NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F054380

Metagenome / Metatranscriptome Family F054380

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F054380
Family Type Metagenome / Metatranscriptome
Number of Sequences 140
Average Sequence Length 37 residues
Representative Sequence VAQKLSEYKRKRDPKQTPEPFGSKKGKAKEPIFVVQRH
Number of Associated Samples 126
Number of Associated Scaffolds 140

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 57.55 %
% of genes near scaffold ends (potentially truncated) 99.29 %
% of genes from short scaffolds (< 2000 bps) 97.86 %
Associated GOLD sequencing projects 125
AlphaFold2 3D model prediction Yes
3D model pTM-score0.25

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (71.429 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(18.571 % of family members)
Environment Ontology (ENVO) Unclassified
(26.429 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(52.143 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 15.15%    β-sheet: 0.00%    Coil/Unstructured: 84.85%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.25
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 140 Family Scaffolds
PF02735Ku 27.86
PF03255ACCA 12.86
PF01039Carboxyl_trans 12.14
PF00296Bac_luciferase 0.71
PF01168Ala_racemase_N 0.71
PF00583Acetyltransf_1 0.71
PF01068DNA_ligase_A_M 0.71
PF01255Prenyltransf 0.71

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 140 Family Scaffolds
COG1273Non-homologous end joining protein Ku, dsDNA break repairReplication, recombination and repair [L] 27.86
COG0825Acetyl-CoA carboxylase alpha subunitLipid transport and metabolism [I] 25.00
COG0777Acetyl-CoA carboxylase beta subunitLipid transport and metabolism [I] 12.14
COG4799Acetyl-CoA carboxylase, carboxyltransferase componentLipid transport and metabolism [I] 12.14
COG0020Undecaprenyl pyrophosphate synthaseLipid transport and metabolism [I] 0.71
COG1423ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) familyReplication, recombination and repair [L] 0.71
COG1793ATP-dependent DNA ligaseReplication, recombination and repair [L] 0.71
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 0.71

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms71.43 %
UnclassifiedrootN/A28.57 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459003|FZ032L002HVJYSNot Available508Open in IMG/M
2228664021|ICCgaii200_c0857464All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300000886|AL3A1W_1022437All Organisms → cellular organisms → Bacteria1029Open in IMG/M
3300001686|C688J18823_10787259All Organisms → cellular organisms → Bacteria604Open in IMG/M
3300003321|soilH1_10128400All Organisms → cellular organisms → Bacteria1277Open in IMG/M
3300005180|Ga0066685_10390481Not Available967Open in IMG/M
3300005181|Ga0066678_10579402All Organisms → cellular organisms → Bacteria745Open in IMG/M
3300005186|Ga0066676_11151478All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300005450|Ga0066682_10568408All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis716Open in IMG/M
3300005451|Ga0066681_10612065All Organisms → cellular organisms → Bacteria670Open in IMG/M
3300005543|Ga0070672_100782656All Organisms → cellular organisms → Bacteria839Open in IMG/M
3300005546|Ga0070696_100927476All Organisms → cellular organisms → Bacteria724Open in IMG/M
3300005549|Ga0070704_100558947All Organisms → cellular organisms → Bacteria1001Open in IMG/M
3300005553|Ga0066695_10472564All Organisms → cellular organisms → Bacteria772Open in IMG/M
3300005554|Ga0066661_10463249All Organisms → cellular organisms → Bacteria772Open in IMG/M
3300005556|Ga0066707_10426069All Organisms → cellular organisms → Bacteria862Open in IMG/M
3300005558|Ga0066698_10065433All Organisms → cellular organisms → Bacteria2332Open in IMG/M
3300005558|Ga0066698_10842263All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium591Open in IMG/M
3300005560|Ga0066670_10950682All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia524Open in IMG/M
3300005561|Ga0066699_10809266All Organisms → cellular organisms → Bacteria659Open in IMG/M
3300005562|Ga0058697_10493002All Organisms → cellular organisms → Bacteria624Open in IMG/M
