NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F055043

Metagenome / Metatranscriptome Family F055043

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F055043
Family Type Metagenome / Metatranscriptome
Number of Sequences 139
Average Sequence Length 45 residues
Representative Sequence KAQLEIEPLTAAEIETLLAKAYGAPRTIVQKAAALVEPSGRAP
Number of Associated Samples 117
Number of Associated Scaffolds 139

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.46 %
% of genes near scaffold ends (potentially truncated) 96.40 %
% of genes from short scaffolds (< 2000 bps) 89.93 %
Associated GOLD sequencing projects 114
AlphaFold2 3D model prediction Yes
3D model pTM-score0.45

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (92.086 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(30.935 % of family members)
Environment Ontology (ENVO) Unclassified
(38.849 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(41.007 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Fibrous Signal Peptide: No Secondary Structure distribution: α-helix: 32.39%    β-sheet: 0.00%    Coil/Unstructured: 67.61%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.45
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 139 Family Scaffolds
PF03401TctC 51.08
PF13343SBP_bac_6 13.67
PF01522Polysacc_deac_1 2.16
PF01557FAA_hydrolase 2.16
PF00528BPD_transp_1 1.44
PF01925TauE 0.72
PF00596Aldolase_II 0.72
PF02900LigB 0.72
PF00135COesterase 0.72
PF03471CorC_HlyC 0.72
PF00903Glyoxalase 0.72
PF04606Ogr_Delta 0.72
PF00156Pribosyltran 0.72

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 139 Family Scaffolds
COG3181Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctCEnergy production and conversion [C] 51.08
COG0726Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 familyCell wall/membrane/envelope biogenesis [M] 2.16
COG0730Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 familyInorganic ion transport and metabolism [P] 0.72
COG2272Carboxylesterase type BLipid transport and metabolism [I] 0.72

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms92.09 %
UnclassifiedrootN/A7.91 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2228664021|ICCgaii200_c0729359All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium1004Open in IMG/M
3300000858|JGI10213J12805_10162273All Organisms → cellular organisms → Bacteria → Proteobacteria510Open in IMG/M
3300000955|JGI1027J12803_106357643All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria780Open in IMG/M
3300001455|JGI11848J15208_101249All Organisms → cellular organisms → Bacteria → Proteobacteria664Open in IMG/M
3300004479|Ga0062595_100749908All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium794Open in IMG/M
3300005332|Ga0066388_102905260All Organisms → cellular organisms → Bacteria → Proteobacteria876Open in IMG/M
3300005332|Ga0066388_106454200All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria591Open in IMG/M
3300005332|Ga0066388_107315683Not Available554Open in IMG/M
3300005439|Ga0070711_100907918All Organisms → cellular organisms → Bacteria752Open in IMG/M
3300005459|Ga0068867_100180637All Organisms → cellular organisms → Bacteria → Proteobacteria1677Open in IMG/M
3300005545|Ga0070695_100047310All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2747Open in IMG/M
3300005548|Ga0070665_100608753All Organisms → cellular organisms → Bacteria1105Open in IMG/M
3300005719|Ga0068861_100117627All Organisms → cellular organisms → Bacteria → Proteobacteria2139Open in IMG/M
3300005764|Ga0066903_103613070All Organisms → cellular organisms → Bacteria → Proteobacteria833Open in IMG/M
3300005764|Ga0066903_106840182All Organisms → cellular organisms → Bacteria → Proteobacteria592Open in IMG/M
3300006028|Ga0070717_10320283All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1381Open in IMG/M
3300006028|Ga0070717_11347790Not Available648Open in IMG/M
3300006049|Ga0075417_10568829All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium574Open in IMG/M
3300006058|Ga0075432_10173757All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium839Open in IMG/M
