*
Ga0070684_10105130813300005535Corn RhizosphereHCSVGSVRRVISRRSLVGRVVRQSPRPGSIRRRGFPVNLWVGRR*
Ga0066698_1016954013300005558SoilAHCSVGRVRRVRSRRSLWGRVVNQAPRPGAIRRQGFPVKLAVGRS*
Ga0066698_1023152913300005558SoilSVGRVRRARARRSLRGRVVRQTPRPGTIRRRGFPVALVVGRR*
Ga0070664_10210379123300005564Corn RhizosphereGQVSRVRSRRSLRGRVVKQTPRPGTIKRQNFPVRLKVGRG*
Ga0066905_10023387913300005713Tropical Forest SoilRAHCTVGRVSRVRSRRSLRGRVVRQIPRPGTIKRRNFPVRLSVGRG*
Ga0066905_10068519023300005713Tropical Forest SoilVGRVRRVVSRRSLRGRVVSQSPRPGAVRRRGFPVSLRVGRG*
Ga0066903_10014492853300005764Tropical Forest SoilGRVRRVRARRSLRGRVVNQSPRPGTIKRRNFPVKLAIGRR*
Ga0066903_10697986223300005764Tropical Forest SoilVRARRSLRGRVVSQNPRPGAVKRRNFPVKLAIGRL*
Ga0070712_10027773513300006175Corn, Switchgrass And Miscanthus RhizosphereRRARARRSLRGRIVKQTPRPGTIKRRNFPVALVVGR*
Ga0070712_10105633223300006175Corn, Switchgrass And Miscanthus RhizosphereSVGNVRRVRSRRSLRGRVVNQSPRPGTIKRRNFPVKLAVGRG*
Ga0068871_10125431623300006358Miscanthus RhizosphereCSVGNVRRVRSRRSLRGRVVNQSPRPGTIKRRNFPVRLKVGRG*
Ga0074051_1169415313300006572SoilCSVGRVRRVRARRSLRGRVVNQSPRPGTIKRRNFPVKLAVGRR*
Ga0074056_1165824813300006574SoilHCSVGNVRRVRSRRSLRGRVVNQSPRPGAIKRRNFPVKLAVGRG*
Ga0074053_1113378523300006575SoilRRARRSLRGRVVNQVPRPGTIRRRGFPVSLAIGRR*
Ga0074053_1193217823300006575SoilRVRARRSLRGRVVNQSPRPGTVKRRNSPVKLAVGRP*
Ga0074047_1198897513300006576SoilCSVGRVRRVRSRRSLRGRVVNQAPRPGTIKRRNFPVKLAVGRG*
Ga0074049_1314968113300006580SoilAAHCSVGQIRRARARRSLRGRVVNQSPRPGTIKRRNFPVRLVVGRR*
Ga0074060_1194409523300006604SoilGRVRRVRARRSLRGRVVNQSPRPGTIKRRNFPVKLAVGRR*
Ga0075421_10161680413300006845Populus RhizosphereRANCRVGTVRRVRSRRSLRGRVVAQNPRPGAIRRAGFPVNLRVGRG*
Ga0075425_10055044513300006854Populus RhizosphereAHCSVGNVRRVRSRRSLRGRVVNQAPRPGTVKRRNFPVKLAVGRG*
Ga0075425_10142694813300006854Populus RhizosphereSVGNVRRVRSRRSLRGRVVNQSPRPGTVKRRNFPVKLAIGRR*
Ga0075425_10169608623300006854Populus RhizosphereVRSRRSLRGRVVNQNPRPGSIRRRGFPVNLAIGRR*
Ga0075425_10281756323300006854Populus RhizosphereRSRRSLRGRVVSQNPRPGTIKRRNFPVKLAVGRS*
Ga0079217_1101478733300006876Agricultural SoilRVGTVRRVRSRRQLRGRVVGQSPRGGAVRRVGFRVNLRVGRG*