3300005569|Ga0066705_10751567All Organisms → cellular organisms → Bacteria584Open in IMG/M
3300005574|Ga0066694_10484121All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300005575|Ga0066702_10291010All Organisms → cellular organisms → Bacteria996Open in IMG/M
3300005576|Ga0066708_10535380All Organisms → cellular organisms → Bacteria755Open in IMG/M
3300005576|Ga0066708_10616549All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia694Open in IMG/M
3300005578|Ga0068854_101873546All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300005764|Ga0066903_100773536All Organisms → cellular organisms → Bacteria1711Open in IMG/M
3300005897|Ga0075281_1036591All Organisms → cellular organisms → Bacteria737Open in IMG/M
3300005901|Ga0075274_1086167Not Available521Open in IMG/M
3300006028|Ga0070717_11362407All Organisms → cellular organisms → Bacteria644Open in IMG/M
3300006031|Ga0066651_10667367All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia556Open in IMG/M
3300006163|Ga0070715_10436563All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium736Open in IMG/M
3300006804|Ga0079221_11202998All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300006854|Ga0075425_102742730All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia543Open in IMG/M
3300006871|Ga0075434_100393340All Organisms → cellular organisms → Bacteria1407Open in IMG/M
3300006881|Ga0068865_100889284All Organisms → cellular organisms → Bacteria774Open in IMG/M
3300006954|Ga0079219_11001277All Organisms → cellular organisms → Bacteria693Open in IMG/M
3300006954|Ga0079219_11941509All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia557Open in IMG/M
3300007764|Ga0102950_1285227Not Available514Open in IMG/M
3300009012|Ga0066710_102569216All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium734Open in IMG/M
3300009098|Ga0105245_10241824All Organisms → cellular organisms → Bacteria1750Open in IMG/M
3300009156|Ga0111538_10577851All Organisms → cellular organisms → Bacteria1425Open in IMG/M
3300009174|Ga0105241_11180310All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria724Open in IMG/M
3300009174|Ga0105241_11621461All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria626Open in IMG/M
3300009176|Ga0105242_10604998All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1059Open in IMG/M
3300009177|Ga0105248_13292747All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium514Open in IMG/M
3300009551|Ga0105238_12047322Not Available606Open in IMG/M
3300010036|Ga0126305_10261207All Organisms → cellular organisms → Bacteria1116Open in IMG/M
3300010040|Ga0126308_10543802All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria788Open in IMG/M
3300010321|Ga0134067_10024119All Organisms → cellular organisms → Bacteria1849Open in IMG/M
3300010323|Ga0134086_10449281All Organisms → cellular organisms → Bacteria → Terrabacteria group526Open in IMG/M
3300010336|Ga0134071_10293120All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria816Open in IMG/M
3300010366|Ga0126379_11280635Not Available839Open in IMG/M
3300010397|Ga0134124_10236118All Organisms → cellular organisms → Bacteria1676Open in IMG/M
3300010398|Ga0126383_13668043All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium502Open in IMG/M
3300011003|Ga0138514_100045613Not Available873Open in IMG/M
3300012001|Ga0120167_1078889All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium688Open in IMG/M
3300012189|Ga0137388_11849994Not Available535Open in IMG/M
3300012198|Ga0137364_10492944Not Available921Open in IMG/M
3300012200|Ga0137382_10026066All Organisms → cellular organisms → Bacteria3433Open in IMG/M
3300012207|Ga0137381_10793708Not Available821Open in IMG/M
3300012210|Ga0137378_11093761Not Available712Open in IMG/M
3300012211|Ga0137377_11817254All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300012349|Ga0137387_11281987All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium513Open in IMG/M
3300012351|Ga0137386_10651339All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium758Open in IMG/M