3300006175|Ga0070712_101950877All Organisms → cellular organisms → Bacteria → Proteobacteria514Open in IMG/M
3300006844|Ga0075428_101910793All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium616Open in IMG/M
3300006881|Ga0068865_100074602All Organisms → cellular organisms → Bacteria → Proteobacteria2416Open in IMG/M
3300006903|Ga0075426_10631658All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria801Open in IMG/M
3300006953|Ga0074063_10098096All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1146Open in IMG/M
3300009137|Ga0066709_103721623All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria553Open in IMG/M
3300009162|Ga0075423_12079253Not Available616Open in IMG/M
3300010043|Ga0126380_10795478All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria773Open in IMG/M
3300010047|Ga0126382_10809446All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae800Open in IMG/M
3300010048|Ga0126373_10257865All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1720Open in IMG/M
3300010048|Ga0126373_10848637All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria976Open in IMG/M
3300010359|Ga0126376_10274682All Organisms → cellular organisms → Bacteria → Proteobacteria1449Open in IMG/M
3300010360|Ga0126372_10134754All Organisms → cellular organisms → Bacteria → Proteobacteria1940Open in IMG/M
3300010360|Ga0126372_10804451All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria931Open in IMG/M
3300010361|Ga0126378_12433884All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria598Open in IMG/M
3300010361|Ga0126378_12588130All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria580Open in IMG/M
3300010373|Ga0134128_11293432All Organisms → cellular organisms → Bacteria → Proteobacteria804Open in IMG/M
3300010376|Ga0126381_102652274All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria717Open in IMG/M
3300010376|Ga0126381_104281516All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria553Open in IMG/M
3300010376|Ga0126381_104586663All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria533Open in IMG/M
3300010398|Ga0126383_11269433All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria826Open in IMG/M
3300010398|Ga0126383_12132707All Organisms → cellular organisms → Bacteria647Open in IMG/M
3300012208|Ga0137376_10959436All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales733Open in IMG/M
3300012209|Ga0137379_10807203All Organisms → cellular organisms → Bacteria843Open in IMG/M
3300012908|Ga0157286_10008194All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1961Open in IMG/M
3300012948|Ga0126375_10987723All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria684Open in IMG/M
3300012971|Ga0126369_12614295All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria589Open in IMG/M
3300014969|Ga0157376_13140969All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales500Open in IMG/M
3300015374|Ga0132255_101469307All Organisms → cellular organisms → Bacteria → Proteobacteria1031Open in IMG/M
3300016294|Ga0182041_10416128All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1147Open in IMG/M
3300016319|Ga0182033_10282241All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1363Open in IMG/M
3300016319|Ga0182033_10940361All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria767Open in IMG/M
3300016341|Ga0182035_10114466All Organisms → cellular organisms → Bacteria → Proteobacteria2005Open in IMG/M
3300016445|Ga0182038_10843367All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria805Open in IMG/M
3300016445|Ga0182038_11177622All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium683Open in IMG/M
3300018028|Ga0184608_10008690All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3398Open in IMG/M
3300018028|Ga0184608_10506486All Organisms → cellular organisms → Bacteria → Proteobacteria516Open in IMG/M
3300018067|Ga0184611_1311979All Organisms → cellular organisms → Bacteria → Proteobacteria545Open in IMG/M
3300018433|Ga0066667_11529893All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria591Open in IMG/M
3300018482|Ga0066669_10625843All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium945Open in IMG/M
