NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F054960

Metagenome Family F054960

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F054960
Family Type Metagenome
Number of Sequences 139
Average Sequence Length 44 residues
Representative Sequence MLEPSADEIRDWGNSVTQFMIDYLGGLRDRPAYRHTSSREIRS
Number of Associated Samples 117
Number of Associated Scaffolds 139

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 19.42 %
% of genes near scaffold ends (potentially truncated) 99.28 %
% of genes from short scaffolds (< 2000 bps) 92.81 %
Associated GOLD sequencing projects 111
AlphaFold2 3D model prediction Yes
3D model pTM-score0.50

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (97.842 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil
(13.669 % of family members)
Environment Ontology (ENVO) Unclassified
(26.619 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(51.079 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 32.39%    β-sheet: 0.00%    Coil/Unstructured: 67.61%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.50
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 139 Family Scaffolds
PF13091PLDc_2 6.47
PF01757Acyl_transf_3 6.47
PF08386Abhydrolase_4 5.04
PF13602ADH_zinc_N_2 2.16
PF01699Na_Ca_ex 1.44
PF04365BrnT_toxin 1.44
PF16884ADH_N_2 1.44
PF15919HicB_lk_antitox 1.44
PF00672HAMP 0.72
PF06782UPF0236 0.72
PF13302Acetyltransf_3 0.72
PF13847Methyltransf_31 0.72
PF13155Toprim_2 0.72
PF04191PEMT 0.72
PF00211Guanylate_cyc 0.72
PF00282Pyridoxal_deC 0.72
PF01425Amidase 0.72
PF05128DUF697 0.72

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 139 Family Scaffolds
COG0387Cation (Ca2+/Na+/K+)/H+ antiporter ChaAInorganic ion transport and metabolism [P] 1.44
COG0530Ca2+/Na+ antiporterInorganic ion transport and metabolism [P] 1.44
COG2929Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin systemDefense mechanisms [V] 1.44
COG0076Glutamate or tyrosine decarboxylase or a related PLP-dependent proteinAmino acid transport and metabolism [E] 0.72
COG0154Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidaseTranslation, ribosomal structure and biogenesis [J] 0.72
COG2114Adenylate cyclase, class 3Signal transduction mechanisms [T] 0.72
COG3768Uncharacterized membrane protein YcjF, UPF0283 familyFunction unknown [S] 0.72

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.84 %
UnclassifiedrootN/A2.16 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459005|F1BAP7Q01BL2VYAll Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium510Open in IMG/M
2199352025|deepsgr__Contig_117209All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium549Open in IMG/M
3300000651|AP72_2010_repI_A10DRAFT_1009971All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1247Open in IMG/M
3300000955|JGI1027J12803_109219610All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium545Open in IMG/M
3300000956|JGI10216J12902_110131301All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300001991|JGI24743J22301_10067980All Organisms → cellular organisms → Bacteria740Open in IMG/M
3300002126|JGI24035J26624_1011737All Organisms → cellular organisms → Bacteria878Open in IMG/M
3300002128|JGI24036J26619_10048193All Organisms → cellular organisms → Bacteria828Open in IMG/M
3300002128|JGI24036J26619_10067312All Organisms → cellular organisms → Bacteria710Open in IMG/M
3300003203|JGI25406J46586_10166284All Organisms → cellular organisms → Bacteria643Open in IMG/M
3300004114|Ga0062593_101637793All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium700Open in IMG/M
3300004114|Ga0062593_103518605All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium503Open in IMG/M
3300004479|Ga0062595_102482897All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300005172|Ga0066683_10427172All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium815Open in IMG/M
3300005288|Ga0065714_10190479All Organisms → cellular organisms → Bacteria887Open in IMG/M
3300005331|Ga0070670_100332711All Organisms → cellular organisms → Bacteria1332Open in IMG/M
3300005332|Ga0066388_106672757All Organisms → cellular organisms → Bacteria581Open in IMG/M
3300005339|Ga0070660_100064547All Organisms → cellular organisms → Bacteria → Proteobacteria2848Open in IMG/M
3300005344|Ga0070661_100277743All Organisms → cellular organisms → Bacteria1299Open in IMG/M