3300012351|Ga0137386_11084662All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300012362|Ga0137361_10792647Not Available862Open in IMG/M
3300012476|Ga0157344_1020316All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria567Open in IMG/M
3300012913|Ga0157298_10385355Not Available528Open in IMG/M
3300012915|Ga0157302_10383154All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium574Open in IMG/M
3300012930|Ga0137407_11130050All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria743Open in IMG/M
3300012951|Ga0164300_10775107All Organisms → cellular organisms → Bacteria591Open in IMG/M
3300012955|Ga0164298_11602582All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium513Open in IMG/M
3300012977|Ga0134087_10134717Not Available1063Open in IMG/M
3300012977|Ga0134087_10813778All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium507Open in IMG/M
3300012987|Ga0164307_11139506All Organisms → cellular organisms → Bacteria643Open in IMG/M
3300012987|Ga0164307_11645791Not Available544Open in IMG/M
3300012988|Ga0164306_10166374All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia1518Open in IMG/M
3300012988|Ga0164306_11151403All Organisms → cellular organisms → Bacteria648Open in IMG/M
3300012989|Ga0164305_10218110Not Available1355Open in IMG/M
3300013102|Ga0157371_10219251Not Available1366Open in IMG/M
3300013297|Ga0157378_10488253Not Available1228Open in IMG/M
3300014311|Ga0075322_1177531All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium535Open in IMG/M
3300015077|Ga0173483_10841475All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria534Open in IMG/M
3300015077|Ga0173483_10933352Not Available514Open in IMG/M
3300015262|Ga0182007_10433116All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria505Open in IMG/M
3300015373|Ga0132257_104439129Not Available510Open in IMG/M
3300017659|Ga0134083_10232419All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria768Open in IMG/M
3300017792|Ga0163161_10497053Not Available993Open in IMG/M
3300018078|Ga0184612_10258801Not Available898Open in IMG/M
3300018433|Ga0066667_10611042All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium910Open in IMG/M
3300018482|Ga0066669_10377355Not Available1190Open in IMG/M
3300018482|Ga0066669_11422684All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria628Open in IMG/M
3300018482|Ga0066669_11811219Not Available564Open in IMG/M
3300019269|Ga0184644_1804371All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria505Open in IMG/M
3300019875|Ga0193701_1085491All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium605Open in IMG/M
3300021441|Ga0213871_10296334All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria521Open in IMG/M
3300021445|Ga0182009_10621031All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria580Open in IMG/M
3300022694|Ga0222623_10051375All Organisms → cellular organisms → Bacteria1586Open in IMG/M
3300024323|Ga0247666_1011815All Organisms → cellular organisms → Bacteria1914Open in IMG/M
3300025885|Ga0207653_10115549Not Available962Open in IMG/M
3300025913|Ga0207695_10390546Not Available1276Open in IMG/M
3300025924|Ga0207694_11427370All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium585Open in IMG/M
3300025931|Ga0207644_11752826Not Available520Open in IMG/M
3300025945|Ga0207679_10913329All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi803Open in IMG/M
3300025949|Ga0207667_11734827All Organisms → cellular organisms → Bacteria590Open in IMG/M
3300025960|Ga0207651_11509153All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium605Open in IMG/M
3300025990|Ga0208527_1027780Not Available685Open in IMG/M
3300026075|Ga0207708_10965756Not Available739Open in IMG/M
3300026078|Ga0207702_10882021Not Available886Open in IMG/M
3300027869|Ga0209579_10620473All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium586Open in IMG/M
3300028712|Ga0307285_10041098All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1134Open in IMG/M
3300028716|Ga0307311_10229667All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300028718|Ga0307307_10028333All Organisms → cellular organisms → Bacteria1581Open in IMG/M
3300028722|Ga0307319_10068390Not Available1123Open in IMG/M