Ga0068865_10074465723300006881Miscanthus RhizosphereGNVRRVRSRRSLRGRVVSQNPRPGTIKRRNFPVKLAVGRS*
Ga0079215_1146907413300006894Agricultural SoilRRCRVGTIRRVRSRRNRIGRVVGQSPRGGAVRRVGFRVNLRVGRR*
Ga0074063_1417493223300006953SoilVGRVRRARARRSLRGRVVNQSPRPGTIKRRNFPVKLVVGRR*
Ga0074063_1424914913300006953SoilNVRRVRSRRSLVGRVVSQNPRPGAIKRRNFPVKLAVGRR*
Ga0075435_10088580413300007076Populus RhizosphereNVRRVRSRRSLRGRVVNQSPRPGTVKRRNFPVKLAVGRG*
Ga0075435_10130968213300007076Populus RhizosphereRVRSRRSLRGRVVNQAPRPGTVKRRNFPVKLAVGRG*
Ga0105243_1064053523300009148Miscanthus RhizosphereVRARRSLRGRVVNQSPRPGTIKRRNFPVKLAVGRL*
Ga0075423_1173095323300009162Populus RhizosphereRVRARRSLRGRVVNQSPRPGTIKRRNFPVKLAVGRP*
Ga0126312_1036674323300010041Serpentine SoilVGTVRRVRTRRSLRGRVVGQSPRPGAVRRVGFPVNLRVGRG*
Ga0126380_1174289123300010043Tropical Forest SoilAHCSVGRIRRVAARRSLRGRVVNQSPRPGTVKRRGFPVRMAVGR*
Ga0134065_1016164623300010326Grasslands SoilRRVRSRRSLRGRVVNQAPRPGTIKRRGFPVKLAVGRG*
Ga0126376_1305424723300010359Tropical Forest SoilVRRVRARRSLRGRVVNQSPRPGTIKRRNFPVKLAIGRR*
Ga0126377_1291864723300010362Tropical Forest SoilVGRIRRVAARRSLRGRVVNQSPRPGTVKRRGFPVKMAVGR*
Ga0134066_1037635423300010364Grasslands SoilVRSRRSLRGRVVNQAPRPGTIKRRGFPVKLAVGRG*
Ga0134128_1151587413300010373Terrestrial SoilRAHCSVGSVRRGLSRRSLVGRVVKQTPGPGALRRRGFPVNLVVGRR*
Ga0105239_1268557523300010375Corn RhizosphereIRRVRSKHSLRGRVVKQSPRPGTIKRRNFPVSLALGRG*
Ga0126383_1146112823300010398Tropical Forest SoilCSVGNVRRVRSRRSLRGRVVSQKPRPGSVKRRNFPVKLAIGRS*
Ga0134122_1147739113300010400Terrestrial SoilHCSVGNVRRVRSRRSLVGRVVSQNPRPGAIKRRNFPVKLAVGRR*
Ga0134123_1212396713300010403Terrestrial SoilCSVGNVRRVRSRRSLVGRVVSQNPRPGAIKRRNFPVKLAVGRR*
Ga0151490_120680513300011107SoilAHCSVGNVRRVRSRRSLRGRVVSQNPRPGTIKRRNFPVKLAVGRS*
Ga0157342_106477113300012507Arabidopsis RhizosphereRRVRSRRSLRGRVVSQNPRPGTIKRRNFPVKLAVGRS*
Ga0157299_1006128313300012899SoilVRSRRTLRGRVVSQSPRVGAIKRRNFPVSLAVGRG*
Ga0157291_1011478723300012902SoilVGRVRRVRSRRALRSRVVGQSPRAGAIKRRGFPVSLLVGRG*
Ga0126375_1044705513300012948Tropical Forest SoilHCTVGRVRRQRSRRQLVGRVVKQTPRAGALKRRGFPVALVVGRR*
Ga0164298_1056083923300012955SoilGQVRRVRSRRSLRGRVVNQSPRPGTIKRRNFPVRLAVGRG*