3300020000|Ga0193692_1035631All Organisms → cellular organisms → Bacteria → Proteobacteria1154Open in IMG/M
3300021363|Ga0193699_10149433All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales961Open in IMG/M
3300025315|Ga0207697_10491146All Organisms → cellular organisms → Bacteria → Proteobacteria543Open in IMG/M
3300025893|Ga0207682_10087587All Organisms → cellular organisms → Bacteria → Proteobacteria1345Open in IMG/M
3300025910|Ga0207684_10513083Not Available1027Open in IMG/M
3300025916|Ga0207663_10748844All Organisms → cellular organisms → Bacteria776Open in IMG/M
3300025917|Ga0207660_11148901All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium632Open in IMG/M
3300025922|Ga0207646_11324508All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria628Open in IMG/M
3300025981|Ga0207640_11232144All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium666Open in IMG/M
3300026035|Ga0207703_10051960All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3325Open in IMG/M
3300026508|Ga0257161_1105270All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria588Open in IMG/M
3300027288|Ga0208525_1015620All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria857Open in IMG/M
3300027381|Ga0208983_1033704All Organisms → cellular organisms → Bacteria → Proteobacteria1002Open in IMG/M
3300027383|Ga0209213_1060507All Organisms → cellular organisms → Bacteria → Proteobacteria710Open in IMG/M
3300027480|Ga0208993_1011126All Organisms → cellular organisms → Bacteria → Proteobacteria1551Open in IMG/M
3300027616|Ga0209106_1014854All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1660Open in IMG/M
3300027846|Ga0209180_10060800All Organisms → cellular organisms → Bacteria → Proteobacteria2100Open in IMG/M
3300027862|Ga0209701_10233652All Organisms → cellular organisms → Bacteria → Proteobacteria1082Open in IMG/M
3300027866|Ga0209813_10499041All Organisms → cellular organisms → Bacteria → Proteobacteria505Open in IMG/M
3300028380|Ga0268265_10541256Not Available1104Open in IMG/M
3300028536|Ga0137415_11455233Not Available509Open in IMG/M
3300028710|Ga0307322_10134298All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium652Open in IMG/M
3300028710|Ga0307322_10213724Not Available528Open in IMG/M
3300028714|Ga0307309_10178250All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium550Open in IMG/M
3300028768|Ga0307280_10271696All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium613Open in IMG/M
3300028796|Ga0307287_10206516All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium745Open in IMG/M
3300028810|Ga0307294_10273812All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium605Open in IMG/M
3300028824|Ga0307310_10232566All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium880Open in IMG/M
3300031543|Ga0318516_10106875All Organisms → cellular organisms → Bacteria → Proteobacteria1585Open in IMG/M
3300031543|Ga0318516_10571290All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria646Open in IMG/M
3300031545|Ga0318541_10286469All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria917Open in IMG/M
3300031545|Ga0318541_10537622All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria654Open in IMG/M
3300031546|Ga0318538_10372564All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria772Open in IMG/M
3300031561|Ga0318528_10105045All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1484Open in IMG/M
3300031564|Ga0318573_10422677All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria716Open in IMG/M
3300031668|Ga0318542_10622289All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria563Open in IMG/M
3300031680|Ga0318574_10322087All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria899Open in IMG/M
3300031681|Ga0318572_10034486All Organisms → cellular organisms → Bacteria → Proteobacteria2654Open in IMG/M
3300031713|Ga0318496_10059613All Organisms → cellular organisms → Bacteria → Proteobacteria1993Open in IMG/M
3300031713|Ga0318496_10119644All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1425Open in IMG/M
3300031718|Ga0307474_11030508All Organisms → cellular organisms → Bacteria651Open in IMG/M
