NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F054338

Metagenome Family F054338

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F054338
Family Type Metagenome
Number of Sequences 140
Average Sequence Length 42 residues
Representative Sequence MKLPVDTSAIAFLCALEPQPVVDFETKRPRADENGEPL
Number of Associated Samples 73
Number of Associated Scaffolds 140

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 98.57 %
% of genes near scaffold ends (potentially truncated) 94.29 %
% of genes from short scaffolds (< 2000 bps) 88.57 %
Associated GOLD sequencing projects 68
AlphaFold2 3D model prediction Yes
3D model pTM-score0.32

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (64.286 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil
(25.714 % of family members)
Environment Ontology (ENVO) Unclassified
(27.143 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(40.714 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 12.12%    β-sheet: 6.06%    Coil/Unstructured: 81.82%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.32
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 140 Family Scaffolds
PF00392GntR 12.86
PF01381HTH_3 12.86
PF07702UTRA 9.29
PF00436SSB 2.86
PF00293NUDIX 2.14
PF03091CutA1 1.43
PF12728HTH_17 1.43
PF13560HTH_31 1.43
PF01527HTH_Tnp_1 1.43
PF13730HTH_36 0.71
PF00583Acetyltransf_1 0.71
PF02441Flavoprotein 0.71
PF13302Acetyltransf_3 0.71
PF02371Transposase_20 0.71
PF13546DDE_5 0.71
PF12681Glyoxalase_2 0.71
PF13649Methyltransf_25 0.71
PF10458Val_tRNA-synt_C 0.71
PF12844HTH_19 0.71
PF00376MerR 0.71

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 140 Family Scaffolds
COG0629Single-stranded DNA-binding proteinReplication, recombination and repair [L] 2.86
COG2965Primosomal replication protein NReplication, recombination and repair [L] 2.86
COG1324Divalent cation tolerance protein CutAInorganic ion transport and metabolism [P] 1.43
COG3547TransposaseMobilome: prophages, transposons [X] 0.71


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms64.29 %
UnclassifiedrootN/A35.71 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000550|F24TB_10358896Not Available1603Open in IMG/M
3300000559|F14TC_100153245Not Available998Open in IMG/M
3300000956|JGI10216J12902_101595217All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia506Open in IMG/M
3300000956|JGI10216J12902_106027188All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1001Open in IMG/M
3300000956|JGI10216J12902_120408362Not Available791Open in IMG/M
3300003203|JGI25406J46586_10028549All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales2125Open in IMG/M
3300003373|JGI25407J50210_10072856All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria857Open in IMG/M
3300003373|JGI25407J50210_10169511All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales538Open in IMG/M
3300005562|Ga0058697_10199404All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria906Open in IMG/M
3300005562|Ga0058697_10212486All Organisms → cellular organisms → Bacteria882Open in IMG/M
3300005562|Ga0058697_10283081Not Available784Open in IMG/M
3300005981|Ga0081538_10017846All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales5362Open in IMG/M
3300005981|Ga0081538_10031972All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3538Open in IMG/M
3300005981|Ga0081538_10256613All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales663Open in IMG/M
3300005985|Ga0081539_10034759All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3040Open in IMG/M
3300005985|Ga0081539_10268019All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia750Open in IMG/M
3300006049|Ga0075417_10134916All Organisms → cellular organisms → Bacteria1141Open in IMG/M
3300006058|Ga0075432_10289972All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria676Open in IMG/M
3300006169|Ga0082029_1106933All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia584Open in IMG/M
3300006844|Ga0075428_100668268Not Available1107Open in IMG/M
3300006880|Ga0075429_100744409All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria859Open in IMG/M
3300006918|Ga0079216_11703501All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria537Open in IMG/M
3300009100|Ga0075418_11514697Not Available728Open in IMG/M