3300005344|Ga0070661_100297197All Organisms → cellular organisms → Bacteria1256Open in IMG/M
3300005347|Ga0070668_100206536All Organisms → cellular organisms → Bacteria → Proteobacteria1614Open in IMG/M
3300005354|Ga0070675_100067491All Organisms → cellular organisms → Bacteria2960Open in IMG/M
3300005434|Ga0070709_11049201All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium650Open in IMG/M
3300005451|Ga0066681_10490949All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium756Open in IMG/M
3300005554|Ga0066661_10837631All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia538Open in IMG/M
3300005556|Ga0066707_10372808All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium931Open in IMG/M
3300005560|Ga0066670_10531060All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium721Open in IMG/M
3300005566|Ga0066693_10241391All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium713Open in IMG/M
3300005566|Ga0066693_10351803All Organisms → cellular organisms → Bacteria → Proteobacteria593Open in IMG/M
3300005574|Ga0066694_10232090All Organisms → cellular organisms → Bacteria874Open in IMG/M
3300005576|Ga0066708_10015719All Organisms → cellular organisms → Bacteria → Proteobacteria3738Open in IMG/M
3300005615|Ga0070702_100458860All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium926Open in IMG/M
3300005764|Ga0066903_100400516All Organisms → cellular organisms → Bacteria2258Open in IMG/M
3300005764|Ga0066903_101740661All Organisms → cellular organisms → Bacteria1188Open in IMG/M
3300005764|Ga0066903_105659250All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia657Open in IMG/M
3300005764|Ga0066903_105722309All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia653Open in IMG/M
3300005764|Ga0066903_106122689All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium629Open in IMG/M
3300005764|Ga0066903_106548637All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium607Open in IMG/M
3300005937|Ga0081455_10732569All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium627Open in IMG/M
3300005983|Ga0081540_1346910All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium508Open in IMG/M
3300006031|Ga0066651_10118464All Organisms → cellular organisms → Bacteria → Proteobacteria1356Open in IMG/M
3300006058|Ga0075432_10526412All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria530Open in IMG/M
3300006237|Ga0097621_100158044All Organisms → cellular organisms → Bacteria1947Open in IMG/M
3300006796|Ga0066665_10195420All Organisms → cellular organisms → Bacteria1566Open in IMG/M
3300006796|Ga0066665_10978942All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales650Open in IMG/M
3300009137|Ga0066709_103740516All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium552Open in IMG/M
3300009177|Ga0105248_12612053All Organisms → cellular organisms → Bacteria576Open in IMG/M
3300009553|Ga0105249_13043082All Organisms → cellular organisms → Bacteria538Open in IMG/M
3300009792|Ga0126374_10713407All Organisms → cellular organisms → Bacteria756Open in IMG/M
3300010042|Ga0126314_11204786All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300010047|Ga0126382_10461960All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1009Open in IMG/M
3300010301|Ga0134070_10409102All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium536Open in IMG/M
3300010320|Ga0134109_10331863All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium593Open in IMG/M
3300010321|Ga0134067_10331608All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium594Open in IMG/M
3300010335|Ga0134063_10613414All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300010337|Ga0134062_10549572All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium588Open in IMG/M
3300010360|Ga0126372_10693893All Organisms → cellular organisms → Bacteria993Open in IMG/M
3300010360|Ga0126372_10920619All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium879Open in IMG/M
3300010362|Ga0126377_12092039All Organisms → cellular organisms → Bacteria642Open in IMG/M
3300010366|Ga0126379_11797552All Organisms → cellular organisms → Bacteria717Open in IMG/M
3300010366|Ga0126379_12237680All Organisms → cellular organisms → Bacteria647Open in IMG/M
3300010376|Ga0126381_101380232All Organisms → cellular organisms → Bacteria1018Open in IMG/M