3300031719|Ga0306917_10642356All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria834Open in IMG/M
3300031723|Ga0318493_10462482All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria698Open in IMG/M
3300031724|Ga0318500_10437193All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria653Open in IMG/M
3300031747|Ga0318502_10295725All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria951Open in IMG/M
3300031764|Ga0318535_10006108All Organisms → cellular organisms → Bacteria → Proteobacteria4025Open in IMG/M
3300031764|Ga0318535_10334183All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria677Open in IMG/M
3300031778|Ga0318498_10081373All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1461Open in IMG/M
3300031781|Ga0318547_10125876All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1489Open in IMG/M
3300031795|Ga0318557_10075290All Organisms → cellular organisms → Bacteria → Proteobacteria1464Open in IMG/M
3300031805|Ga0318497_10016100All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3557Open in IMG/M
3300031833|Ga0310917_10217164All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1281Open in IMG/M
3300031833|Ga0310917_10405776All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium926Open in IMG/M
3300031846|Ga0318512_10392921All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria696Open in IMG/M
3300031880|Ga0318544_10446447All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria503Open in IMG/M
3300031893|Ga0318536_10069901All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae1725Open in IMG/M
3300031894|Ga0318522_10351100All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria558Open in IMG/M
3300031912|Ga0306921_11102890All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria889Open in IMG/M
3300031912|Ga0306921_11257611All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria821Open in IMG/M
3300031942|Ga0310916_10100798All Organisms → cellular organisms → Bacteria → Proteobacteria2320Open in IMG/M
3300031946|Ga0310910_10615161All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium861Open in IMG/M
3300031947|Ga0310909_10115276All Organisms → cellular organisms → Bacteria → Proteobacteria2175Open in IMG/M
3300031954|Ga0306926_10631338All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1305Open in IMG/M
3300031981|Ga0318531_10040715All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1944Open in IMG/M
3300031981|Ga0318531_10424841All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria601Open in IMG/M
3300032001|Ga0306922_10349011All Organisms → cellular organisms → Bacteria → Proteobacteria1587Open in IMG/M
3300032008|Ga0318562_10409599All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria788Open in IMG/M
3300032010|Ga0318569_10084460All Organisms → cellular organisms → Bacteria → Proteobacteria1418Open in IMG/M
3300032025|Ga0318507_10170355All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria935Open in IMG/M
3300032025|Ga0318507_10494237Not Available532Open in IMG/M
3300032041|Ga0318549_10578680All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria504Open in IMG/M
3300032054|Ga0318570_10080716All Organisms → cellular organisms → Bacteria → Proteobacteria1398Open in IMG/M
3300032055|Ga0318575_10066814All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1687Open in IMG/M
3300032064|Ga0318510_10395834Not Available588Open in IMG/M
3300032065|Ga0318513_10154696All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1095Open in IMG/M
3300032076|Ga0306924_11237821All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria805Open in IMG/M
3300032090|Ga0318518_10192109All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1044Open in IMG/M