3300009100|Ga0075418_11589182Not Available710Open in IMG/M
3300009100|Ga0075418_12900319Not Available523Open in IMG/M
3300009162|Ga0075423_10073711All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium3548Open in IMG/M
3300009162|Ga0075423_11218577All Organisms → cellular organisms → Bacteria803Open in IMG/M
3300009162|Ga0075423_11427118All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia742Open in IMG/M
3300009789|Ga0126307_10155251All Organisms → cellular organisms → Bacteria1832Open in IMG/M
3300009789|Ga0126307_10164451All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1778Open in IMG/M
3300009789|Ga0126307_10424886Not Available1072Open in IMG/M
3300009789|Ga0126307_11688931All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia515Open in IMG/M
3300009810|Ga0105088_1082465All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria577Open in IMG/M
3300009840|Ga0126313_10029124All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3765Open in IMG/M
3300009840|Ga0126313_10043198All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3149Open in IMG/M
3300009840|Ga0126313_10263171Not Available1340Open in IMG/M
3300009840|Ga0126313_10730201Not Available803Open in IMG/M
3300009840|Ga0126313_11303572Not Available600Open in IMG/M
3300009840|Ga0126313_11384327Not Available583Open in IMG/M
3300009840|Ga0126313_11819403All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia510Open in IMG/M
3300010036|Ga0126305_10175578All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1347Open in IMG/M
3300010036|Ga0126305_11063479Not Available556Open in IMG/M
3300010036|Ga0126305_11193231All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria526Open in IMG/M
3300010037|Ga0126304_10049745Not Available2542Open in IMG/M
3300010037|Ga0126304_10472486All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia841Open in IMG/M
3300010037|Ga0126304_10577591Not Available757Open in IMG/M
3300010038|Ga0126315_10199837All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1204Open in IMG/M
3300010038|Ga0126315_10406165Not Available857Open in IMG/M
3300010038|Ga0126315_10595750All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella → unclassified Kribbella → Kribbella sp. VKM Ac-2500713Open in IMG/M
3300010038|Ga0126315_10694670All Organisms → cellular organisms → Bacteria → Terrabacteria group663Open in IMG/M
3300010038|Ga0126315_11270982Not Available501Open in IMG/M
3300010040|Ga0126308_10732819Not Available681Open in IMG/M
3300010041|Ga0126312_10038370All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3199Open in IMG/M
3300010041|Ga0126312_10167383All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1530Open in IMG/M
3300010041|Ga0126312_10379480Not Available1004Open in IMG/M
3300010041|Ga0126312_10615037All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → Nonomuraea pusilla781Open in IMG/M
3300010041|Ga0126312_10714626All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia724Open in IMG/M
3300010041|Ga0126312_11118176All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae579Open in IMG/M
3300010041|Ga0126312_11202091Not Available559Open in IMG/M
3300010042|Ga0126314_10509847All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria873Open in IMG/M
3300010044|Ga0126310_10960167Not Available670Open in IMG/M
3300010044|Ga0126310_11163557All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia617Open in IMG/M
3300010045|Ga0126311_10495237Not Available955Open in IMG/M
3300010045|Ga0126311_11309460All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia602Open in IMG/M
3300010166|Ga0126306_10832384All Organisms → cellular organisms → Bacteria → Terrabacteria group → Candidatus Dormibacteraeota → unclassified Candidatus Dormibacteraeota → Candidatus Dormibacteraeota bacterium746Open in IMG/M
3300014487|Ga0182000_10299818Not Available669Open in IMG/M
3300018051|Ga0184620_10184923Not Available687Open in IMG/M
3300018073|Ga0184624_10131330All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes derwentensis1091Open in IMG/M
3300018073|Ga0184624_10280838All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia747Open in IMG/M
3300018074|Ga0184640_10389707All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia628Open in IMG/M
3300018081|Ga0184625_10441886All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia667Open in IMG/M