3300010398|Ga0126383_13649430All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium503Open in IMG/M
3300012096|Ga0137389_11607014All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium546Open in IMG/M
3300012198|Ga0137364_10055728All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia2651Open in IMG/M
3300012199|Ga0137383_10096410All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium2145Open in IMG/M
3300012207|Ga0137381_10652518All Organisms → cellular organisms → Bacteria916Open in IMG/M
3300012210|Ga0137378_10224939All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1747Open in IMG/M
3300012356|Ga0137371_10308614All Organisms → cellular organisms → Bacteria1232Open in IMG/M
3300012913|Ga0157298_10392046All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300012929|Ga0137404_10121443All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium2136Open in IMG/M
3300012929|Ga0137404_11051914All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium746Open in IMG/M
3300012944|Ga0137410_10763953All Organisms → cellular organisms → Bacteria809Open in IMG/M
3300012971|Ga0126369_11474462All Organisms → cellular organisms → Bacteria770Open in IMG/M
3300012971|Ga0126369_12338974All Organisms → cellular organisms → Bacteria621Open in IMG/M
3300012972|Ga0134077_10317482Not Available657Open in IMG/M
3300012988|Ga0164306_11126957All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes654Open in IMG/M
3300014154|Ga0134075_10430913All Organisms → cellular organisms → Bacteria585Open in IMG/M
3300014157|Ga0134078_10214352Not Available792Open in IMG/M
3300014969|Ga0157376_10774128All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium970Open in IMG/M
3300015200|Ga0173480_10181874All Organisms → cellular organisms → Bacteria1099Open in IMG/M
3300015241|Ga0137418_10075924All Organisms → cellular organisms → Bacteria3054Open in IMG/M
3300015356|Ga0134073_10328249All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium555Open in IMG/M
3300015357|Ga0134072_10077437All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium981Open in IMG/M
3300015359|Ga0134085_10461841Not Available577Open in IMG/M
3300015372|Ga0132256_100284127All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales1734Open in IMG/M
3300015372|Ga0132256_103835955All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300015373|Ga0132257_102841275All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium631Open in IMG/M
3300015374|Ga0132255_104670913All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia580Open in IMG/M
3300015374|Ga0132255_105787368All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia523Open in IMG/M
3300016371|Ga0182034_10352142All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1196Open in IMG/M
3300016404|Ga0182037_11990250All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium521Open in IMG/M
3300017936|Ga0187821_10160766All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium852Open in IMG/M
3300018027|Ga0184605_10031133All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium2199Open in IMG/M
3300018051|Ga0184620_10137635All Organisms → cellular organisms → Bacteria782Open in IMG/M
3300018431|Ga0066655_10508623All Organisms → cellular organisms → Bacteria799Open in IMG/M
3300018431|Ga0066655_10852865All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium621Open in IMG/M
3300018431|Ga0066655_10962392All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia587Open in IMG/M
3300018433|Ga0066667_10306250All Organisms → cellular organisms → Bacteria1239Open in IMG/M
3300018482|Ga0066669_10122270All Organisms → cellular organisms → Bacteria1857Open in IMG/M
3300019882|Ga0193713_1093212All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium842Open in IMG/M
3300019883|Ga0193725_1111613All Organisms → cellular organisms → Bacteria634Open in IMG/M
3300019886|Ga0193727_1019357All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia2463Open in IMG/M
3300020010|Ga0193749_1095229All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium535Open in IMG/M
3300020062|Ga0193724_1036049All Organisms → cellular organisms → Bacteria1052Open in IMG/M
3300022756|Ga0222622_10603770All Organisms → cellular organisms → Bacteria792Open in IMG/M
3300022756|Ga0222622_11356760All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia523Open in IMG/M