3300032205|Ga0307472_100377064All Organisms → cellular organisms → Bacteria → Proteobacteria1176Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil30.94%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil11.51%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil8.63%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil7.19%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.76%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.60%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil3.60%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil3.60%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.60%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.16%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.16%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.16%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.16%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.44%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.44%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.44%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.72%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.72%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.72%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.72%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.72%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.72%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.72%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere0.72%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.72%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.72%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.72%
Attine Ant Fungus GardensHost-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens0.72%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2228664021Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000858Soil microbial communities from Great Prairies - Wisconsin Native Prairie soilEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001455Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M2EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006058Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1Host-AssociatedOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006953Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300012089Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ008 MetaGHost-AssociatedOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012908Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300018002Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_40EnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018067Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coexEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300020000Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a1EnvironmentalOpen in IMG/M
3300021363Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2EnvironmentalOpen in IMG/M
3300025315Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)Host-AssociatedOpen in IMG/M
3300025893Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026508Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-AEnvironmentalOpen in IMG/M
3300027288Soil and rhizosphere microbial communities from Laval, Canada - mgHMC (SPAdes)EnvironmentalOpen in IMG/M
3300027381Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027383Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027480Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027616Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027862Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027866Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes)Host-AssociatedOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028710Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380EnvironmentalOpen in IMG/M
3300028714Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196EnvironmentalOpen in IMG/M
3300028768Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119EnvironmentalOpen in IMG/M
3300028796Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141EnvironmentalOpen in IMG/M
3300028810Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031880Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031894Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032025Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032064Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17EnvironmentalOpen in IMG/M
3300032065Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
