NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F054695

Metagenome / Metatranscriptome Family F054695

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F054695
Family Type Metagenome / Metatranscriptome
Number of Sequences 139
Average Sequence Length 42 residues
Representative Sequence MLYLLGGFAVLSGFLLLVYLFVNADPARLARGLKVTGIVI
Number of Associated Samples 118
Number of Associated Scaffolds 139

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 85.51 %
% of genes near scaffold ends (potentially truncated) 98.56 %
% of genes from short scaffolds (< 2000 bps) 94.96 %
Associated GOLD sequencing projects 112
AlphaFold2 3D model prediction Yes
3D model pTM-score0.48

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (91.367 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(29.496 % of family members)
Environment Ontology (ENVO) Unclassified
(38.849 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(49.640 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 52.94%    β-sheet: 0.00%    Coil/Unstructured: 47.06%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.48
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 139 Family Scaffolds
PF01568Molydop_binding 18.71
PF13519VWA_2 5.04
PF04879Molybdop_Fe4S4 1.44
PF07683CobW_C 0.72
PF05050Methyltransf_21 0.72
PF05168HEPN 0.72
PF00296Bac_luciferase 0.72
PF03308MeaB 0.72
PF13193AMP-binding_C 0.72
PF13472Lipase_GDSL_2 0.72
PF00067p450 0.72

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 139 Family Scaffolds
COG0523Zinc metallochaperone YeiR/ZagA and related GTPases, G3E familyGeneral function prediction only [R] 0.72
COG1895HEPN domain protein, predicted toxin of MNT-HEPN systemDefense mechanisms [V] 0.72
COG2124Cytochrome P450Defense mechanisms [V] 0.72
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 0.72
COG2250HEPN domain protein, predicted toxin of MNT-HEPN systemDefense mechanisms [V] 0.72

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms91.37 %
UnclassifiedrootN/A8.63 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002245|JGIcombinedJ26739_100205222All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1863Open in IMG/M
3300005167|Ga0066672_11033372All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Thalassobaculaceae500Open in IMG/M
3300005174|Ga0066680_10793483All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales571Open in IMG/M
3300005181|Ga0066678_10762394All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales642Open in IMG/M
3300005434|Ga0070709_11568807All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales536Open in IMG/M
3300005445|Ga0070708_101326212All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales672Open in IMG/M
3300005552|Ga0066701_10638286All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales645Open in IMG/M
3300005575|Ga0066702_10502004All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales738Open in IMG/M
3300005764|Ga0066903_101091085All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales1470Open in IMG/M
3300005764|Ga0066903_101720562All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00881195Open in IMG/M
3300005902|Ga0075273_10039517All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales835Open in IMG/M
3300006028|Ga0070717_10165050All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales1923Open in IMG/M
3300006032|Ga0066696_10651834All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria680Open in IMG/M
3300006032|Ga0066696_11096922All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales506Open in IMG/M
3300006797|Ga0066659_10714294All Organisms → cellular organisms → Bacteria820Open in IMG/M
3300006800|Ga0066660_10687672All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales842Open in IMG/M
3300007258|Ga0099793_10126577All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales1198Open in IMG/M