3300028755|Ga0307316_10232158All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium668Open in IMG/M
3300028755|Ga0307316_10260496All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria631Open in IMG/M
3300028768|Ga0307280_10098486Not Available970Open in IMG/M
3300028771|Ga0307320_10118842All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1012Open in IMG/M
3300028807|Ga0307305_10102756Not Available1320Open in IMG/M
3300028811|Ga0307292_10101687All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1130Open in IMG/M
3300028824|Ga0307310_10532318Not Available594Open in IMG/M
3300028881|Ga0307277_10452750All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium575Open in IMG/M
3300028885|Ga0307304_10390459All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria627Open in IMG/M
3300030336|Ga0247826_10462312All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria951Open in IMG/M
3300031057|Ga0170834_111556803Not Available606Open in IMG/M
3300031231|Ga0170824_107089235Not Available867Open in IMG/M
3300031455|Ga0307505_10532548All Organisms → cellular organisms → Bacteria568Open in IMG/M
3300031548|Ga0307408_100573169All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria999Open in IMG/M
3300031740|Ga0307468_100716702Not Available839Open in IMG/M
3300031740|Ga0307468_100941584All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria753Open in IMG/M
3300031793|Ga0318548_10480277All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium608Open in IMG/M
3300031912|Ga0306921_10761728Not Available1108Open in IMG/M
3300031996|Ga0308176_11990379All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium621Open in IMG/M
3300032002|Ga0307416_103049242Not Available560Open in IMG/M
3300032010|Ga0318569_10481760All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium578Open in IMG/M
3300033550|Ga0247829_10737593All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria820Open in IMG/M
3300034026|Ga0334946_030853All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → unclassified Frankiales → Frankiales bacterium890Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil18.57%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil13.57%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil7.86%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil4.29%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.29%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.57%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere3.57%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.14%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.14%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.14%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil2.14%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.14%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.14%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere2.14%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.43%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil1.43%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost1.43%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.43%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.43%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.43%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.43%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.43%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.71%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.71%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.71%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.71%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.71%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.71%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil0.71%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.71%