3300025900|Ga0207710_10522963All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium617Open in IMG/M
3300025905|Ga0207685_10475508All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium654Open in IMG/M
3300025906|Ga0207699_10648145All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium771Open in IMG/M
3300025912|Ga0207707_11177525All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes621Open in IMG/M
3300025920|Ga0207649_11371588All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes559Open in IMG/M
3300025923|Ga0207681_11025179All Organisms → cellular organisms → Bacteria693Open in IMG/M
3300025936|Ga0207670_11035269All Organisms → cellular organisms → Bacteria692Open in IMG/M
3300025941|Ga0207711_11562822All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes603Open in IMG/M
3300025941|Ga0207711_11707465All Organisms → cellular organisms → Bacteria573Open in IMG/M
3300025944|Ga0207661_12160250All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia503Open in IMG/M
3300025960|Ga0207651_10682789All Organisms → cellular organisms → Bacteria903Open in IMG/M
3300025972|Ga0207668_10910514All Organisms → cellular organisms → Bacteria783Open in IMG/M
3300026035|Ga0207703_11598963All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes627Open in IMG/M
3300026089|Ga0207648_10722403All Organisms → cellular organisms → Bacteria924Open in IMG/M
3300026324|Ga0209470_1172231All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium940Open in IMG/M
3300026325|Ga0209152_10277944All Organisms → cellular organisms → Bacteria623Open in IMG/M
3300026331|Ga0209267_1199866All Organisms → cellular organisms → Bacteria765Open in IMG/M
3300026332|Ga0209803_1133636All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium978Open in IMG/M
3300026530|Ga0209807_1215890All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia661Open in IMG/M
3300028828|Ga0307312_11112230All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia523Open in IMG/M
3300028875|Ga0307289_10145691All Organisms → cellular organisms → Bacteria973Open in IMG/M
3300028875|Ga0307289_10214532All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium792Open in IMG/M
3300028878|Ga0307278_10318607All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium687Open in IMG/M
3300031231|Ga0170824_114187565All Organisms → cellular organisms → Bacteria879Open in IMG/M
3300031231|Ga0170824_120104557All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium553Open in IMG/M
3300031474|Ga0170818_101817167All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1023Open in IMG/M
3300031538|Ga0310888_10624788All Organisms → cellular organisms → Bacteria655Open in IMG/M
3300031716|Ga0310813_12320048All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia509Open in IMG/M
3300032001|Ga0306922_10982580All Organisms → cellular organisms → Bacteria872Open in IMG/M
3300032051|Ga0318532_10199757All Organisms → cellular organisms → Bacteria710Open in IMG/M
3300032059|Ga0318533_10581845All Organisms → cellular organisms → Bacteria821Open in IMG/M
3300032060|Ga0318505_10634788All Organisms → cellular organisms → Bacteria502Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil13.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil9.35%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil7.91%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil7.91%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil7.19%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil5.04%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil4.32%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere3.60%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere3.60%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil2.88%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.88%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere2.