3300009038|Ga0099829_11172424All Organisms → cellular organisms → Bacteria636Open in IMG/M
3300009038|Ga0099829_11551609All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium547Open in IMG/M
3300009038|Ga0099829_11766952All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales507Open in IMG/M
3300009088|Ga0099830_11241753All Organisms → cellular organisms → Bacteria619Open in IMG/M
3300009137|Ga0066709_104262536All Organisms → cellular organisms → Bacteria → Proteobacteria521Open in IMG/M
3300010046|Ga0126384_11640838All Organisms → cellular organisms → Bacteria606Open in IMG/M
3300010046|Ga0126384_11887776All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Thalassospiraceae → Magnetovibrio → Magnetovibrio blakemorei569Open in IMG/M
3300010152|Ga0126318_10667599All Organisms → cellular organisms → Bacteria779Open in IMG/M
3300010322|Ga0134084_10127952All Organisms → cellular organisms → Bacteria836Open in IMG/M
3300010360|Ga0126372_10423062All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium1224Open in IMG/M
3300010361|Ga0126378_10340498All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium1608Open in IMG/M
3300011269|Ga0137392_10401945All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium1137Open in IMG/M
3300011271|Ga0137393_10676302All Organisms → cellular organisms → Bacteria884Open in IMG/M
3300012004|Ga0120134_1107438All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300012202|Ga0137363_10929902Not Available738Open in IMG/M
3300012203|Ga0137399_10319304All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1286Open in IMG/M
3300012205|Ga0137362_10579518All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria968Open in IMG/M
3300012361|Ga0137360_11173594All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria664Open in IMG/M
3300012922|Ga0137394_11361652All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales571Open in IMG/M
3300012948|Ga0126375_10529501Not Available885Open in IMG/M
3300012951|Ga0164300_10872723All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae566Open in IMG/M
3300012958|Ga0164299_10855940All Organisms → cellular organisms → Bacteria655Open in IMG/M
3300012971|Ga0126369_10270093All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1685Open in IMG/M
3300012977|Ga0134087_10167903All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria965Open in IMG/M
3300014501|Ga0182024_10540606All Organisms → cellular organisms → Bacteria1472Open in IMG/M
3300016270|Ga0182036_10874840All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria735Open in IMG/M
3300016294|Ga0182041_11069632All Organisms → cellular organisms → Bacteria732Open in IMG/M
3300016294|Ga0182041_11783464All Organisms → cellular organisms → Bacteria570Open in IMG/M
3300016319|Ga0182033_12217603All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium501Open in IMG/M
3300016341|Ga0182035_11253160Not Available663Open in IMG/M
3300016357|Ga0182032_10005158All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00886562Open in IMG/M
3300016357|Ga0182032_11128471All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria673Open in IMG/M
3300016387|Ga0182040_11484008All Organisms → cellular organisms → Bacteria → Proteobacteria575Open in IMG/M
3300016422|Ga0182039_11362643All Organisms → cellular organisms → Bacteria → Proteobacteria644Open in IMG/M
3300017823|Ga0187818_10560311All Organisms → cellular organisms → Bacteria → Proteobacteria515Open in IMG/M
3300017933|Ga0187801_10372894All Organisms → cellular organisms → Bacteria → Proteobacteria590Open in IMG/M
3300017972|Ga0187781_10735137Not Available715Open in IMG/M
3300018090|Ga0187770_11269786Not Available596Open in IMG/M
3300018482|Ga0066669_12043452All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium538Open in IMG/M
3300020199|Ga0179592_10488213All Organisms → cellular organisms → Bacteria → Proteobacteria529Open in IMG/M