Sub-Biocrust SoilEnvironmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil0.71%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.71%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.71%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.71%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.71%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.71%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.71%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.71%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.71%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.71%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.71%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.71%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.71%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.71%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.71%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.71%
AgaveHost-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave0.71%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459003Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cmEnvironmentalOpen in IMG/M
2228664021Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000886Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-65cm-3A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300001686Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300003321Sugarcane bulk soil Sample H1EnvironmentalOpen in IMG/M
3300005180Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134EnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005450Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131EnvironmentalOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005562Agave microbial communities from Guanajuato, Mexico - As.Ma.eHost-AssociatedOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005574Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143EnvironmentalOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005897Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_103EnvironmentalOpen in IMG/M
3300005901Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_201EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007764Soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_D2_MGEnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300010036Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26EnvironmentalOpen in IMG/M
3300010040Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55EnvironmentalOpen in IMG/M
3300010321Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015EnvironmentalOpen in IMG/M
3300010323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010336Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300011003Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015EnvironmentalOpen in IMG/M
3300012001Permafrost microbial communities from Nunavut, Canada - A24_80cm_12MEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012476Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610Host-AssociatedOpen in IMG/M
3300012913Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2EnvironmentalOpen in IMG/M
3300012915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300014311Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D1EnvironmentalOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015262Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaGHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300017659Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300018078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coexEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019269Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019875Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2EnvironmentalOpen in IMG/M
3300021441Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1Host-AssociatedOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300022694Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coexEnvironmentalOpen in IMG/M
3300024323Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK07EnvironmentalOpen in IMG/M
3300025885Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025990Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_102 (SPAdes)EnvironmentalOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027869Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028712Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139EnvironmentalOpen in IMG/M