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.16%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.16%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.16%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.16%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere2.16%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.44%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.44%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere1.44%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.44%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere1.44%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere1.44%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.72%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.72%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.72%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.72%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.72%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.72%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.72%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.72%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.72%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.72%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.72%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.72%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.72%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459005Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cmEnvironmentalOpen in IMG/M
2199352025Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOILEnvironmentalOpen in IMG/M
3300000651Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A10EnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001991Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2Host-AssociatedOpen in IMG/M
3300002126Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5Host-AssociatedOpen in IMG/M
3300002128Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5EnvironmentalOpen in IMG/M
3300003203Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2Host-AssociatedOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005288Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1Host-AssociatedOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005566Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142EnvironmentalOpen in IMG/M
3300005574Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300005983Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1Host-AssociatedOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006058Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1Host-AssociatedOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010042Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105BEnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015EnvironmentalOpen in IMG/M
3300010320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015EnvironmentalOpen in IMG/M
3300010321Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015EnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012913Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012972Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300014154Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015EnvironmentalOpen in IMG/M
3300014157Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015200Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)EnvironmentalOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015356Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300015357Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300015359Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300017936Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1EnvironmentalOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018051Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1EnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019882Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2EnvironmentalOpen in IMG/M
3300019883Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2EnvironmentalOpen in IMG/M
3300019886Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2EnvironmentalOpen in IMG/M
3300020010Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1s2EnvironmentalOpen in IMG/M
3300020062Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a1EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300025900Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026324Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes)EnvironmentalOpen in IMG/M
3300026325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes)EnvironmentalOpen in IMG/M
3300026331Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes)EnvironmentalOpen in IMG/M
3300026332Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes)EnvironmentalOpen in IMG/M