Ga0164299_1095858923300012958SoilHCSVGRVRRVRARRSLRGRVVNQSPRPGTIKRRNFPVKLAVGRL*
Ga0164301_1089587513300012960SoilHCSVGRVRRVRSRRSLRGRVVNQSPRPGTIKRRNFPVKLAVGRG*
Ga0164301_1147822213300012960SoilHCSVGNVRRVRSRRSLRGHVVNQSPRPGTIKRRNFPVKLAVGRG*
Ga0164302_1110522623300012961SoilRVRRARARRSLVGRVVKQTPRPGTIKRRNFPVALVVGRR*
Ga0164302_1126704523300012961SoilSVGQVRRVRSKRSLRGRVVNQSPRPGAVRRVNFPVKLAVGRG*
Ga0164302_1127192013300012961SoilVGQVRRVRSRRSLRGRVVNQSPRPGTIKRRNFPVKLAVGRG*
Ga0164307_1078622813300012987SoilHCSVGRIRRAHARRSLRGRVVNQSPRPGTIKRRNFPVKLVVGRR*
Ga0164306_1163467113300012988SoilVRSRRSLRGRVVNQSPPPGTVKRRNFPVKLAVGRG*
Ga0164305_1008390633300012989SoilVGNVRRVRARRSLRGRVVNQSPRPGTIKRRNFPVKLAVGRS*
Ga0164305_1150868913300012989SoilGNVRRVRSRRSLRGRVVNQSPRPGTIKRRNFPVKLAVGRP*
Ga0134078_1015334323300014157Grasslands SoilGRVRRVGARRSLRGRVVNQSPRPGTIKRRNFPVKLAIGRR*
Ga0157380_1083470313300014326Switchgrass RhizosphereRAAHCSVGNVRRVRSRRSLRGRVVNQSPRPGTIKRRNFPVRLAVGRL*
Ga0157377_1106213533300014745Miscanthus RhizosphereSVGNVRRVRSRRSLSGRVVSQSPRPSALRRRGFPVELAVGRR*
Ga0132258_1010956633300015371Arabidopsis RhizosphereRRVRARRSLRGRVVNQSPRPGTVKRRNFPVKLAIGRR*
Ga0132258_1125008713300015371Arabidopsis RhizosphereNVRRVRSRRSLRGRVVNQNPRPGTVKRRNFPVKLAVGRG*
Ga0132258_1136373523300015371Arabidopsis RhizosphereCSVGNVRRVRSRRSLRGRVVSQNPRPGVIKRRNFPVKLAIGRS*
Ga0132258_1144141413300015371Arabidopsis RhizosphereTRVRSRRSLRGRVVKQTPRAGTVKRRNFPVALKVGRS*
Ga0132258_1168095133300015371Arabidopsis RhizosphereHCSVGRVTRVRSRRSLRGRVVKQTPRPGTIKRRNFPVALKVGRG*
Ga0132256_10004363623300015372Arabidopsis RhizosphereVGRIRRVRARRSLRGRVVNQSPRPGTIKRRNFPVKLAIGRR*
Ga0132256_10107733023300015372Arabidopsis RhizosphereSVGRIRRVRARRSLRGRVVNQSPRPGTIKRRNFPVKLAIGRR*
Ga0132256_10163074113300015372Arabidopsis RhizosphereGTVRRVRTRRSLRGRVVGQNPRPGAIRARGFHVNLRVGRR*
Ga0132257_10023523923300015373Arabidopsis RhizosphereIRRVRARRSLRGRVVNQSPRPGTIKRRNFPVKLAIGRR*
Ga0132257_10035055243300015373Arabidopsis RhizosphereVGHVRRVRSRRSLRGRVVSQNPRPGVIKRRNFPVKLAIGRS*
Ga0132257_10171717823300015373Arabidopsis RhizosphereCSVGRVRRVRARRSLRGRVVNQSPRPGTVKRRNFPVKLAIGRR*