3300028716Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198EnvironmentalOpen in IMG/M
3300028718Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194EnvironmentalOpen in IMG/M
3300028722Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368EnvironmentalOpen in IMG/M
3300028755Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356EnvironmentalOpen in IMG/M
3300028768Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119EnvironmentalOpen in IMG/M
3300028771Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028811Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300028885Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185EnvironmentalOpen in IMG/M
3300030336Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031455Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_SEnvironmentalOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300033550Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4EnvironmentalOpen in IMG/M
3300034026Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 42SMSEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
E4A_107854702170459003Grass SoilVADKLREYERKRDPKQTPEPFTSSRSGSKAPIFVV
ICCgaii200_085746422228664021SoilMASLRDYERKRDQKKTPEPFGGRKKRAKSPIFVVQRH
AL3A1W_102243713300000886PermafrostVAAPRLREYRRKRDAAGTPEPFTGKKKGKQPIFVVQRH
C688J18823_1078725923300001686SoilMAQKLSEYRRKRDPKQTPEPFGAKRGREKDPIFVVQRHD
soilH1_1012840033300003321Sugarcane Root And Bulk SoilVSKKLSEYERKRDRKQTPEPFGGKRGRAKEPIFVVQRHDA
Ga0066685_1039048123300005180SoilVASQNLKEYRRKRDPKKTSEPFGKGKKRGKQPIFVVQRHD
Ga0066678_1057940223300005181SoilVSLREYERKRDPKKTKEPFPSKRRGRKAKGPIFVVQRHDARRL
Ga0066676_1115147823300005186SoilMSSKSQKRLSEYRGKRDPNKTPEPFGSRKRRAAPLFVVQRHQ
Ga0066682_1056840813300005450SoilMAEKLSEYRRRRDPKQTPEPFGAKGAKPKEPIFVVQRHDA
Ga0066681_1061206513300005451SoilVARLTEYERKRDPKKTPEPFTGKRGKTKQPIFVVQRHDAR
Ga0070672_10078265623300005543Miscanthus RhizosphereMATLRDYERKRDRKKTPEPFGGREGRKKGPIFVVQRHDAR
Ga0070696_10092747623300005546Corn, Switchgrass And Miscanthus RhizosphereMAQKLSEYRRKRDPKKTPEPGLKGREVSPAEAERPIFVVQRHDA
Ga0070704_10055894713300005549Corn, Switchgrass And Miscanthus RhizosphereMAKEKLSEYRRKRDPKQTPEPFAGKRGKTKEPIFVVQRHDA
Ga0066695_1047256413300005553SoilVSGSELGEYKRKRDPKQTPEPFSSRRKRTKDPIFV
Ga0066661_1046324923300005554SoilVAKSELREYRRKRDPKKTPEPFGGKKRGKQPIFVVQ
Ga0066707_1042606923300005556SoilMTEKLSEYRRKRDPKATPEPFAAAKRRAKEPIFVVQRH
Ga0066698_1006543343300005558SoilVSGSELGEYKRKRDPKQTPEPFSSRRKRTKNPIFVVQRHDA
Ga0066698_1084226313300005558SoilVASQNLKEYRRKRDPKKTSEPFGKGKKRGKQPIFVVQRH
Ga0066670_1095068223300005560SoilVPRAKLTEYERKRDRKKTPEPFGAKRGKTKEPIFVVQRHDA
Ga0066699_1080926623300005561SoilVAGRKLAEYERKRTRGKTPEPFGAGERGRAQPIFVVQR
Ga0058697_1049300213300005562AgaveVARLREYERKRDRKKTPEPFGGSGRRGKKPIFVVQR
Ga0066705_1075156723300005569SoilVASRRLTEYRRKRDPKKTSEPFGGRKRRPKDPIFVVQRHDA
Ga0066694_1048412123300005574SoilVSLSEYERKRNRKKTPEPFSGKRKRKEPIFVVQRH
Ga0066702_1029101013300005575SoilVATQKLTEYRRKRDPKQTSEPFGKGKKKGKQPIFVVQ
Ga0066708_1053538023300005576SoilVSLREYERKRDPKKTPEPFKGKRKSKQPTFVVQRHDA
Ga0066708_1061654923300005576SoilVARPRLSEYERKRDPGKTPEPFSGRRGRRKQPIFVVQRH
Ga0068854_10187354613300005578Corn RhizosphereVPKAKLAEYKRKRDPKKTPEPFGSKKGGKEPIFVVQ
Ga0066903_10077353633300005764Tropical Forest SoilVPEKLTEYERKRDPKRTPEPFGAKKRRAKEPIFVIQRHDAR
Ga0066903_10910606813300005764Tropical Forest SoilVSLSDYRRKRTPGKTPEPFEDGGATDGAPIFVVQRHDAR
Ga0075281_103659133300005897Rice Paddy SoilVNLREYEHKRKPKQTPEPFESHDGGDGDGAPIFVVQRHD
Ga0075274_108616713300005901Rice Paddy SoilVSRKLSEYERRRDRKQTPEPFGLPGREPKANRASLD
Ga0070717_1136240723300006028Corn, Switchgrass And Miscanthus RhizosphereVSKKLSEYERKRNRRQTPEPFGGRRTKAKAPIFVVQRH
Ga0066651_1066736713300006031SoilVAKAKLADYKKKRDPRKTPEPFGSSKRGKKPIFVI
Ga0070715_1043656313300006163Corn, Switchgrass And Miscanthus RhizosphereVTVENLTEYRRKRDRTKTSEPFSSKRKRGKQPIFVVQ
Ga0079221_1120299823300006804Agricultural SoilVSKKLSEYERKRSRKQTPEPFGGKRGKAKELTFVVQRHDA
Ga0075425_10274273023300006854Populus RhizosphereVSAEKLGEYKRKRDPKQTPEPFSSKRGGKKDPIFVVQRHDA
Ga0075434_10039334033300006871Populus RhizosphereMSDRLREYRRKRDPKQTSEPFRSEKSRKDGSPIFV
Ga0068865_10088928413300006881Miscanthus RhizosphereVAEKLSEYKRKRDPGKTPEPFGAKKGKTKDPIFVVQRH