3300020580|Ga0210403_10278539All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1371Open in IMG/M
3300021086|Ga0179596_10543058All Organisms → cellular organisms → Bacteria590Open in IMG/M
3300021171|Ga0210405_10189504All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1630Open in IMG/M
3300021377|Ga0213874_10154989All Organisms → cellular organisms → Bacteria801Open in IMG/M
3300021377|Ga0213874_10260032All Organisms → cellular organisms → Bacteria642Open in IMG/M
3300021433|Ga0210391_10988013All Organisms → cellular organisms → Bacteria655Open in IMG/M
3300021439|Ga0213879_10280414Not Available509Open in IMG/M
3300021444|Ga0213878_10198887All Organisms → cellular organisms → Bacteria843Open in IMG/M
3300021475|Ga0210392_10620088All Organisms → cellular organisms → Bacteria803Open in IMG/M
3300021476|Ga0187846_10443960All Organisms → cellular organisms → Bacteria → Proteobacteria532Open in IMG/M
3300021478|Ga0210402_11646171Not Available569Open in IMG/M
3300022717|Ga0242661_1046340All Organisms → cellular organisms → Bacteria799Open in IMG/M
3300025906|Ga0207699_10291831All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1137Open in IMG/M
3300025918|Ga0207662_10327828All Organisms → cellular organisms → Bacteria1023Open in IMG/M
3300025939|Ga0207665_10437172All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1002Open in IMG/M
3300025939|Ga0207665_10852613Not Available721Open in IMG/M
3300026035|Ga0207703_11690066All Organisms → cellular organisms → Bacteria → Proteobacteria609Open in IMG/M
3300026304|Ga0209240_1178753All Organisms → cellular organisms → Bacteria644Open in IMG/M
3300026319|Ga0209647_1278812All Organisms → cellular organisms → Bacteria → Proteobacteria560Open in IMG/M
3300026508|Ga0257161_1073459All Organisms → cellular organisms → Bacteria702Open in IMG/M
3300026530|Ga0209807_1013316All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales4048Open in IMG/M
3300027545|Ga0209008_1023011All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1455Open in IMG/M
3300027576|Ga0209003_1110404All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium522Open in IMG/M
3300027603|Ga0209331_1136721All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300027729|Ga0209248_10062545All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales1136Open in IMG/M
3300027768|Ga0209772_10129520Not Available786Open in IMG/M
3300027812|Ga0209656_10263925All Organisms → cellular organisms → Bacteria809Open in IMG/M
3300027874|Ga0209465_10373575All Organisms → cellular organisms → Bacteria → Proteobacteria714Open in IMG/M
3300028536|Ga0137415_10687026All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria836Open in IMG/M
3300030969|Ga0075394_11953620All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria769Open in IMG/M
3300031546|Ga0318538_10146370All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1246Open in IMG/M
3300031572|Ga0318515_10647647All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium560Open in IMG/M
3300031573|Ga0310915_11226282All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae518Open in IMG/M
3300031573|Ga0310915_11254009All Organisms → cellular organisms → Bacteria → Proteobacteria511Open in IMG/M
3300031679|Ga0318561_10795718All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300031680|Ga0318574_10349162All Organisms → cellular organisms → Bacteria862Open in IMG/M
3300031713|Ga0318496_10827684All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300031723|Ga0318493_10166607All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1148Open in IMG/M
3300031747|Ga0318502_10195665All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1168Open in IMG/M
3300031747|Ga0318502_10261497All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1012Open in IMG/M
3300031751|Ga0318494_10721959All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Thalassospiraceae → Magnetovibrio → Magnetovibrio blakemorei583Open in IMG/M