3300018422|Ga0190265_13301060Not Available538Open in IMG/M
3300018465|Ga0190269_10739986All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia695Open in IMG/M
3300018465|Ga0190269_11175910All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia600Open in IMG/M
3300018466|Ga0190268_10512616All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria818Open in IMG/M
3300018466|Ga0190268_10655770Not Available759Open in IMG/M
3300018466|Ga0190268_10974213All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia671Open in IMG/M
3300018466|Ga0190268_11245197All Organisms → cellular organisms → Bacteria622Open in IMG/M
3300018466|Ga0190268_12300970Not Available508Open in IMG/M
3300019767|Ga0190267_10155015Not Available1008Open in IMG/M
3300019767|Ga0190267_10508331All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia715Open in IMG/M
3300019767|Ga0190267_11436765Not Available526Open in IMG/M
3300022694|Ga0222623_10231816All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia714Open in IMG/M
3300027277|Ga0209846_1011506All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1498Open in IMG/M
3300027718|Ga0209795_10119771All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria749Open in IMG/M
3300027873|Ga0209814_10190236Not Available886Open in IMG/M
3300027880|Ga0209481_10347483All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria756Open in IMG/M
3300027907|Ga0207428_10830189All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia655Open in IMG/M
3300027909|Ga0209382_10106672All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3277Open in IMG/M
3300027909|Ga0209382_12135505All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria532Open in IMG/M
3300028597|Ga0247820_11111192Not Available568Open in IMG/M
3300028704|Ga0307321_1100998All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia586Open in IMG/M
3300028707|Ga0307291_1124090Not Available651Open in IMG/M
3300028711|Ga0307293_10161157All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria714Open in IMG/M
3300028720|Ga0307317_10275686Not Available568Open in IMG/M
3300028721|Ga0307315_10283365All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia524Open in IMG/M
3300028722|Ga0307319_10306470Not Available525Open in IMG/M
3300028744|Ga0307318_10152866All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria792Open in IMG/M
3300028771|Ga0307320_10176722Not Available831Open in IMG/M
3300028796|Ga0307287_10106028Not Available1061Open in IMG/M
3300028811|Ga0307292_10274216Not Available703Open in IMG/M
3300028812|Ga0247825_11415517All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia510Open in IMG/M
3300028819|Ga0307296_10282044All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia905Open in IMG/M
3300028881|Ga0307277_10015008All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3006Open in IMG/M
3300030499|Ga0268259_10149328All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia555Open in IMG/M
3300031548|Ga0307408_101604719All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia618Open in IMG/M
3300031548|Ga0307408_102113437All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria543Open in IMG/M
3300031731|Ga0307405_10061622All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2372Open in IMG/M
3300031731|Ga0307405_10893241All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia751Open in IMG/M
3300031731|Ga0307405_11009047Not Available710Open in IMG/M
3300031824|Ga0307413_10508375Not Available969Open in IMG/M
3300031824|Ga0307413_10946624All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Catellatospora → Catellatospora citrea735Open in IMG/M
3300031852|Ga0307410_10695107All Organisms → cellular organisms → Bacteria → Terrabacteria group857Open in IMG/M
3300031852|Ga0307410_11081803All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia694Open in IMG/M
3300031852|Ga0307410_11935159All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia525Open in IMG/M
3300031901|Ga0307406_10031178All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3244Open in IMG/M
3300031901|Ga0307406_10135707All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora → unclassified Catenulispora → Catenulispora sp. 13_1_20CM_3_70_71734Open in IMG/M