ICCgaii200_072935922228664021SoilEFRADATKAQLEIEPLTATEIDKLLTTAYGAPKSIVQKAAALVEPSSRSP
JGI10213J12805_1016227313300000858SoilTAGEIEQLLAAAYGAPKTIVQKAAALVEPSSRAP*
JGI1027J12803_10635764323300000955SoilEIDPLAASEIETLLARAYGAPKAIVQKAAAFVEPAGRAP*
JGI11848J15208_10124913300001455Forest SoilRSDAAKAQLEIEPLTADEIDRLLATAYSAPKPIVQKAAALVEPSNRAP*
Ga0062595_10074990813300004479SoilATKAQLEIEPLTATEIDKLLATAYGAPKSIVQKAAALVEPSSRSP*
Ga0066388_10290526013300005332Tropical Forest SoilMRDADFRAEAERAQLEIEPLQAGAIEELLAKAYAAPAPIVAQAAALVDPSAHKH*
Ga0066388_10645420023300005332Tropical Forest SoilEFRADADKAQLEIEPLTAAEIDTLLAKAYGAPKAIVQKAAALIEPPGRAP*
Ga0066388_10731568313300005332Tropical Forest SoilLADDEFRADAQKAQLEIEPLAAAEIETLLATAYGTPNAIVQRAAALVEPSGRTP*
Ga0070711_10090791813300005439Corn, Switchgrass And Miscanthus RhizosphereRTQLEIDPLAASEIETLLARAYGAPKATVQKAAAFVEPAGRAP*
Ga0068867_10018063733300005459Miscanthus RhizosphereDAEFRADAAKAQLEIEPLTAAEIDALLATAYGARKPIVQKAAALVEPSVRAP*
Ga0070695_10004731053300005545Corn, Switchgrass And Miscanthus RhizosphereDAEFRADAARAQLEIEPLTAAEIDGLLATAYGAPKPIVQKAAALVEPSVRAP*
Ga0070665_10060875313300005548Switchgrass RhizosphereDAEFRADAAKAQLEIEPLTAAEIDALLATAYGAPKPIVQKAAALVEPSVRAP*
Ga0068861_10011762713300005719Switchgrass RhizosphereFRADAAKAQLEIEPLTAAEIDALLATAYGARKPIVQKAAALVEPSVRAP*
Ga0066903_10361307023300005764Tropical Forest SoilEIEPLEAGEIETLLAKAYSAPKPIVQKAAALVEPSARAP*
Ga0066903_10684018223300005764Tropical Forest SoilPLTAREIETFLATAYGAPRTTVQKAAALVEPSARAP*
Ga0070717_1032028313300006028Corn, Switchgrass And Miscanthus RhizosphereEFRADADKAQLEIEPLTAGEIDTLLALAYGAPKAIVQKAAALVEPSGRAP*
Ga0070717_1134779013300006028Corn, Switchgrass And Miscanthus RhizosphereFEATLVDPEFRTEAEKAQLEIEPLTAHEIEQFLAKAYAASKPIVQKAGALVEPSGRAQ*
Ga0075417_1056882913300006049Populus RhizosphereAEFRADATKAQLEIEPLTATEIDKLLATAYGAPKSIVQKAAALVEPSSRSP*
Ga0075432_1017375723300006058Populus RhizosphereLEDAEFRADATKAQLEIEPLTATEIDKLLATAYGAPKPIVQKAAALVEPSSRAP*
Ga0070712_10195087713300006175Corn, Switchgrass And Miscanthus RhizosphereLTAHEIEQFLAKAYAASKPIVQKAGALVEPSGRAQ*
Ga0075428_10191079323300006844Populus RhizosphereDAEKVQLEIEPLTAGEIETLLASAYGAPKTIVQKAAALVEPSGRAQ*
Ga0068865_10007460243300006881Miscanthus RhizosphereKAQLEIEPLTAAEIDALLATAYGARKPIVQKAAALVEPSVRAP*
Ga0075426_1063165813300006903Populus RhizospherePLTAGEIETLLALAYGAPKAIVQKAAALVEPSGRAP*
Ga0074063_1009809623300006953SoilLADGEFRADADKAQMEIEPLTAGEIETLLALAYGAPKAIVQKAAALVEPSGRAP*
Ga0066709_10372162313300009137Grasslands SoilADADKAQLEIEPLTAGEIETLLALAYGAPKAIVEKAAALVEPSGRAP*
Ga0075423_1207925313300009162Populus RhizosphereQLEIEPLTAGEIDTLLALAYGAPKAIVQKAAALVEPSGRAP*
Ga0126380_1079547813300010043Tropical Forest SoilDADKAQLEVEPLTAAEIDTLLAKAYAAPKTIVRKAAALIEPGRAP*
Ga0126382_1080944633300010047Tropical Forest SoilTASEIETFLATAYGAPRTTVQKAAALVEPSARAP*
Ga0126373_1025786513300010048Tropical Forest SoilADKAQLEIEPLTAAEIETLLAKAYGAPRTIVQKAAALVEPSGRAP*
Ga0126373_1084863713300010048Tropical Forest SoilLEIEPLTAAEIETLLARAFGAPKTIVQKAAALIEPPGRAP*
Ga0126376_1027468213300010359Tropical Forest SoilDKAQLEIEPLTASEIETFLATAYGAPRTTVQKAAALVEPSARAP*
Ga0126372_1013475433300010360Tropical Forest SoilADAEFRADAEKAQLEIEPLTAPEIENYLAAAYSAPKAIVQKAGALVEPSGRVQ*
Ga0126372_1080445113300010360Tropical Forest SoilGEFRADADKAQLEIEPLTAGEIETLLAAAYSAPKAIVQKAAALVEPSGRAP*
Ga0126378_1243388413300010361Tropical Forest SoilFRADADKAQLEVEPLTAAEIDTLLAKDYAAPKTIVQNAAALIEPSGRAP*
Ga0126378_1258813013300010361Tropical Forest SoilLTAAEIETLLAKAYGAPRTIVQKAAALVEPSGRAP*
Ga0134128_1129343223300010373Terrestrial SoilLTAAEIDALLATAYGAPKPIVQKAAALVGPSVRAP*
Ga0126381_10265227423300010376Tropical Forest SoilEKAQLEIEPLTAAEIETLLAKAYGAPRTIVQKAAALVEPSGRAP*
Ga0126381_10428151623300010376Tropical Forest SoilIEPLTAAEIETLLAAAYSAPKAIVQKAAALVEPSGRAP*
Ga0126381_10458666313300010376Tropical Forest SoilAQLEIEPLTAAEIETLLAKAYGAPRTIVQKAAALVEPSGRVP*
Ga0126383_1126943323300010398Tropical Forest SoilDGEFRADADKAQLEVEPLTAAEIDTLLAKAYGAPKTIVQKAAALIEPSGRAP*
Ga0126383_1213270713300010398Tropical Forest SoilLAEADKISLEIDPLKAGEIERLLGAAYGAPKPIIERAAALVEPSGH*
Ga0153924_112517913300012089Attine Ant Fungus GardensDPLTGQEIEKLLARAYAAPKTIVQRAAALVEPSAPNVK*