3300026530Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes)EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028875Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031538Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032051Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032060Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
E41_117280802170459005Grass SoilMLDPSADEMRNWGNSVMQLMTEYLGDLRDHRVYGRMSSREIRGRLD
deepsgr_018572502199352025SoilMLDPSDDEMRNWGNSVIQLMTDYLRDIRDHRVYGRIS
AP72_2010_repI_A10DRAFT_100997143300000651Forest SoilMLEPSADEIGEWANSVTQFMIDYLGGLRDRPVYRQTSSREIRSGLD
JGI1027J12803_10921961013300000955SoilMDMLEPSASEMRDWGNSVSQFIIEYLGELRDRPVYRHTSSREIRSGLDW
JGI10216J12902_11013130113300000956SoilMLDPSADEICDWGKSVIKFMTDYLGGLSDRGVYRHMSSRRIRGRLDS
JGI24743J22301_1006798033300001991Corn, Switchgrass And Miscanthus RhizosphereMLEPSADEIREWGDSVIEFMTDYLGELRDLPAYRHSSSRE
JGI24035J26624_101173713300002126Corn, Switchgrass And Miscanthus RhizosphereMLDPSADEIREWGDSVTQFVIEYLGWLRDRPVYRHTSSRE
JGI24036J26619_1004819313300002128Corn, Switchgrass And Miscanthus RhizosphereMLEPSADEIREWGDSVIEFMTDYLGELRNRPAXRHSSSREIRSGL
JGI24036J26619_1006731213300002128Corn, Switchgrass And Miscanthus RhizosphereMLEPSADEIGEWANSVTQFMIDYLGGLRDRPVYCQTS
JGI25406J46586_1016628413300003203Tabebuia Heterophylla RhizosphereMEMLEPSADEIRDWANLVTQFMIDYLGDLRDRPAYRHTSSHEIR
Ga0062593_10163779313300004114SoilMLEPSADEIGDWGNSVTQFMIDYLGGLRDRPAYRHTSSREIRSGLDS
Ga0062593_10351860523300004114SoilMLDPSDDEMRNWGNSVIQLMTDYLRDLRDHRVYGRMSSREIRDRLD
Ga0062595_10248289723300004479SoilMRMLEPSADEIRDWGNSVTQLMIEYLGNLRDRPVYRQTSSREIRRGLDSK
Ga0066683_1042717213300005172SoilMLYPSADEIRDWGNSVTQFMIDYLGGLRDRPVYRHTSSREIRDGLD
Ga0065714_1019047933300005288Miscanthus RhizosphereMLEPSADEIREWGDSVIQFMTDYLGWMRDRPVYRQTSSREIRSGLDLKLP
Ga0070670_10033271143300005331Switchgrass RhizosphereMLEPSADEIREWGDSIIQFIIEYLGWLRDRPVYRHTSSRAIRSGLESKLPIKG
Ga0066388_10667275723300005332Tropical Forest SoilVNMLEPSADEIREWANSVTQFMIDYLGGLRDRPVYRQTSSR
Ga0070660_10006454713300005339Corn RhizosphereVNMLEPSADEIREWGDSIIQFIIEYLGWLRDRPVYRHTSS
Ga0070661_10027774313300005344Corn RhizosphereMLEPSADEIREWGDSVIQFMTDYLGWMRDRPVYRQTSSREIRSGLD
Ga0070661_10029719713300005344Corn RhizosphereMLEPSADEIREWENAVTQFMIEYLGGLRDRPVYRHTSSREIRSKLDSNLPAKG
Ga0070668_10020653633300005347Switchgrass RhizosphereMLEPSADEIREWGDSVTRFVIEYVGGLRNRRAYQHTSSREIRSGL
Ga0070675_10006749113300005354Miscanthus RhizosphereMLEPSADEIREWGDSVIEFMTDYLGELRNRPAYRHSSSREIRSGLDS
Ga0070709_1104920123300005434Corn, Switchgrass And Miscanthus RhizosphereMDMLEPSPDEIRDWGNSVTQFIIDYLGGLRDRPAYRHTSSREIRSGLDSKLP
Ga0066681_1049094913300005451SoilMLDPSADEIRDWGNSVIQLMSDYLRSLRARGVYRHMFSRRIR
Ga0066661_1083763113300005554SoilMEMLDPSADEIRDWGNSVIQFMTDYLGDLRARPVYRHTSSHEIR
Ga0066707_1037280823300005556SoilMLDPSADEIRDWGNSVIQLMADYLGNLRDRKVYRHMSS
Ga0066670_1053106023300005560SoilMLDPSADEIRSWSNSVTQFMVDYLGDLRDRGVYRHMFSRAIRNRLD
Ga0066693_1024139113300005566SoilMVDPSADEICSWSNSVTQFMADYLGDLRDRGVYRHMVSRAIR
Ga0066693_1035180323300005566SoilMLEPSADEIRKWSNSVAQFMIDYLEGLRRRPVYRHTSSR
Ga0066694_1023209013300005574SoilMLDPSADEIRDWSNSVIQLMTDYLGDLRDRPVYRRISSREIRDRLDA
Ga0066708_1001571953300005576SoilMDMLDPSADEIRDWGNSVIQFMTDYLGDLRARPVYRHTSSHEIRS
Ga0070702_10045886013300005615Corn, Switchgrass And Miscanthus RhizosphereMLEPSADEIREWENAVTQFMIEYFGELRDRPVYRHTSSREIRS
Ga0066903_10040051613300005764Tropical Forest SoilMLEPSANEIRDWGNSITQFMIEYLGGLRDRPAYRHTSSREI
Ga0066903_10174066123300005764Tropical Forest SoilMLEPSADEIRAWSNSVIQFLTDYLSELRDHPVYRR
Ga0066903_10565925023300005764Tropical Forest SoilMLEPSANEIRDWGDSVIRFMTDYLGNLRDRGVYRHMVSRRIRDRLD
Ga0066903_10572230923300005764Tropical Forest SoilMLEPSADEIRDWGDSVIRFMTDYLGNLRDRGVYRHMVSRRIRDRLD
Ga0066903_10612268923300005764Tropical Forest SoilMLEPSVDEIGEWANSVTQFMIDYLGGLRDRPVYRQTSSREIRSGLDSKLPIKGTDL
Ga0066903_10654863713300005764Tropical Forest SoilMLEPSADEIREWGNSVTQFMIDYLGGLRDRPAYRH
Ga0081455_1073256923300005937Tabebuia Heterophylla RhizosphereMLDPSANEMRKWGDSTVQFMTDYLGDLRDRGVYRHMFSRAIRSRL
Ga0081540_134691023300005983Tabebuia Heterophylla RhizosphereMLDPSSDEIRDWGNSVIQFMTDYLGGLSDRGVYRHMSSKRIRGR
Ga0066651_1011846413300006031SoilMLDPSADEIRSWSNSVSQFMADYLGDLRDRGVYRHMVSRAI
Ga0075432_1052641223300006058Populus RhizosphereMLEPSADEIREWGNLVTQFMIEYLGDLRDRPVYRQTSSRELRSGLDSK
Ga0097621_10015804413300006237Miscanthus RhizosphereMLEPSADEIREWGDSVIEFMTDYLGELRDLPAYRHSSSREIRSGLDS