3300031901|Ga0307406_10396915All Organisms → cellular organisms → Bacteria → Terrabacteria group → Candidatus Dormibacteraeota → unclassified Candidatus Dormibacteraeota → Candidatus Dormibacteraeota bacterium1092Open in IMG/M
3300031901|Ga0307406_10965909All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella → unclassified Kribbella → Kribbella sp. VKM Ac-2500729Open in IMG/M
3300031901|Ga0307406_11726139Not Available555Open in IMG/M
3300031903|Ga0307407_10046172All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2465Open in IMG/M
3300031903|Ga0307407_10557383Not Available848Open in IMG/M
3300031911|Ga0307412_10857238Not Available793Open in IMG/M
3300031995|Ga0307409_100191358All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces1821Open in IMG/M
3300031995|Ga0307409_100602299Not Available1086Open in IMG/M
3300032002|Ga0307416_100828486Not Available1022Open in IMG/M
3300032002|Ga0307416_101153484Not Available880Open in IMG/M
3300032002|Ga0307416_101521427All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia775Open in IMG/M
3300032002|Ga0307416_102505618All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae614Open in IMG/M
3300032004|Ga0307414_10050761All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2875Open in IMG/M
3300032004|Ga0307414_10159266All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces1791Open in IMG/M
3300032005|Ga0307411_10135532All Organisms → cellular organisms → Bacteria1807Open in IMG/M
3300032005|Ga0307411_10659525All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia907Open in IMG/M
3300032126|Ga0307415_100451654All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1111Open in IMG/M
3300032126|Ga0307415_100649830All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium945Open in IMG/M
3300032126|Ga0307415_102332624Not Available525Open in IMG/M
3300032126|Ga0307415_102508487Not Available508Open in IMG/M
3300033168|Ga0272423_1069674All Organisms → cellular organisms → Bacteria2229Open in IMG/M
3300034172|Ga0334913_050078Not Available887Open in IMG/M
3300034172|Ga0334913_088452Not Available654Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil25.71%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere22.86%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil16.43%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere10.71%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment3.57%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere3.57%
AgaveHost-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave2.86%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.14%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere2.14%
Sub-Biocrust SoilEnvironmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil1.43%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.43%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.43%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand1.43%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.71%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.71%
Termite NestEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest0.71%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.71%
RockEnvironmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock0.71%
AgaveHost-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave0.71%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000550Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemlyEnvironmentalOpen in IMG/M
3300000559Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemlyEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300003203Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2Host-AssociatedOpen in IMG/M
3300003373Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1Host-AssociatedOpen in IMG/M
3300005562Agave microbial communities from Guanajuato, Mexico - As.Ma.eHost-AssociatedOpen in IMG/M
3300005981Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1Host-AssociatedOpen in IMG/M
3300005985Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2Host-AssociatedOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006058Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1Host-AssociatedOpen in IMG/M