Ga0137376_1095943613300012208Vadose Zone SoilTMTDPEFVAEAGKLQMEIEPLTAAQIDALLATAYGAPRPIVQQAAELLEPAGQR*
Ga0137379_1080720323300012209Vadose Zone SoilADADKAQLEIEPLTAGEIETLLALAYGAPKAIVQKAAALVEPSGRAP*
Ga0157286_1000819413300012908SoilIEPLTAAEIDALLATAYGARKPIVQNAAALVEPSVRAP*
Ga0126375_1098772313300012948Tropical Forest SoilDADKAQLEVEPLTAAEIDTLLAKAYAAPKTIVRKAAALIEPSGRAP*
Ga0126369_1261429523300012971Tropical Forest SoilDADKAQLEIEPLTAGEIETLLALAYGAPKAIVQKAAALVDPSVRAP*
Ga0157376_1314096913300014969Miscanthus RhizosphereTEFRADAAKAQLEIESLTAAEIDGLLATAYDTPKPIVHKAAVLVEPSVRAP*
Ga0132255_10146930713300015374Arabidopsis RhizosphereAAKAQLEIEPLTGEEIDRLLATAYTTPKPIVQKAAALVEPSTRAP*
Ga0182041_1041612823300016294SoilGEFRADADKAQLKIEPLTAAEIEALLAKAYGAPRTIVQKAAALVEPSGRAP
Ga0182033_1028224113300016319SoilPLTAAEIDTLLAKAYAAPKTIVKKAAALIEPPGRAP
Ga0182033_1094036123300016319SoilRADADKAQLEIEPLTATEIEALLAKAYGAPRTIVQKAAALVEPSGRAP
Ga0182035_1011446633300016341SoilAEKAQLEIEPLTGAEIEKLLATAYSAPKSIVQQAAGLVEPGGRAN
Ga0182038_1084336713300016445SoilQLEIEPLTAAEIERLLDMAYSTPKPIVTEAAALLEPGK
Ga0182038_1117762213300016445SoilRADAQKAQLEIEPLAAVEIETLLATAYGAPSAIVQRAAALVEPSGRTP
Ga0187868_128217513300018002PeatlandTQLEIDPLTGDEIEKLLAKAYAAPKPIVQRAAALVEPAHRAR
Ga0184608_1000869053300018028Groundwater SedimentLGDAEFRSDAAKAQLEIEPLTGDEIDNLLATAYSTPKPIVQKAAALVEPSTRAP
Ga0184608_1050648623300018028Groundwater SedimentLGDAEFRSDAAKAQLEIEPLTGDEIDNLLATAYSTPKPIVHKAAALVEPSTRAP
Ga0184611_131197913300018067Groundwater SedimentKAQLEIEPLTAAEIDGLLATAYAAPKPIVQKAAALVEPSVRAP
Ga0066667_1152989323300018433Grasslands SoilGEFRVDADKAQLEIEPLTAGEIETLLALAYGAPKAIVQKAAALVEPSGRAP
Ga0066669_1062584323300018482Grasslands SoilGDAEFRADADKAQLEIEPLTSGEIEQLLARAYGAPKPIVQKAAALVEPSGRAP
Ga0193692_103563123300020000SoilTLGDAEFRSDAAKAQLEIEPLTGNEIDNLLATAYSTPKPIVHKAAALVEPSTRAP
Ga0193699_1014943323300021363SoilLEIEPLTADEIDRLLATAYSAPKPIVQKAAALVEPSNRAP
Ga0207697_1049114623300025315Corn, Switchgrass And Miscanthus RhizosphereADAAKAQLEIEPLTAAEIDALLATAYGAPKPIVQKAAALVEPSVRAP
Ga0207682_1008758723300025893Miscanthus RhizosphereLEIEPLTAAEIDALLATAYGARKPIVQKAAALVEPSVRAP
Ga0207684_1051308313300025910Corn, Switchgrass And Miscanthus RhizosphereEPLTAGEIETLLALAYGAPKAVVQKAAALVEPSARAP
Ga0207663_1074884413300025916Corn, Switchgrass And Miscanthus RhizosphereRTQLEIDPLAASEIETLLARAYGAPKATVQKAAAFVEPAGRAP
Ga0207660_1114890113300025917Corn RhizosphereLTAAEIDGLLATAYDTPKPIVHKAAVLVEPSVRAP
Ga0207646_1132450813300025922Corn, Switchgrass And Miscanthus RhizosphereGEFRADADKAQLEIEPLTAGEIDTLLALAYGAPKAIVQKAAALVEPSGRAP
Ga0207640_1123214413300025981Corn RhizosphereIEPLTAAEIDALLATAYGARKPIVQKAAALVEPSVRAP
Ga0207703_1005196013300026035Switchgrass RhizosphereEIEPLTAAEIDALLATAYGAPKPIVQKAAALVEPSVRAP
Ga0257161_110527023300026508SoilKAQLEIEPLTAGEIETLLALAYGAPKAIVEKAAALVEPSGRAP
Ga0208525_101562023300027288SoilEPLTAGEIETLLALAYGAPKAIVQKAAALVEPSSRAP
Ga0208983_103370423300027381Forest SoilLGDAEFRSDAAKAQLEIEPLTADEIDRLLATAYSAPKPIVQKAAALVEPSNRAP
Ga0209213_106050723300027383Forest SoilTLGDAEFRSDAAKAQLEIEPLTADEIDRLLATAYSAPKPIVQKAAALVEPSNRAP
Ga0208993_101112633300027480Forest SoilEPLTADEIDRLLATAYSAPKPIVQKAAALVEPSNRAP
Ga0209106_101485413300027616Forest SoilADAEFRADADKAQLEIEPLTASEIETFLAKAYGAPRPIVQKAAALVEPAGRAQ
Ga0209180_1006080013300027846Vadose Zone SoilEFRADADKAQLEIEPLTAGEIETLLALAYGAPKAIVEKAAALVEPSGRAP
Ga0209701_1023365213300027862Vadose Zone SoilFEATLRDAEFRAEAERAQLEIEPLTAGEIEQFLATAYGAPKPIVQKAAALVEPSGRAQ
Ga0209813_1049904123300027866Populus EndosphereGKAQLEIEPLTAAEIDALLAKAYGAPQPIVQKAAALVEPSVRAP
Ga0268265_1054125613300028380Switchgrass RhizosphereIEPLTATAIDKLLATAYGAPKSIVQKAAALVEPSSRSP
Ga0137415_1145523313300028536Vadose Zone SoilAQLEIEPLTAGEIETLLALAYGAPKAIVEKAAALVEPSGRAP
Ga0307322_1013429813300028710SoilQLEIEPLTAAEIDALLATAYGARKPIVQKAAALVEPSVRAP
Ga0307322_1021372413300028710SoilKAQLEIEPLTGDEIDNLLATAYSTPKPIVHKAAALVEPSTRAP
Ga0307309_1017825023300028714SoilEPLTGNEIDNLLATAYSTPKPIVHKAAALVEPSTRAP
Ga0307280_1027169623300028768SoilLEIEPLTGNEIDNLLATAYSTPKPIVHKAAALVEPSTRAP
Ga0307287_1020651623300028796SoilFRSDAAKAQLEIEPLTGEEIDRLLATAYTTPKPIVQKAAALVEPSTRAP
Ga0307294_1027381223300028810SoilLEVEPLTAAEINALLATAYGAPKPIVQKAATLVEPSVRAP