Ga0132257_10299499423300015373Arabidopsis RhizosphereVGNVRRVRSRRSLRGRVVNQNPRPGTVKRRNFPVKLAVGRG*
Ga0132255_10056497613300015374Arabidopsis RhizosphereAHCSVGKVRRVRARRSLCGRVVSQSPKPRVVKRRNFPVKLAIGRR*
Ga0132255_10081336733300015374Arabidopsis RhizosphereAHCAVGRVRRARARRSLVGRVVKQTPRPGTIKRRNFPVALVVGRR*
Ga0132255_10404991913300015374Arabidopsis RhizosphereRRVRSRRSLRGRVVNQSPRPGTIKRRNFPVKLAVGRG*
Ga0132255_10429625023300015374Arabidopsis RhizosphereGRVTRVRSRRSLRGRVVKQTPRPGTIKRRNFPVKLKVGRG*
Ga0184634_1006264233300018031Groundwater SedimentVGNVRRVRSRRSLRGRVVSQNPRPGTIKRRNFPVKLAVGRG
Ga0184634_1052809113300018031Groundwater SedimentAHCTVGNVRRVRSRRSLRGRVVSQNPRPGTIKRRNFPVKLAVGRR
Ga0184635_1019506113300018072Groundwater SedimentHCSVGRVRRVRARRSLRGRVVNQSPRPGTIKRRNFPVKLAVGRR
Ga0184624_1013850823300018073Groundwater SedimentRRVRARRSLRGRVVSQNPRPGAIKRRNFPVKLAIGRR
Ga0184640_1005583213300018074Groundwater SedimentVGNVRRVRARRSLRGRVVNQSPRPGTIKRRNFPVKLAVGRP
Ga0184633_1033439023300018077Groundwater SedimentAAHCSVGNVRRVRSRRSLRGRVVNQSPRPGTIKRRNFPVRLAVGRL
Ga0184625_1062880813300018081Groundwater SedimentRRAHCSVGNVRRVRSRRSLRGRVVSQNPRPGTIKRRNFPVKLAVGRG
Ga0184625_1065551013300018081Groundwater SedimentVRRVRARRSLRGRVVNQAPRPGTIRRRGFPVNLAVGRR
Ga0193741_101020643300019884SoilKVRKRRCSVGRVRRIRVRRSLRGKVIGQSLRAGTVKRRNVPVKLSVGSR
Ga0193696_111281313300020016SoilRVRSRRSLRGRVVNQAPRPGTIKRRNFPVKLAVGRS
Ga0210381_1003262213300021078Groundwater SedimentVRSRRSLRGRVVNQSPRPGTIKRQNFPVKLAVGRV
Ga0210382_1034743113300021080Groundwater SedimentAAHCSVGRVRRVRSRRSLRGRVVKQSPRPGTIKRRNFPVKLAVGRS
Ga0222621_113225813300021510Groundwater SedimentHCSVGNVRRVRSRRSLRGRVVNQSPRPGTIKRRNFPVRLAVGRL
Ga0222622_1131568413300022756Groundwater SedimentVRARRSLRGRVVHQSPRPGTIKRRNFPVKLAIGRR
Ga0247788_102659323300022901SoilCSVGRVRHVRSRRTLRGRVVSQSPRVGAIKRRNFPVSLAVGRG
Ga0207693_1039345123300025915Corn, Switchgrass And Miscanthus RhizosphereSVGNVRRVRSRRSLRGRVVSQNPRPGTIKRRNFPVKLAVGRP
Ga0207663_1053189033300025916Corn, Switchgrass And Miscanthus RhizosphereSVGRVRRVRARRSLRGRVVNQSPRPGTIKRRNFPVKLAIGRR
Ga0207649_1146634123300025920Corn RhizosphereAAHCSVGRVRHVRSRRSLRGRVVNQSPRPGTIKRRNFPVKLAVGRS