3300031764|Ga0318535_10374350All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria636Open in IMG/M
3300031765|Ga0318554_10352221All Organisms → cellular organisms → Bacteria837Open in IMG/M
3300031768|Ga0318509_10808755All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300031770|Ga0318521_10090140All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1670Open in IMG/M
3300031771|Ga0318546_10188398All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1405Open in IMG/M
3300031777|Ga0318543_10126636All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1112Open in IMG/M
3300031797|Ga0318550_10496199All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae589Open in IMG/M
3300031797|Ga0318550_10563605All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium548Open in IMG/M
3300031805|Ga0318497_10143087All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1305Open in IMG/M
3300031805|Ga0318497_10435414All Organisms → cellular organisms → Bacteria734Open in IMG/M
3300031805|Ga0318497_10731854All Organisms → cellular organisms → Bacteria → Proteobacteria555Open in IMG/M
3300031846|Ga0318512_10030253All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2316Open in IMG/M
3300031879|Ga0306919_11367899All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300031890|Ga0306925_12023578All Organisms → cellular organisms → Bacteria → Proteobacteria543Open in IMG/M
3300031890|Ga0306925_12061910Not Available536Open in IMG/M
3300031890|Ga0306925_12103762All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300031890|Ga0306925_12159957All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300031893|Ga0318536_10444381All Organisms → cellular organisms → Bacteria653Open in IMG/M
3300031910|Ga0306923_10041090All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales5051Open in IMG/M
3300031912|Ga0306921_10093191All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3482Open in IMG/M
3300031912|Ga0306921_11042568All Organisms → cellular organisms → Bacteria920Open in IMG/M
3300031942|Ga0310916_10345767All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1263Open in IMG/M
3300031946|Ga0310910_10339195All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1186Open in IMG/M
3300031947|Ga0310909_11276052All Organisms → cellular organisms → Bacteria → Proteobacteria591Open in IMG/M
3300031954|Ga0306926_11096489All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria942Open in IMG/M
3300031954|Ga0306926_11169456All Organisms → cellular organisms → Bacteria905Open in IMG/M
3300031962|Ga0307479_11233667All Organisms → cellular organisms → Bacteria710Open in IMG/M
3300032051|Ga0318532_10334997All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium537Open in IMG/M
3300032051|Ga0318532_10369646Not Available509Open in IMG/M
3300032055|Ga0318575_10388665All Organisms → cellular organisms → Bacteria708Open in IMG/M
3300032059|Ga0318533_10183282All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1493Open in IMG/M
3300032067|Ga0318524_10775336All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium507Open in IMG/M
3300032076|Ga0306924_10560237All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1296Open in IMG/M
3300032261|Ga0306920_101750628All Organisms → cellular organisms → Bacteria879Open in IMG/M
3300032515|Ga0348332_11656057All Organisms → cellular organisms → Bacteria822Open in IMG/M
3300032896|Ga0335075_11235477All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium645Open in IMG/M
3300032898|Ga0335072_11486651All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium579Open in IMG/M
3300033134|Ga0335073_10104343All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3659Open in IMG/M
3300033289|Ga0310914_11295655All Organisms → cellular organisms → Bacteria631Open in IMG/M