Ga0307310_1023256623300028824SoilTLEDTEFRADAAKAQLEIEPLTAAKIDGLLATAYGAPKPIVQKAAALVEPSVRAP
Ga0318516_1010687533300031543SoilKAQLEIEPLTAAEIETLLAKAYGAPRTIVQKAAALVEPSGRAP
Ga0318516_1057129013300031543SoilADADKAQLEVEPLTAAEIDTLLAKAYAAPKTIVKKAAALIEPSGRAP
Ga0318541_1028646923300031545SoilDKAQLEVEPLTAAEIDTLLAKAYAAPKTIVKKAAALIEPPGRAP
Ga0318541_1053762223300031545SoilFRADADKAQLEVEPLTATEIDTLLAKAYAAPKTIVQKAAALIEPGRAP
Ga0318538_1037256413300031546SoilADGEFRADADKAQLEIEPLTAAEIEALLAKAYGAPRTIVQKAAALVEPSGRAP
Ga0318528_1010504533300031561SoilADADKAQLEIEPLTAAEIETLLAKAYGAPRTIVQKAAALIEPPGRAP
Ga0318573_1042267723300031564SoilADKAQLEVEPLTAAEIDTLLAKAYAAPKTIVKKAAALIEPPGRAP
Ga0318542_1062228923300031668SoilLEVEPLTAAEIDTLLAKAYAAPKTIVKKAAALIEPSGRAP
Ga0318574_1032208713300031680SoilVEPLTAAEIDTLLAKAYAAPKTIVKKAAALIEPPGRAP
Ga0318572_1003448613300031681SoilPLTAAEIETLLAKAYGAPRTIVQKAAALIEPPGRAP
Ga0318496_1005961313300031713SoilKAQLEIEPLTAAEIEALLAKAYGAPRTIVQKAAALVEPSGRAP
Ga0318496_1011964433300031713SoilPLTAGEIETLLALAYGAPKAIVQKAAALVEPSGRAP
Ga0307474_1103050823300031718Hardwood Forest SoilPLTGQEIETMLAKAYAAPKPIVQRAAALVEPSAMKAK
Ga0306917_1064235623300031719SoilDADKAQLEIEPLTAAEIETLLAKAYGAPRTIVQKAAALIEPPGRAP
Ga0318493_1046248223300031723SoilEFRADADKAQLEIEPLTAAEIETLLAKAYGAPRTIVQKAAALVEPSGRAP
Ga0318500_1043719323300031724SoilEKAQLEIEPLTAAEIETLLAKAYGAPRTIVQKAAALIEPPGRAP
Ga0318502_1029572513300031747SoilDADKAQLEVEPLTAAEIDTLLAKAYAAPKTIVKKAAALIEPSGRAP
Ga0318535_1000610853300031764SoilRADADKAQLEIEPLTAAEIETLLAKAYGAPRTIVQKAAALIEPPGRAP
Ga0318535_1033418323300031764SoilKAQLEVEPLTAAEIDTLLAKAYAAPKTIVKKAAALIEPPGRAP
Ga0318498_1008137323300031778SoilLDDLEFRGEAEKAQLEIEPLTGAEIEKLLATAYSAPKSIVQQAAGLVEPGGRAN
Ga0318547_1012587633300031781SoilIEPLTAGEIETLLALAYGAPKAIVQKAAALVEPSGRAP
Ga0318557_1007529033300031795SoilIEPLTGAEIEKLLATAYSAPKSIVQQAAGLVEPGGRAN
Ga0318497_1001610013300031805SoilTLADGEFRADADKAQLEIEPLTAAEIETLLAKAYGAPRTIVQKAAALVEPSGRAP
Ga0310917_1021716413300031833SoilGEFRADADKAQLEIEPLTAAEIETLLAKAYGAPRTIVQKAAALIEPPGRAP
Ga0310917_1040577613300031833SoilQKAQLEIEPLAAVEIETLLATAYGAPSAIVQRAAALVEPSGRTP
Ga0318512_1039292113300031846SoilKAQLEIEPLTAAEIETLLAKAYGAPRTIVQKAAALIEPPGRAP
Ga0318544_1044644713300031880SoilGEFRADADKAQLEIEPLTAAEIETLLAKAYGAPRTIVQKAAALVEPSGRAP
Ga0318536_1006990133300031893SoilLTAGEIETLLALAYGAPKAIVQKAAALVEPSGRAP
Ga0318522_1035110013300031894SoilVEPLTAAEIDTLLAKAYAAPKTIVKKAAALIEPSGRAP
Ga0306921_1110289023300031912SoilADGEFRADADKAQLEIEPLTAGEIETLLALAYGAPKAIVQKAAALVEPSGRAP
Ga0306921_1125761123300031912SoilDKAQLEIEPLTAGEIETLLALAYGTPKAIVQKAAALVEPSGRAP
Ga0310916_1010079833300031942SoilLKIEPLTAAEIEALLAKAYGAPRTIVQKAAALVEPSGRAP
Ga0310910_1061516113300031946SoilAQLEIEPLAAVEIETLLATAYGAPSAIVQRAAALVEPSGRTP
Ga0310909_1011527613300031947SoilEIEPLMAAEIETLLAKAYGAPRTIVQKAAALVEPSGRAP
Ga0306926_1063133813300031954SoilEFRADADKAQLEIEPLTAAEIETLLAKAYGAPRTIVQKAAALIEPPGRAP
Ga0318531_1004071553300031981SoilLEIEPLAAVEIETLLATAYGAPSAIVQRAAALVEPSGRTP
Ga0318531_1042484123300031981SoilADADKAQLEIEPLTAGEIETLLALAYGAPKAIVQKAAALVEPSGRAP
Ga0306922_1034901113300032001SoilDGEFRADADKAQLEIEPLTAAEIETLLAKAYGAPRTIVQKAAALVEPSGRAP
Ga0318562_1040959913300032008SoilEIEPLTAAEIETLLAKAYGAPRTIVQKAAALIEPPGRAP
Ga0318569_1008446013300032010SoilDADKAQLEIEPLTAAEIETLLAKAYGAPRTIVQKAAALVEPSGRAP
Ga0318507_1017035523300032025SoilGEFRADADKAQLEIEPLTAAEIEALLAKAYGAPRTIVQKAAALVEPSGRAP
Ga0318507_1049423723300032025SoilAQLEIEPLTAGEIETLLALAYGAPKAIVQKAAALVEPSGRAP
Ga0318549_1057868013300032041SoilLEIEPLTAGEIETLLALAYGAPKAIVQKAAALVEPSGRAP
Ga0318570_1008071633300032054SoilLEIEPLTAAEIETLLAKAYGAPRTIVQKAAALVEPSGRAP
Ga0318575_1006681433300032055SoilQLEIEPLTAGEIETLLALAYGAPKAIVQKAAALVEPSGRAP
Ga0318510_1039583413300032064SoilDEFRADAQKAQLEIEPLAAVEIETLLATAYGAPSAIVQRAAALVEPSGRTP
Ga0318513_1015469613300032065SoilADKAQLEIEPLTAAEIETLLAKAYGAPRTIVQKAAALVEPSGRAP
Ga0306924_1123782123300032076SoilEPLTAGEIETLLALAYGTPKAIVQKAAALVEPSGRAP
Ga0318518_1019210913300032090SoilLEIEPLTATEIEALLAKAYGAPRTIVQKAAALVEPSGRAP
Ga0307472_10037706423300032205Hardwood Forest SoilEADKAQLEIEPLTAREIETFLARAYGAPRTTVQKAAALVEPSARAP

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.