Ga0207669_1080594313300025937Miscanthus RhizosphereSVGNVRRVRSRRSLRGRVVNQSPRPGTIKRRNFPVRLAVGRG
Ga0207661_1016806123300025944Corn RhizosphereHCSVGRVRRVRARRSLRGRVVRQSPRPGTIKRRNFPVKLAVGRG
Ga0207661_1021850333300025944Corn RhizosphereSVGRVTRVRSRRSLRGRVVKQTPRPGTIKRRNFPVRLKVGRG
Ga0207661_1039158013300025944Corn RhizosphereVRRVRSRRSLRGRVVNQSPRPGTVKRRNFPVKLAVGRG
Ga0207661_1163946513300025944Corn RhizosphereRVRRVRSRRSLYGRVVNQSPRPRTVKRRGFPVKLAVGRR
Ga0207679_1007264513300025945Corn RhizosphereVRSRRSLRGRVVKQTPRPGTIKRQNFPVRLKVGRG
Ga0207679_1139730823300025945Corn RhizosphereVGNVRRVRSRRSLRGRVVNQTPRPGTIKRRNFPVKLAVGRG
Ga0207702_1070531413300026078Corn RhizosphereRVRARRSLRGRVVHQSPRPGTIKRRNFPVKLAVGRG
Ga0207702_1094925923300026078Corn RhizosphereRRAHCSVGKVRRVRARRSLRGRVVNQSPRPGTIKRRNFPVKLAIGRR
Ga0207648_1025908413300026089Miscanthus RhizosphereHCSVGNVRRVRSRRSLVGRVVSQNPRPGAIKRRNFPVKLAVGRR
Ga0207674_1021475913300026116Corn RhizosphereVRARRSLRGRVVRQSPRPGTIKRRNFPVKLAVGRG
Ga0207981_105136513300027560SoilHCSVGNVRRVRSRRSLRGRVVNQTPRPGTIKRRNFPVKLGVGRG
Ga0209811_1005068513300027821Surface SoilGNIRRVRSRRSLRGRVVNQSPRPGTIKRRNFPVKLAVGRS
Ga0307295_1019095313300028708SoilRAHCSVGNVRRVRSRRSLRGRVVSQNPRPGTIKRRNFPVKLAVGRG
Ga0307285_1007081713300028712SoilRRAHCSVGNVRRVRSRRSLRGRVVSQNPRPGTIKRRNFPVKLAIGRR
Ga0307313_1021487913300028715SoilAHCSVGNVRRVRARRSLRGRVVKQSPRPGTVKRRNFPVKLAIGRR
Ga0307313_1021510313300028715SoilVRRVRSRRSLRGRVVNQSPRPGTIKRRNFPVKLAVGRG
Ga0307301_1022585433300028719SoilRRAHCTVGNVRRVRSRRSLRGRVVSQNPRPGTIKRRNFPVKLAVGRG
Ga0307317_1000678463300028720SoilVRSRRSLRGRVVNQSPRPGTIKRRNFPVKLAVGRG
Ga0307317_1015081723300028720SoilSVGRVRRVRSRRSLRGRVVKQSPRPGTIKRRNFPVKLAVGRS
Ga0307320_1007446623300028771SoilRVRSRRSLRGRVVSQNPRPGTIKRRNFPVKLAIGRR
Ga0307282_1006118113300028784SoilRVRRVRARRSLRGRVVNQSPRPGTIKRRNFPVKLAVGRR
Ga0307287_1029626013300028796SoilCSVGNVRRVRSRRSLRGRVVSQNPRPGTIKRRNFPVKLAVGRR
Ga0307296_1009487913300028819SoilRVRARRSLRGRVVHQSPRPGTIKRRNFPVKLAIGRR
Ga0307296_1034303823300028819SoilVRARRSLRGRVVNQSPRPGTIKRRNFPVKLAVGRR
Ga0307310_1022080613300028824SoilVGRVRRVRARRSLRGRVVNQSPRPATIKRRNFPVKLAVGRG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.