Ga0066665_1019542013300006796SoilMLDPSADEIRDWGNSVIQLMADYLGNLRDRKVYRHMSSR
Ga0066665_1097894213300006796SoilMLDPSADEIRDWGNSVIQLMSDYLRSLRDRGVYRHMFSRRI
Ga0066709_10374051613300009137Grasslands SoilMLDPSADEIRDWGNSVIELMADYLGDLRDRRVYRHMSSREIRGRL
Ga0105248_1261205313300009177Switchgrass RhizosphereMLEPSADEIREWENAVTQFMIEYLGGLRDRPVYRHTTSHE
Ga0105249_1304308213300009553Switchgrass RhizosphereMLEPSADEIGEWANSVTQFMIDYLGGLRDRPVHRQTSSREIRSGLDSKLPIKGTD
Ga0126374_1071340723300009792Tropical Forest SoilMLEPSADEIHDWGNSISQFMIEYLGSLRDRPAYRHPSSREIRSRLDLKLP
Ga0126314_1120478613300010042Serpentine SoilMLEPSADEIRDWGNSITQFTIDYLGGLRDRPAYRHTSSREIRRGLDSKLPIKGT
Ga0126382_1046196033300010047Tropical Forest SoilMLEPSADEIREWENAVTQFMVEYLGGLRDRPVYRHTSSREIRSGLDSKL
Ga0134070_1040910223300010301Grasslands SoilMLEPSADEIRKWSNSVAQFMIDYLGGLRDRPVYRQSSSREIRSG
Ga0134109_1033186323300010320Grasslands SoilMLDPSADEIRDWGNSVIQLMIDYLRTLRDRGVYRHMSSREIRN
Ga0134067_1033160823300010321Grasslands SoilMLEPSADELRDWGNSVTQFMIDYLGGLRDRPAYRQTSSREIRSGLDLTLPIRGTA
Ga0134063_1061341423300010335Grasslands SoilMLDPSADEIRDWGNSVTEFMIKYLADLRDRRVYRYTSSREIRDGLDAA
Ga0134062_1054957213300010337Grasslands SoilMLDPSADEIRNWGNSVIQLMTNYLGDLRDHRVYGRMSSREIR
Ga0126372_1069389323300010360Tropical Forest SoilMLEPSADQIREWGNSVTQFMIDYLGGLRGRSVYRQTSSREIRSGLDSKLPI
Ga0126372_1092061923300010360Tropical Forest SoilMTMLDPSADELRNWGNSAIQLMTDYLGDLRDRKVYGRMSSREIRD
Ga0126377_1209203913300010362Tropical Forest SoilMLDPSADEIRAWGNSVTPFIIEYLGGLRDRPAYRHTSSREIRSGLDSKLP
Ga0126379_1179755233300010366Tropical Forest SoilMLEPSADEIREWENAVTQFMIEYLGGLRDRPVYRH
Ga0126379_1223768023300010366Tropical Forest SoilMLEPSADEIREWANSVTQFMIDYLGGLRGRPVYRQTSSREIRSGLDSKLPI
Ga0126381_10138023233300010376Tropical Forest SoilMLEPSADEIREWENAVTQFMIEYLGGLRDRPVYRHTSS
Ga0126383_1364943013300010398Tropical Forest SoilMLEPSADEIRDWANSVTQFIIDYLGELRDRPVYRHTCSREIRGGFDSKLP
Ga0137389_1160701423300012096Vadose Zone SoilMDMLEPSADEIRDWGNSVTQFMIDYLGGLRDRPAYRHTSSRE
Ga0137364_1005572843300012198Vadose Zone SoilMLEPSADEIRDWGNSVIQFMIEYRGGLRARPVYRHTSSREIRSRLDLKLPT
Ga0137383_1009641043300012199Vadose Zone SoilMLEPSADEIREWANSVTQFMIDYLGGLRDRPVYRQTSSREIRSGLDS
Ga0137381_1065251823300012207Vadose Zone SoilMLDPSADEIRDWGNSVIQLMSDYLGNLRNRGVYRHMFSRRIRDRLDA
Ga0137378_1022493913300012210Vadose Zone SoilMLYPSADEIRDWGNSVTQFMIDYLGGLRDRPVYRHTSSREIRDGLDRA
Ga0137371_1030861413300012356Vadose Zone SoilMLEPSADEIRDWGNSVTQFMIDYLGGLRDRPAYRHT
Ga0157298_1039204613300012913SoilMLEPSADEIREWGDSIIQFIIEYLGWLRDRPVYRHTSSREIRSGLDSKLPIKGT
Ga0137404_1012144313300012929Vadose Zone SoilMNMLEPSAAEIRDWGNSVTQFMIDYLGDLRDRPVYRHIS
Ga0137404_1105191423300012929Vadose Zone SoilMLEPSADEIRDWGNSVTQFMIDYLGGLRDRPVYRQTSSHEIRSGLDSKL
Ga0137410_1076395333300012944Vadose Zone SoilMLEPSADEIRDWGNSVSQFMIDYLGGLRDRPAYRHTSSREIRSGLD
Ga0126369_1147446223300012971Tropical Forest SoilMLEPSANEIRDWGNSITQFMIEYLGGLRDRPAYRHTSSREIRSRLDLELPI
Ga0126369_1233897423300012971Tropical Forest SoilMGMLEPSADEIRDWGNSVTQFVNEYLGGLRDCPVYRHMSSLEIRSGLDSKLPV
Ga0134077_1031748213300012972Grasslands SoilMLDPSADEIRDWGTSVIQLVADYLGDLRDRKVYRHTSSREIRDWLDAAL
Ga0164306_1112695733300012988SoilMLEPSADEIREWGDSIIQFIIEYLGWLRDRPVYRHSSSRAIRTGLESKLPIKGT
Ga0134075_1043091323300014154Grasslands SoilMLYPSADEIRDWGNSVTQFMIDYLGGLRDRPVYRHTSSR
Ga0134078_1021435213300014157Grasslands SoilMLDPSADEIRDWGNSVIQLMSDYLGDLRDRPVYRHMFSRRI
Ga0157376_1077412813300014969Miscanthus RhizosphereMLEPSADEIREWENAVTQFMIEYFGELRDRPVYRHTSSREIRSGLDSKLPIKGTD
Ga0173480_1018187413300015200SoilMLEPSADEIREWGDSVTQFMTDYLGWMRDRPVYRQTSSREI
Ga0137418_1007592413300015241Vadose Zone SoilMLDPSADELREWGNSVIQFMADYLGDLRNRNVYRHMSSGRIRNRI
Ga0134073_1032824913300015356Grasslands SoilMLEPSADEIRDWGNSVIQFMTDYLGNLRDRSVYRHMSSD
Ga0134072_1007743713300015357Grasslands SoilMLEPSADELRDWGNSVTQFMIDYLGGLRDRPAYRHTSSREIRGR
Ga0134085_1046184123300015359Grasslands SoilMLDPSADEIRDWGNSVTEFMIKYLGDLRDRRVYRHTSSREIRDR
Ga0132256_10028412733300015372Arabidopsis RhizosphereMLEPSAAEIREWENAVTQFMIEYLGGLRDRPVYRHTTSHEIRSGLDPKLP
Ga0132256_10383595523300015372Arabidopsis RhizosphereMLEPSADEIREWSNSVTQFMIDYLAGLRDRPVYRQTSSREIRSGLDSKLPIKG
Ga0132257_10284127523300015373Arabidopsis RhizosphereMLEPSADEIRKWENAVTQFMIEYLGGLRDRPVYRHTSSREIRS
Ga0132255_10467091313300015374Arabidopsis RhizosphereMLEPSADEIRKWENAVTQFMIEYLGDLRDRPVYRHTSSREIRSGLDSELP
Ga0132255_10578736813300015374Arabidopsis RhizosphereMLEPSADEIREWENAVTQFMIEYFGELRDRPVYRHTSSREIRSGL