3300033977|Ga0314861_0233140All Organisms → cellular organisms → Bacteria855Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil29.50%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil15.11%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil10.79%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil7.91%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.32%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.32%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.88%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.88%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil2.16%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.16%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.16%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.44%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.44%
Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil1.44%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.44%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.44%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots1.44%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.72%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.72%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.72%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.72%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.72%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.72%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.72%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.72%
BiofilmEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm0.72%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.72%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005174Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129EnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005902Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_102EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300007258Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010152Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012004Permafrost microbial communities from Nunavut, Canada - A30_5cm_6MEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300017823Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3EnvironmentalOpen in IMG/M
3300017933Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1EnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300020199Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300021086Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021377Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7Host-AssociatedOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021439Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R03EnvironmentalOpen in IMG/M
3300021444Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02EnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021476Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2)EnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300022717Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes)EnvironmentalOpen in IMG/M
3300026319Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes)EnvironmentalOpen in IMG/M
3300026508Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-AEnvironmentalOpen in IMG/M
3300026530Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes)EnvironmentalOpen in IMG/M
3300027545Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027576Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027603Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027729Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027768Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027812Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300030969Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 Emin (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032051Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032515FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)EnvironmentalOpen in IMG/M
3300032896Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033977Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGIcombinedJ26739_10020522233300002245Forest SoilVLYLLGGFAVLSGFLLLVYLFVNADPARLARGLKVTG
Ga0066672_1103337223300005167SoilMLYLLGGFVILCGVLLLGYLFVNTEPARLARTLKWTGITKPPSR*
Ga0066680_1079348313300005174SoilMLYLLGGFAVLSGFLLLVYLFINADPARLARGLKVTGIVIAVLA
Ga0066678_1076239423300005181SoilMPLLSLFGGLAILCGLLLLAYLFVNADPARLAQRLKWIGIGV
Ga0070709_1156880713300005434Corn, Switchgrass And Miscanthus RhizosphereMLYLLGGFAVLSGLLLLVYLFVNADPARLARGLKVTGIVIAVVAVATLAV
Ga0070708_10132621213300005445Corn, Switchgrass And Miscanthus RhizosphereMLYLLGGFAILCGVLLLGYLFVNTEPARLVRTLKWTGIVI
Ga0066701_1063828623300005552SoilMLYLVGGFAILGGLLLLVYLFVNADPARLARGLEVTGIVVAVAAVATL
Ga0066702_1050200423300005575SoilMPLLSLFGGLAILCGLLLLAYLFVNADPARLAQRLKWIGIG
Ga0066903_10109108513300005764Tropical Forest SoilVLYLLGGFAVLSGFLMLVYLFVNADPARLARGLKVTGIVI
Ga0066903_10172056223300005764Tropical Forest SoilMLYLLGGFAILGGLLMLVYLFVNADPARLARNLKWT
Ga0075273_1003951713300005902Rice Paddy SoilMLFLVGGVAILVGLLLLGWLFVNADPARLARGAKWTGI
Ga0070717_1016505013300006028Corn, Switchgrass And Miscanthus RhizosphereMPLLSLFGGLAVLGGLLLLAYLFVNADPARLAQRL
Ga0066696_1065183423300006032SoilMLLLLGGFAILCGLLLLGYLFVNADPAKLARGLKWG
Ga0066696_1109692213300006032SoilMLYLLGGFAVLSGFLLLVYLFVNADPARLARGLKVTGIVMGVLAVATLAIS
Ga0066659_1071429423300006797SoilMPLLSLFGGLAILCGLLLLAYLFVNADPARLAQRL
Ga0066659_1189537413300006797SoilLLSLFGGLAILCGLLLLAYLFVNADPARLAQRLKWIGIGVAALA
Ga0066660_1068767223300006800SoilMLYLLGGFAVLSGFLLLVYLFVNADPARLTRGLKFTGI
Ga0099793_1012657733300007258Vadose Zone SoilMLYLVGGFAILGGLLLLVYLFVNADPARLARGLKVTGIVVAVAAVATLAISGRLA
Ga0099829_1117242413300009038Vadose Zone SoilMLYLLGGFAILCGLLLLVYLFVNADPARLARIVKWAAVVAAIFAVVALIWSER
Ga0099829_1155160913300009038Vadose Zone SoilMLYLLGGFAILIGLLLLGYLFVNADPARLARIVKWAG
Ga0099829_1176695223300009038Vadose Zone SoilMIYLLGGFAVLSGFLLLIYLFVNADPARLARGLKVTGIIIAVAAVATLAI
Ga0099830_1124175313300009088Vadose Zone SoilMLYLLGGFAVLGGFLLLIYLFVNADPARLARGLKVTGIVIAVV
Ga0066709_10426253613300009137Grasslands SoilMLYLLGGFAILGGLLLLVYLFVNADPARLARGLKVSGIVVAIAAVATLAISGRL
Ga0126384_1164083813300010046Tropical Forest SoilMLYLFGGFAILGGLLLLVYLFVNADPARLARGLKVTGIVVAVAAVATLA
Ga0126384_1188777613300010046Tropical Forest SoilMLYLLGGFAVLSGFLLLVYLFVNADPARLARGLKVTGIVIAVVAV
Ga0126318_1066759913300010152SoilMLFLLGGVVLLGGLLLLVYLFVNADPMRLARNLKW
Ga0134084_1012795213300010322Grasslands SoilMPLLSLFGGLAILCGLLLLAYLFVNADPARLAQRLKWIGI
Ga0126372_1042306233300010360Tropical Forest SoilMLYLLGGFAILGGLLMLLYLFVNADPARLARNLKWTGITIAGVAIVLLILL
Ga0126378_1034049813300010361Tropical Forest SoilMIYVLGGFAVLSGFLMLIYLFVNADPARLARGLKVTGIVIAVLAVATLAV
Ga0137392_1040194513300011269Vadose Zone SoilMLYLLGGFAVLSGFLLLIYLFINADPARLARGLKVSGIVIAVLAVATL
Ga0137393_1067630213300011271Vadose Zone SoilMLPLLGGFAILIGLLLLGYLFVNADPARLARIVKWTAIVVAV
Ga0120134_110743813300012004PermafrostMLSLLGGFAILIGLLLLGYLFVNADPARLAKIVKWAGIVLAVLAV
Ga0137363_1092990223300012202Vadose Zone SoilMLYLLGGFAVLSGFLLLIYLFINADPARLARGLKVSGIVIAV
Ga0137399_1031930433300012203Vadose Zone SoilMLYLLGGVAILCGFLLLGYLFVNADPARLAKIVKW
Ga0137362_1057951813300012205Vadose Zone SoilMLYLLGGFAVLSGFLLLVYLFINADPARLARGLKVTGIVIAV
Ga0137360_1117359413300012361Vadose Zone SoilMLYLLGGFAVLSGFLLLIYLFINADPARLARGLKVSGIVIAVLAVATLAVSGRLAAL
Ga0137394_1136165223300012922Vadose Zone SoilMLYLLGGFAVLSGFLLLIYLFINADPARLARGLKVSGIVIAVLAVATLA
Ga0126375_1052950113300012948Tropical Forest SoilMVYLLGGFAILGGLLMLVYLFVNADPARLARNLKWTG
Ga0164300_1087272323300012951SoilMLYLLGGFAVLSGSLMLVYVFVNADPARLARGLKATGVVIAILAVATLAISGRL
Ga0164299_1085594023300012958SoilMLYLLGGFAVLSGFLLLIYLFVNADPARLARGLKVTGIVIAVLAVA
Ga0126369_1027009313300012971Tropical Forest SoilMLYLLGGFAVLTGFLLLVYLFVNADPARLARGLKVTGIVIAV
Ga0134087_1016790313300012977Grasslands SoilMLFLLGGFAILCGLLLLGYLFVNAEPAKLARNLKWGGLAG
Ga0182024_1054060633300014501PermafrostMLYLIGGLAILGGLMLLLYLFINADPAKLATGTKWVLVGLAVAL