3300006169Termite nest microbial communities from Madurai, IndiaEnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006918Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100EnvironmentalOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300009810Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30EnvironmentalOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010036Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26EnvironmentalOpen in IMG/M
3300010037Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25EnvironmentalOpen in IMG/M
3300010038Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106EnvironmentalOpen in IMG/M
3300010040Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55EnvironmentalOpen in IMG/M
3300010041Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104AEnvironmentalOpen in IMG/M
3300010042Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105BEnvironmentalOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010045Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61EnvironmentalOpen in IMG/M
3300010166Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27EnvironmentalOpen in IMG/M
3300014487Bulk soil microbial communities from Mexico - Magueyal (Ma) metaGEnvironmentalOpen in IMG/M
3300018051Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1EnvironmentalOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300018074Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2EnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018465Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 ISEnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300019767Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 TEnvironmentalOpen in IMG/M
3300022694Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coexEnvironmentalOpen in IMG/M
3300027277Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 (SPAdes)EnvironmentalOpen in IMG/M
3300027718Agave microbial communities from Guanajuato, Mexico - Or.Ma.rz (SPAdes)Host-AssociatedOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027880Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)Host-AssociatedOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028597Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14EnvironmentalOpen in IMG/M
3300028704Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_379EnvironmentalOpen in IMG/M
3300028707Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148EnvironmentalOpen in IMG/M
3300028711Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150EnvironmentalOpen in IMG/M
3300028720Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357EnvironmentalOpen in IMG/M
3300028721Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355EnvironmentalOpen in IMG/M
3300028722Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368EnvironmentalOpen in IMG/M
3300028744Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367EnvironmentalOpen in IMG/M
3300028771Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369EnvironmentalOpen in IMG/M
3300028796Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141EnvironmentalOpen in IMG/M
3300028811Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149EnvironmentalOpen in IMG/M
3300028812Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300030499Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (v2)Host-AssociatedOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031731Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1Host-AssociatedOpen in IMG/M
3300031824Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2Host-AssociatedOpen in IMG/M
3300031852Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3Host-AssociatedOpen in IMG/M
3300031901Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2Host-AssociatedOpen in IMG/M
3300031903Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1Host-AssociatedOpen in IMG/M
3300031911Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1Host-AssociatedOpen in IMG/M
3300031995Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2Host-AssociatedOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300032004Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3Host-AssociatedOpen in IMG/M
3300032005Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1Host-AssociatedOpen in IMG/M
3300032126Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2Host-AssociatedOpen in IMG/M