Ga0182034_1035214233300016371SoilMLEPSADEIGEWADSVTQFMIDYLSGLRDRPVYRQTSSREIRSGLDSKLPIK
Ga0182037_1199025023300016404SoilMLEPSADEIREWGNSVTQFMIDYLGDLRDRPAYRQTSSGEIRSGLDPKLPI
Ga0187821_1016076623300017936Freshwater SedimentMLDPSAGEIRDWGNSVVQSMAEYLGGLRDRNVYRQMSS
Ga0184605_1003113313300018027Groundwater SedimentMDMLEPSADEIRDWGNSVTQFMIDYLGGLRDRPAYRQTSSREIRSGLDSKLP
Ga0184620_1013763513300018051Groundwater SedimentMLEPSADEIREWGDSVTRFVIEYLGGLRNRPAYQRT
Ga0066655_1050862313300018431Grasslands SoilMLEPSADEIRDWGNSVTQFMIDYLGGLRDRPAYRHTSSREIRS
Ga0066655_1085286513300018431Grasslands SoilMLEPSADEIRDWGNSVIQFMTDYLGNLRDRSVYRHM
Ga0066655_1096239213300018431Grasslands SoilMLDPSAEEIRDWGNSIVEFMADYLGDLRDRRVYRRMSSREIRDRL
Ga0066667_1030625013300018433Grasslands SoilMLDPSADEIRDWSNSVIQLMTDYLGDLRDRPVYRR
Ga0066669_1012227013300018482Grasslands SoilMLEPSADELRDWGNSVTQFMIDYLGGLRDRPAYRHTSSRE
Ga0193713_109321233300019882SoilMLEPSADEIRDWGNSVTQFMIDYLGGLRDRPAYRHTSSREIRSGLDSK
Ga0193725_111161313300019883SoilMDMLEPSADEIRDWGNSVTQFMIDYLGGLRDRPAYRHTSSREIRSGLDSKLP
Ga0193727_101935713300019886SoilMDMLEPSADEIRDWGNSVTQFMIDYLGGLRDRPAYRHTSSREI
Ga0193749_109522913300020010SoilMLEPSAGEIRDWGNSVIQFMTEYLGNLRDRNVYRHM
Ga0193724_103604933300020062SoilMLEPSADEIRDWGNSVTRFVIEYLGGLRDRPVYRHTSSRGIRSELDS
Ga0222622_1060377013300022756Groundwater SedimentMLEPSADEIREWADSVIEFMTDYLGGLRDRPVYRHT
Ga0222622_1135676023300022756Groundwater SedimentMLDPSADETREWGNSAIEFMADYFSELRERKVYRQMSSRDIRDRL
Ga0207710_1052296323300025900Switchgrass RhizosphereMLEPSADEIREWENAVTQFMIEYLGDLRDRPVYRHTSSRE
Ga0207685_1047550823300025905Corn, Switchgrass And Miscanthus RhizosphereMDMLEPSPDEIRDWGNSVTQFIIDYLGGLRDRPAYRHTSSREIRSGLD
Ga0207699_1064814513300025906Corn, Switchgrass And Miscanthus RhizosphereMDMLEPSPDEIRDWGNSVTQFIIDYLGGLRDRPAYRHTSSREIRSGLDSKLPIKG
Ga0207707_1117752533300025912Corn RhizosphereMLEPSADEIREWGDSVIEFMTDYLGELRNRPAYRHSSSREIRSG
Ga0207649_1137158813300025920Corn RhizosphereMLEPSADEIREWGDSVIEFMTDYLGGLRDRPAYRHSS
Ga0207681_1102517913300025923Switchgrass RhizosphereMIDPSDDKIRDWGKSVVDLMADYLGNLPDRPVYRPM
Ga0207670_1103526913300025936Switchgrass RhizosphereMLEPSADEIREWGDSVIEFMTDYLGELRDLPAYRHSSSREIRSGLDSELPIK
Ga0207711_1156282213300025941Switchgrass RhizosphereMLEPSADEIREWGDSVIEFMTDYLGGLRDRPAYRHSSSRK
Ga0207711_1170746513300025941Switchgrass RhizosphereMLEPSADEIREWENAVTQFMIEYLGGLRDRPVYRHTT
Ga0207661_1216025013300025944Corn RhizosphereMLEPSANEMREWENAVTQFMIEYFGELRDRPVYRHTSSREIRSGLDSKLPI
Ga0207651_1068278933300025960Switchgrass RhizosphereMLEPSADEIREWGDSVIEFMTDYLGELRNRPAYRHSSSREI
Ga0207668_1091051413300025972Switchgrass RhizosphereMLEPSADEIREWGDSVTRFVIEYVGGLRNRRAYQRTSSREIRS
Ga0207703_1159896313300026035Switchgrass RhizosphereMLEPSADEIREWGDSVIEFMTDYLGGLRDRPAYRHSSSRKIRSGLD
Ga0207648_1072240313300026089Miscanthus RhizosphereMLEPSADEIREWGDSVIQFMTDYLGWMRDRPVYRQTSSREIRSGLDL
Ga0209470_117223133300026324SoilMLDPSADEIRDWGNSVIQLMSDYLRSLRDRGVYRHMFSR
Ga0209152_1027794423300026325SoilMLDPSAEEIRDWGNSVVEFMANYLGDLRDRPVYRRMCSREI
Ga0209267_119986613300026331SoilMLDPSADEIRDWGNSVIQLMTDYLCNLRDRGVYRHMFSRR
Ga0209803_113363613300026332SoilMLYPSADEIRDWGNSVTQFMIDYLGGLRDRPVYRHTSSREIRDGLDPALPTKG
Ga0209807_121589023300026530SoilMLEPSADEIRDWGNSAIQLITEYLGGLRDRAVYRHMFS
Ga0307312_1111223023300028828SoilMLDPSADETREWGNSAIEFMADYFSELRERRVYRQMSSRDIRDRLDA
Ga0307289_1014569113300028875SoilMLEPSTDEIREWGNSVTRFVIEYLGGLRDRPVYRHTSSRGIRSEL
Ga0307289_1021453233300028875SoilMLEPSADEIREWGDSVTRFVIEYLGGLRNRPAYQHT
Ga0307278_1031860713300028878SoilMLEPSADEIRDWGNSVTQFMIDYLGGLRDRPAYRHTSSRE
Ga0170824_11418756513300031231Forest SoilMLEPSADEIREWGDSLIQFMIDYLGGLRDRPVYRQTSSREIRSGLDSKLPIK
Ga0170824_12010455713300031231Forest SoilMLDPSDDEMRNWGNSVIQLMTDYLRDLRDHRVYGRMSSR
Ga0170818_10181716713300031474Forest SoilMLEPSADEIREWGNSVTQFIIEYLGGLRDRPVYRHTSSREIRSE
Ga0310888_1062478823300031538SoilMLEPSADEIREWGDSAIRLMIEYLGGLRDRPVYRHTSSGEIRSGLDSKLPIEGTD
Ga0310813_1232004823300031716SoilMLDPSADEIRDWGNSVMQFMADYLGDLRDRNVYRHMSS
Ga0306922_1098258023300032001SoilMLEPSADEIREWGNSVTQFMIDYLGDLRDRPAYRQTSSGEI
Ga0318532_1019975713300032051SoilMLEPSSDKIREWANSVTQFMIDYLGGLRDRPVYRQTSSRE
Ga0318533_1058184523300032059SoilMLEPSADEIGEWANSVTQFMIDYLGGLRDRPVYRQTSSREIRSGLDSKLP
Ga0318505_1063478813300032060SoilMLEPSADEIGEWANSVTQFMIDYLGGLRDRPVYRQTS

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.