Ga0182036_1087484023300016270SoilMLYLLGGFALLSGFLMLVYLFVNADPARLARGLKVTGIVIAVLAVATLAIS
Ga0182041_1106963213300016294SoilMIYVLGGFAVIVGFLMLVYLFVNADPARLARGLKATGIVIAIFAV
Ga0182041_1178346423300016294SoilVLYLLGGFAVLSGFLMLVYLFVNADPARLARGLKVTGIV
Ga0182033_1221760323300016319SoilMLYLLGGFAVLSGFLLLVYLFVNADPARLARGLKVTGI
Ga0182035_1125316023300016341SoilMLYLVGGFAVLGGFLLLVHLFVNADPARLARNLKWAGIAIGAVAVVA
Ga0182032_1000515873300016357SoilMLYLLGGFAVLSGFLLLVYLFVNADPARLARGLKV
Ga0182032_1112847123300016357SoilMLYLLGGFALLSGFLMLVYLFVNADPARLARGLKVTGIVIAVLAVATLAISG
Ga0182040_1148400813300016387SoilMLYLVGGFAVLGGFLLLVHLFVNADPARLARNLKWAGIAIGAAAIT
Ga0182039_1136264313300016422SoilMLYLVGGFAVLGGFLLLVHLFVNADPARLARNLKWAGIAIGAVA
Ga0187818_1056031123300017823Freshwater SedimentMLFLLGGVLLLGGFLLLVYLFVNADPVRLARNLKWA
Ga0187801_1037289413300017933Freshwater SedimentMLFLLGGVLLLGGFLLLVYLFVNADPVRLARNLKWTGI
Ga0187781_1073513723300017972Tropical PeatlandMLALVGGVAILVGLLLLVYLFVNANPAKLARGLKW
Ga0187770_1126978613300018090Tropical PeatlandMIYLLGGFAILSGFLMLIYLFVNADPARLARGLKVTGIVIAVLAVATL
Ga0066669_1204345223300018482Grasslands SoilMLYLLGGFAVLGGFLLLVYLFVNADPARLARGLKVTGIIIAVVA
Ga0179592_1048821313300020199Vadose Zone SoilMLYLVGGFALLSGFLLLVYLFVNADPARLARGLKVTGVVVAVAA
Ga0210403_1027853933300020580SoilMLYLLGGFAVLSGFLMLVYLFVNADPARLARGLKATGIVIAVLAV
Ga0179596_1054305813300021086Vadose Zone SoilMPLLSLFGGLAILCGLLLLAYLFVNADPARLAQRLKWIG
Ga0210405_1018950433300021171SoilVLYLLGGFAVLSGFLLLVYLFVNADPARLARGLKVTGIVIAVAAVAT
Ga0213874_1015498923300021377Plant RootsMLYLLGGFAVLSGFLLLVYLFVNADPARLARGLKVTAVIIGVVAVATLAI
Ga0213874_1026003213300021377Plant RootsMLYLLGGFAVLSGFLLLVYLFVNADPARLARGLKVTGIVI
Ga0210391_1098801313300021433SoilMLFLFGGVALLGGFLLLVYLFANADPVRLARNLKWTGIGLAAFAVI
Ga0213879_1028041423300021439Bulk SoilMIYLLGGFAILTGFLMLVYLFVNADPARLARGLKVTGI
Ga0213878_1019888713300021444Bulk SoilMLFLLGGVVLLVGFLLLVYLFVNADPAKLARNLKWT
Ga0210392_1062008823300021475SoilVLYLLGGFAVLSGFLLLVYLFVNADPARLARGLKVTGIVVAVAAFATLAIS
Ga0187846_1044396023300021476BiofilmMIYVLGGFAILGGFLMLVYLFVNADPARLARGLKVTGIVIAV
Ga0210402_1164617123300021478SoilMLYLLGGFAVLSGFLLLIYLFVNADPARLARGLKVSGIVIAVLAVA
Ga0242661_104634013300022717SoilMLYLLGGFAILSGFLLLVYLFVNADPARLARGLKV
Ga0207699_1029183133300025906Corn, Switchgrass And Miscanthus RhizosphereVLYLLGGFAVLSGFLLLVYLFVNADPARLARGLKVTGI
Ga0207662_1032782823300025918Switchgrass RhizosphereMLYFLGGFAILCGLLLLGWVFVNTSPARLARVLKWT
Ga0207665_1043717233300025939Corn, Switchgrass And Miscanthus RhizosphereMLYLLGGFAVLSGFLLLIYLFVNADPARLARGLKVTGI
Ga0207665_1085261313300025939Corn, Switchgrass And Miscanthus RhizosphereVLYLLGGFAVLSGFLLLVYLFVNADPARLARGLKVT
Ga0207703_1169006623300026035Switchgrass RhizosphereMLQLRGGFGILCGLLLLGWVFVNTSPTVLARVLKWA
Ga0209240_117875323300026304Grasslands SoilMLYLLGGFAILCGVLLLGYLFVNAEPARLARILKWSGIVVAGL
Ga0209647_127881213300026319Grasslands SoilMLFLLGGFAILCGVLLLGYLFVNADPAKLARTVKWAGLGGGVV
Ga0257161_107345923300026508SoilMLYLLGGFAILCGVLLLGYLFVNTEPARLARTLKWTG
Ga0209807_101331613300026530SoilMPLLSLFGGLAILCGLLLLAYLFVNADPARLAQRLKWI
Ga0209008_102301133300027545Forest SoilMLAVLGGVTILAGLLLLIYLFVNADPAKLARGLKWT
Ga0209003_111040413300027576Forest SoilMLYLLGGFAVLSGFLLLVYLFVNADPARLARLLNDPAR
Ga0209331_113672123300027603Forest SoilMLYLIGGFAILGGLLLLVYLFVNADPARLARGLKVSGIVVA
Ga0209248_1006254533300027729Bog Forest SoilMLYFLGGFAVLSGFLMLVYLFVNADPARLARGLKVTGIVIAVLAVATLA
Ga0209772_1012952023300027768Bog Forest SoilMLPLLGGFAILCGLLLLGYLFVNANPTRLARIVKWGG
Ga0209656_1026392523300027812Bog Forest SoilMLYLLGGFAVLGGFLLLVYLFVNADPARLARGLKVTGIVIA
Ga0209465_1037357513300027874Tropical Forest SoilMIYVLGGFAILGGFLLLVYLFVNADPARLARGLKVTGIV
Ga0137415_1068702623300028536Vadose Zone SoilMLYLLGGFAVLSGFLLLIYLFVNADPARLARGLKVSGIVIAVLAVATLAVSG
Ga0075394_1195362013300030969SoilMLYLIGGFAILGGFLLLVYLFVNADPARLARGLKVTGIVIAVLAVVTLAIS
Ga0318538_1014637033300031546SoilMLYVLGGFALLSGFLMLVYLFVNADPARLARGLKVTGIVIAI