Ga0079219_1100127743300006954Agricultural SoilMAKLAAYKRKRDPAKTPEPFGGKLRGGAPTFVIQR
Ga0079219_1194150913300006954Agricultural SoilVPRAKLTDYERKRDPKKTPEPFGGKRDRAKAPIFVVQRHD
Ga0102950_128522723300007764SoilVSLREYERKRNRKQTPEPFEGRGGDGAPVFVVQRHDA
Ga0066710_10256921623300009012Grasslands SoilVASQKLEEYRRKRDPKETSEPFGTGKRRGKQPIFVIQRH
Ga0105245_1024182413300009098Miscanthus RhizosphereMASLRDYERKRDRKKTPEPFSGRKKRAKSPIFVVQRH
Ga0111538_1057785113300009156Populus RhizosphereVSLREYRRKRDPKKTSEPFAEPRRGKRKEPIFVVQRHD
Ga0105241_1118031023300009174Corn RhizosphereVSLKEYRRKRDPKKTGEPFTGKRKGKKPIFVVQRHD
Ga0105241_1162146113300009174Corn RhizosphereVPEDRLSDYRRKRDPKATPEPFGAGKRGKQPTFVL
Ga0105242_1060499813300009176Miscanthus RhizosphereVAQKLSEYKRKRDPKQTPEPFGSKKGKAKDPIFVVQ
Ga0105248_1329274713300009177Switchgrass RhizosphereVSKKLSEYERKRDRKKTPEPFGSRARNKDPIFVVQRH
Ga0105238_1204732213300009551Corn RhizosphereVAPPLESYKKKRDPKKTPEPFGRRRGKAKGKPIFVVQR
Ga0126305_1026120723300010036Serpentine SoilVAKAKLADYKRKRDPKKTPEPFGGKKGGKQPSFVVQRH
Ga0126308_1054380223300010040Serpentine SoilVSLPEYRRKRDPKVTPEPVEGHGKRGKKPIFVVQRHDAR
Ga0134067_1002411913300010321Grasslands SoilVASRNLTQYRRKRDPKKTSEPFGKAKKRGKQPIFVVQRHDA
Ga0134086_1044928113300010323Grasslands SoilVSLREYERKRNRKKTPEPFSARAQAKGAPIFVVQRQDARR
Ga0134071_1029312013300010336Grasslands SoilVSPEKLREYNRKRDPKQTPEPFSSTRRGPKAPIFVVQRHDARR
Ga0126379_1128063523300010366Tropical Forest SoilMSRKLSEYERKRNRRGTPEPFGGKRGKAKGPIFVVQRH
Ga0134124_1023611833300010397Terrestrial SoilVSQKLQEYRRKRDPEKTAEPFGSKKKRGKQPIFVVQR
Ga0126383_1366804313300010398Tropical Forest SoilVSKKLSEYERKRDRKQTPEPFGGTRGTATAPTFVVQRHD
Ga0138514_10004561313300011003SoilVSQKLQEYRRKRDPKKTSEPFGTKKKRGKEPIFVIQP
Ga0120167_107888913300012001PermafrostVSPSKLGEYNRKRDPKQTPEPFTSKRKGTKDPIFVVQRHDAR
Ga0137388_1184999423300012189Vadose Zone SoilMPRNLTEYKKKRDPSKTSEPFGNGRPGKEPIFVVQRHDA
Ga0137364_1049294423300012198Vadose Zone SoilVATQRLKEYRRKRDPKQTSEPFGKAKKRGKQPIFVVQRHD
Ga0137382_1002606653300012200Vadose Zone SoilVAKAKLAEYKKKRDPKKTPEPFGSKKSAKDPIFVV
Ga0137381_1079370823300012207Vadose Zone SoilVSKKLSEYERKRKREQTPEPFGGKRGKAKAPIFVI
Ga0137378_1109376113300012210Vadose Zone SoilVASQKLKEYRRKRDPKQTSEPFDTRKKRGKQPIFVVQRHDAR
Ga0137377_1181725413300012211Vadose Zone SoilVARQLTEYKRKRDPKKTPEPFGGKGRKTKAPIFVVQRHD
Ga0137387_1128198713300012349Vadose Zone SoilVAEKLSEYKRKRDPKQTPEPFGGKKEKTKEPIFVVQ
Ga0137386_1065133923300012351Vadose Zone SoilMAQKQLSEYKRKRDPRQTPEPFGAKGGKTKEPTFVV
Ga0137386_1108466223300012351Vadose Zone SoilVSPRKLAEYERKRDPKTTPEPFRGKRRKTKEPIFVVQRH
Ga0137361_1079264713300012362Vadose Zone SoilVAEELREYKRKRDPKETPEPFTSKRPRAKVPIFVVQRHDA
Ga0157344_102031623300012476Arabidopsis RhizosphereVPEPKLREYRRKRDPKKTSEPFTGKRKTKEPLFVV
Ga0157298_1038535523300012913SoilLVDKHTTVATLRDYERKRDRRKTPEPFGGKPKRERRPIFV
Ga0157302_1038315423300012915SoilVSKKLSEYERKRKRKQTPEPFGGRHAKAKGPIFVV
Ga0137407_1113005023300012930Vadose Zone SoilVATQKLSEYKRRRDPKATPEPFGSRKGKTKDTIFVVQ
Ga0164300_1077510723300012951SoilVAQKLSEYKRKRDPKQTPEPFGSKKGKAKDPIFVVQRHDAR
Ga0164298_1160258223300012955SoilMNQKLRDYERKRKRRETPEPFTSSRARKKHDPIFVVQR
Ga0134087_1013471713300012977Grasslands SoilVASRNLTEYRRKRDPKKTSEPFGKAKKRGKQPIFVVQ
Ga0134087_1081377823300012977Grasslands SoilMTEKLSEYRRKRDPKATPEPFESPRKRTGEPIFVVQR
Ga0164307_1113950613300012987SoilVPKAKLAEYKRKRDPKKTPEPFGSSKRGEEPIFVIQRH
Ga0164307_1164579123300012987SoilVDYYFVVAKLEDYKRKRNPKQTPEPFGGAKRGGKPI
Ga0164306_1016637433300012988SoilVAQKLSEYKRKRDPKQTPEPFGSKKGKAKDPIFVVQR
Ga0164306_1115140323300012988SoilVATQKLQEYRRKRDEKQTPEPFGKGKKRSKQPIFVIQRH
Ga0164305_1021811033300012989SoilVGSSELGEYRRKRDPKQTPEPFSSRRKRTKDPIFVV
Ga0157371_1021925133300013102Corn RhizosphereMAEKLREYERKRHRGATPEPFTSKRKGREKQPIFVVQRH
Ga0157378_1048825323300013297Miscanthus RhizosphereVSQKLQEYRRKRDPEKTAEPFGGQKKRGKQPIFVVQRHQA
Ga0075322_117753113300014311Natural And Restored WetlandsVVPPLESYRRKRDPKKTPEPFGGRRRKTGGPIFVI
Ga0173483_1084147523300015077SoilVSLREYERKRDRKKTPEPFSGKRRGKQPTFVVQRH
Ga0173483_1093335223300015077SoilMAQKLSEYRRKRDPKKTPEPFGAKQGEPKEPIFVVQR
Ga0182007_1043311623300015262RhizosphereVPEPRLSEYRRKRDPEITPEPFGSAKRGSRPIFVVQR
Ga0132257_10443912923300015373Arabidopsis RhizosphereVSPKLSEYERKRNRKKTPEPFGGKRGKEKSPVFVVQRH