Ga0318515_1064764713300031572SoilMIYVLGGFAVLGGFLMLVYLFVNADPARLARGLKATGIVIAI
Ga0310915_1122628213300031573SoilMIYVLGGFAVLGGFLMLVYLFVNADPARLARGLKVTGIVIAVLAVATLAISGR
Ga0310915_1125400923300031573SoilMLYVLGGFALLSGFLMLVYLFVNADPARLARGLKVTGIVIA
Ga0318561_1079571813300031679SoilMLYLLGGFAILGGLLMLVYLFVNADPTRLARNLKWTG
Ga0318574_1034916223300031680SoilMLYLLGGFALLSGFLMLVYLFVNADPARLARGLKVTGIVIAV
Ga0318496_1082768423300031713SoilMIYVLGGFAVLGGFLMLVYLFVNADPARLARGLKATGIVIAILA
Ga0318493_1016660713300031723SoilMLYLLGGFALLSGFLMLVYLFVNADPARLARGLKVT
Ga0318502_1019566513300031747SoilMLFLLGGLAILGGFLLLVYLFANADPARLARNLKWAGIAVAAVAV
Ga0318502_1026149733300031747SoilMLYVLGGFALLSGFLMLVYLFVNADPARLARGLNV
Ga0318494_1072195913300031751SoilMLYLLGGFAILGGLLMLVYLFVNADPARLARNLKWTGITIAGVAIV
Ga0318535_1037435013300031764SoilMIYVLGGFAVLSGFLMLVYLFVNADPVRLARGLKVTGIVIAVLAVATLAIS
Ga0318554_1035222123300031765SoilMLYLIGGFAVLGGFLLLVHLFVNADPARLARNLKWAGIAVGAVAV
Ga0318509_1080875523300031768SoilMIYVLGGFAVLSGFLMLVYLFVNADPVRLARGLKVTG
Ga0318521_1009014013300031770SoilMLYVLGGFALLSGFLMLVYLFVNADPARLARGLKVTG
Ga0318546_1018839833300031771SoilMLYFLGGFAVLGGFLLLIYLFVNADPARLARGLKVTGIVIAVLAV
Ga0318543_1012663613300031777SoilMLYVLGGFALLSGFLMLVYLFVNADPARLARGLKVT
Ga0318550_1049619913300031797SoilMLYLLGGFAVLSGFLMLVYLFVNADPARLARGLKVTGVVIAVLAVATLAI
Ga0318550_1056360523300031797SoilMLYLLGGFAVLSGFLLLVYLFVNADPARLARGLKVTGIVIAVVAVA
Ga0318497_1014308733300031805SoilMLYLLGGFAILGGLLMLVYLFVNADPTRLARNLKWTGIT
Ga0318497_1043541423300031805SoilMLYLLGGFAVLGGFLLLIYLFVNADPARLARGLKVTGIVIAVLA
Ga0318497_1073185423300031805SoilMLFLLGGLAILGGFLLLVYLFANADPARLARNLKWASIAVAAVA
Ga0318512_1003025333300031846SoilMLYLLGGFAVLSGFLMLVYLFVNADPARLARGLKVTGVVIAVLA
Ga0306919_1136789913300031879SoilMIYLLGGFAVLSGFLMLVYLFVNADPARLARGLKVTGIVI
Ga0306925_1202357823300031890SoilMLYLVGGFAVLGGFLLLVYLFVNADPARLARNLKWAGIAVAAVVVIAVILL
Ga0306925_1206191013300031890SoilMIYLLGGFAILCGFLLLVYLFVNADPAHLEAAGEA
Ga0306925_1210376223300031890SoilMLYLLGGFALLGGFLLLVHLFVNADPARLARNLKWAGIAIG
Ga0306925_1215995723300031890SoilMIYVLGGFAVLSGFLMLVYLFVNADPVRLARGLKVTGI
Ga0318536_1044438123300031893SoilMLYVLGGFALLSGFLMLVYLFVNADPARLARGLKVTGIVI
Ga0306923_1004109013300031910SoilMLYVLGGFALLSGFLMLVYLFVNADPARLARGLKV
Ga0306921_1009319113300031912SoilMLYLLGGFAVLGGFLLLIYLFVNADPARLARGLKVTG
Ga0306921_1104256833300031912SoilMLYLLGGFAVLSGFLLLVYLFVNADPARLARGLKIT
Ga0310916_1034576713300031942SoilMIYLLGGFAVLSGFLMLVYLFVNADPARLARGLKVTGIVIAVLAVATL
Ga0310910_1033919533300031946SoilMLYLLGGFALLSGFLMLVYLFVNADPARLARGLKVTGIV
Ga0310909_1127605213300031947SoilMLYLLGGFAVLGGFLLLIYLFVNADPARLARGLKVTGIVIAVL
Ga0306926_1109648913300031954SoilMLYLLGGFAVLSGFLMLVYLFVNADPARLARGLKVTGVVIA
Ga0306926_1116945623300031954SoilMLYLVGGFAVLGGFLLLVHLFVNADPARLARNLKWAAIAVGGVAV
Ga0307479_1123366713300031962Hardwood Forest SoilMLYLLGGFAVLSGFLMLVYLFVNADPARLARGLKVTGIVIAVA
Ga0318532_1033499713300032051SoilMIYVLGGFAVIVGFLMLVYLFVNADPARLARGLKATGIVIAIFAVAT
Ga0318532_1036964623300032051SoilLPELLLLGGFAILCGLLLLGYLFVNADPARLARVLKWTGIVLGA
Ga0318575_1038866513300032055SoilMLYLLGGFAVLSGFLMLVYLFVNADPARLARGLKVTGIVI
Ga0318533_1018328233300032059SoilMLYLLGGFAVLTGFLLLVYLFVNADPARLARGLKVSGI
Ga0318524_1077533623300032067SoilMIYVLGGFAVLSGFLMLVYLFVNADPVRLARGLKVTGIVIAVLAVATLA
Ga0306924_1056023733300032076SoilMLYLLGGFAVLSGFLMLVYLFVNADPARLARGLKVT
Ga0306920_10175062813300032261SoilMLYLVGGIAVLAGFLLLVQVFVNADPAWLARHLKWTGIAVGAVAV
Ga0348332_1165605723300032515Plant LitterMLFLLGGFAVLGGVLLLVYLFANADPARLARNLKW
Ga0335075_1123547713300032896SoilMPELALLGGVLILGGLLLLVYLFVNTDPAKLARALKW
Ga0335072_1148665123300032898SoilMLALLGGLLVLAGLLLLVYLFVNADPAKLASGLKWVAIGLA
Ga0335073_1010434343300033134SoilMLFLLGGVALLAGFLLLVYSFVNADPVRLARNLKWTGIGIAAVA
Ga0310914_1129565523300033289SoilMLYLLGGFAVLSGLLLLVYLFVNADPARLARGLRVTGIVIAVAAVAT
Ga0314861_0233140_723_8543300033977PeatlandMLALVGGVAILVGLLLLVYLFVNADPAKLARALKWTAIGAAGLI

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.