Ga0134083_1023241923300017659Grasslands SoilVAKLTEYERKRDPKRTPEPFGGKRAKTKEPIFVVQR
Ga0163161_1049705313300017792Switchgrass RhizosphereVATLRDYERKRDRKKTPEPFGARKGRKKGPIFVVQRHD
Ga0184612_1025880123300018078Groundwater SedimentLAKLAEYKRKRDPKKTPEPFGGKKRGKEPIFVVQR
Ga0066667_1061104213300018433Grasslands SoilVETQKLKEYRRKRDPKQTAEPFDSRRGGKRAKGPIFV
Ga0066669_1037735513300018482Grasslands SoilVASRRLTEYRRKRDPKKTSEPFAGQKRRAKQPIFV
Ga0066669_1142268413300018482Grasslands SoilVSLREYERKRDPKKTPEPFKGKRKSKDPIFVVQRHD
Ga0066669_1181121923300018482Grasslands SoilMSLKEYRRKRDPKETPEPFAGGKARRKKQPIFVVQRHDARR
Ga0184644_180437123300019269Groundwater SedimentVAKQKLAEYRKKRDPKKTPEPFGDKKRGQEATFVVQ
Ga0193701_108549113300019875SoilVTVENLTEYRRKRDRKKTSEPFSSKRKRGKQPIFVVQRHD
Ga0213871_1029633423300021441RhizosphereMAKLSEYRAKRDPKKTPEPFGGARDGSAPVFVVQR
Ga0182009_1062103123300021445SoilVSPKLDEYHRKRDPKQTPEPFTSKGRKAKLPIFVVQ
Ga0222623_1005137533300022694Groundwater SedimentVAEKLSEYKRKRDPKKTPEPFGGKKDKTKEPIFVVQRHD
Ga0247666_101181533300024323SoilVSKKLSEYERKRNRKQTPEPFGGKQTKAKAPTFVVQR
Ga0207653_1011554923300025885Corn, Switchgrass And Miscanthus RhizosphereVSLREYERKRDRKQTPEPFTGRRKGKQPIFVVQRH
Ga0207695_1039054613300025913Corn RhizosphereVPPKLRDYERKRDPKATPEPFTSTRKGRENEPIFVV
Ga0207694_1142737023300025924Corn RhizosphereVAEKLREYNAKRDPEQTPEPFTSKRGGRTKAPIFVVQRHDAR
Ga0207644_1175282623300025931Switchgrass RhizosphereMASLRDYERKRDQKKTPEPFGRRTKRAKSPIFVVQR
Ga0207679_1091332923300025945Corn RhizosphereVPPLESYKKKRDPKKTPEPFGGKRGRGKAKDKPIFVVQRHDA
Ga0207667_1173482723300025949Corn RhizosphereVPPLESYKKKRDPKKTPEPFGGKRGRGKARDKPIFVVQRHDA
Ga0207651_1150915313300025960Switchgrass RhizosphereVAEKLSEYKRKRDPGKTPEPFGAKKGKTKDPIFVV
Ga0208527_102778013300025990Rice Paddy SoilVSSLSEYRRKRDPRATPEPFGKGKRGKKQPIFVVQR
Ga0207708_1096575623300026075Corn, Switchgrass And Miscanthus RhizosphereMATLRDYERKRDRKKTPEPFGGRKGRKKGPIFVVQ
Ga0207702_1088202113300026078Corn RhizosphereVSKKLSEYERKRHRKQTPEPFGGRRAKAKAPVFVVQ
Ga0209579_1062047323300027869Surface SoilVSKKLSEYERKRDRTQTPEPFGGKRNKKKAPIFVVQRHDAR
Ga0307285_1004109813300028712SoilVAQKLSDYNRKRDPKQTPEPFGSTKGTAKEPIFVVQRHDA
Ga0307311_1022966713300028716SoilVATQKLSEYKRKRDPKETPEPFGSRKGKTKEPIFVVQ
Ga0307307_1002833313300028718SoilVAQKLTEYKRKRDPKATPEPGLKAPARAKRSKEKEPIFVVQRH
Ga0307319_1006839013300028722SoilMARLRDYERKRDHKKTPEPFGGRKKRAKSPIFVVQRHDAR
Ga0307316_1023215813300028755SoilMGVARLSEYERKRKKAKTPEPFGGKKRGKAPIFVV
Ga0307316_1026049613300028755SoilVPKAKLAEYKRKRDRKKTPEPFGDKKRGKDPIFVVQR
Ga0307280_1009848613300028768SoilVAQKLTEYKRKRDPKATPEPGLKAPARAKHGKEKEPIFVVQRHDARR
Ga0307320_1011884213300028771SoilVAEKLSEYKRKRDPKKTPEPFGGKKDKTKEPIFVV
Ga0307305_1010275623300028807SoilVAQKLTEYKRKRDPKATPEPGLKAPVRAKRGEGKEPIFVVQR
Ga0307292_1010168713300028811SoilVAEKLSEYKRKRDAKKTPEPFGGKKGKTKDPIFVV
Ga0307310_1053231823300028824SoilLVSLREYEQKRDPKKTPEPFAGKRETKEPIFVVQRH
Ga0307277_1045275023300028881SoilVASQNLKEYRRKRDPKKTAEPFGKGKKRGKQPIFV
Ga0307304_1039045913300028885SoilVAKLAEYRKKRDPKKTPEPFTGKKGAKEPIFVIQR
Ga0247826_1046231213300030336SoilVAQLDEYRRKRDPKQTPEPFSGRGHSARQPIFVVQRH
Ga0170834_11155680323300031057Forest SoilVSKKLSEYERNRNRTKTPEPFGGKRGKKKAPIFVVQR
Ga0170824_10708923523300031231Forest SoilMATEKLQEYRRKRDEKQTPEPFGKGKKRGKEPIFVIQR
Ga0307505_1053254813300031455SoilVAQKLSEYKRKRDPKQTPEPFGSKKGKAKEPIFVV
Ga0307408_10057316923300031548RhizosphereVTERLGEYRKKRDPKKTPEPFGGRKRGKQPIFVVQ
Ga0307468_10071670213300031740Hardwood Forest SoilMATLRDYERKRDRRKTPEPFGARKGRRKGPIFVVQRHDA
Ga0307468_10094158413300031740Hardwood Forest SoilVAQKLSEYKRKRDPKQTPEPFGSKKGKAKEPIFVVQRH
Ga0318548_1048027723300031793SoilVSLGEYRRKRDPAKTPEPFPRKRGRSKEPIFVVQRHD
Ga0306921_1076172813300031912SoilVSKKLSEYERKRNRKQTPEPFGGKPGRAKAPIFVV
Ga0308176_1199037923300031996SoilVATQRLKEYRRKRDPKQTSEPFGKAKKRGKQPIFVVQR
Ga0307416_10304924213300032002RhizosphereVARLREYERKRDPKKTPEPFGKGKRREKEPIFVVQRHD
Ga0318569_1048176013300032010SoilVSKKLSEYERKRNRKQTPEPFGGKPGRAKAPIFVVQ
Ga0247829_1073759323300033550SoilVAEPKLREYRRKRDPKKTPEPFTGKRKTKDPIFVI
Ga0334946_030853_2_1123300034026Sub-Biocrust SoilMPSKLRTYERMRDPKATPEPFGAKKRRPRKKEPRFVV

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.