3300033168Rock endolithic microbial communities from Victoria Land, Antarctica - Mt New Zealand sudEnvironmentalOpen in IMG/M
3300034172Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 9HMSEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
F24TB_1035889623300000550SoilMRLPVDVSAISFLCAMAPEPVVDFETKRPRADENGEP
F14TC_10015324513300000559SoilVKLPIDTSAIAFLCAMPPEPVVDFETRRPKADENGE
JGI10216J12902_10159521713300000956SoilVKLPVDTSAIAFLCAMPPEPVVDFETKRPRADDNGE
JGI10216J12902_10602718813300000956SoilLKLPVDTSAIAFLCALEPQPLLAFDTKQPRADENGEPL
JGI10216J12902_12040836213300000956SoilMKLPVDTSAIAFLCAMPPEPVIDFQTKQHRADENGEPLFVVQLLVMGEDSADLIA
JGI25406J46586_1002854913300003203Tabebuia Heterophylla RhizosphereMKLPVDTSAIAFLCALEPQPVLDFETRQPRADGNGEPLYV
JGI25407J50210_1007285623300003373Tabebuia Heterophylla RhizosphereVKLPIDTSAIAFLCAMPAEPVVDFETRRPKADENGEPLYVVQLLVMGED
JGI25407J50210_1016951123300003373Tabebuia Heterophylla RhizosphereMKLPVDTSAIAFLCAVEAEPVVDFETRRPKADENGEPLYVV
Ga0058697_1019940413300005562AgaveMKLPVDTSSIAFLCALEPQPVLDFETRQPRADENGEPLYVVQLIA
Ga0058697_1021248623300005562AgaveVKLPIDTSAIAFLCALAPEPVVDFETRRPKADENGEPLYTVQLLVMGED
Ga0058697_1028308113300005562AgaveVKLPIDTSAIAFMCAMPPEPVVDFETRRPKADENGEPLYVVQL
Ga0081538_1001784683300005981Tabebuia Heterophylla RhizosphereVKLPVDTSAIAFLCAVEAEPVVDFETKRPSADENGEPL
Ga0081538_1003197253300005981Tabebuia Heterophylla RhizosphereVKLPVDTSAIAFLCAMPPEPVVDFETKRPRADENGEPLYV
Ga0081538_1025661323300005981Tabebuia Heterophylla RhizosphereMKLPVDTSAIAFLCAVEAEPVVDFETRRPKADENGEP
Ga0081539_1003475963300005985Tabebuia Heterophylla RhizosphereVKLPVDTSAIAFLCALEPQPVLDFETRQPRADSNG
Ga0081539_1026801913300005985Tabebuia Heterophylla RhizosphereMKLPVDTSAIAFLCAVEAEPVVDFETTRPRADENGEPLYLVQLIA
Ga0075417_1013491613300006049Populus RhizosphereVKLPIDTSAIAFLCAMPPEPVVDFETRRPKADENGEPL
Ga0075432_1028997213300006058Populus RhizosphereLKLPVDTSAIAFLCALEPQPVLDFETRRPRADENGEPLYV
Ga0082029_110693313300006169Termite NestMKLPVDTSAIAFLCALEPQPVLAFDTKQPRADENGEPL
Ga0075428_10066826813300006844Populus RhizosphereMKLPVDTSAIACLCAMPPEPVVDFETRRPKADENGEPLYVIQLLAMGDGS
Ga0075429_10074440913300006880Populus RhizosphereVKLPIDTSAIAFLCAMAPEPVVDFETKRPRADENGE
Ga0079216_1170350113300006918Agricultural SoilMKLPVDTSAIAFLCALAPEPVIDFQTKQPRADENGEPLYLIQLL
Ga0075418_1151469713300009100Populus RhizosphereMKLPVDTSAIAFLCAMPPEPVIDFQTKQHRADENGEPLYVIQL
Ga0075418_1158918223300009100Populus RhizosphereMKLPVDTSAIAFLCAMAPEPVVDFETRRPKADENGEPLYVIQLLA
Ga0075418_1290031913300009100Populus RhizosphereVRTLPIDTTAITFLASAPPAPVLDFQTKQPKADSNGEPLYAVQLVAMQPA
Ga0075423_1007371153300009162Populus RhizosphereVKLPIDTSAIAFLCALAPEPVVDFETRRPKADENGEPLYTVQLLV
Ga0075423_1121857733300009162Populus RhizosphereMKLPVDTSAIAFLCAVEAEPVVDFETKRPRADENGEPCTWCS*
Ga0075423_1142711823300009162Populus RhizosphereMKLPVDTSAIAFLCALAPEPVVDFETRQPKADENGEPL
Ga0126307_1015525143300009789Serpentine SoilMKLPVDTSAIAFLCAPEPQPVLAFETKQPRRMRTVSRCTWCS*
Ga0126307_1016445133300009789Serpentine SoilMKLPVDTTSITFLCALEPQPLLDFETKQPRADENGEPLYVVQLIAL
Ga0126307_1042488623300009789Serpentine SoilVKLPIDTSAIAFLCAMPPEPVVDFETRRPKADENGEP
Ga0126307_1168893113300009789Serpentine SoilVKLPIDTSAIAFLCALAPEPLVDFETRRPKADENGEPL
Ga0105088_108246523300009810Groundwater SandVKLPVDTSALAFLCAMPPEPVVDFETRRPKADENGEPLYVVQL
Ga0126313_1002912453300009840Serpentine SoilVKLPVDTSAIAFLCALEPQPVLAFDTKQPRADENGEPLFVVQLIALVGLCQVGG*
Ga0126313_1004319813300009840Serpentine SoilMKLPVDTSSIAFLCALEPQPVLAFDTKQPRADENGEPLYV
Ga0126313_1026317113300009840Serpentine SoilVKLPIDTSAIAFLCAMPPEPVVDFETRRPKADENG
Ga0126313_1073020123300009840Serpentine SoilVKLPVDTSAIAFLCALEPQPVLAFDTKQPRADENGE
Ga0126313_1130357213300009840Serpentine SoilLKLPIDTSAIAFLCAMPPEPVLDFQTCQTKADDNGEPLYVIQS*
Ga0126313_1138432713300009840Serpentine SoilMKLPVDTSAIAFLCAVEAEPVVDFETRRPKADENGEPLYL
Ga0126313_1181940323300009840Serpentine SoilVRLPVDTSAITFLCALAPEPLVDFETRRPKADENGEPLYVI
Ga0126305_1017557813300010036Serpentine SoilMKLPVDTSAIAFLCALEPQPVLDFETRRPRADENGEPLYVMQL
Ga0126305_1106347923300010036Serpentine SoilVKLPIDTSAIAFLCAMPPEPVLDFETRRPKADDNGEPLYVIQLL
Ga0126305_1119323113300010036Serpentine SoilMKLPVDTSAIAFLCALEPQPVLHFETRQPRADGNGEPL
Ga0126304_1004974513300010037Serpentine SoilMKLPVDTSAIAFLCALAPEPVVDFETRRPKADENGEPLYLIQLLAMGD
Ga0126304_1047248613300010037Serpentine SoilMKLPVDTSAIAFLCALAPEPVVDFETRRPKADENGEPLYLI
Ga0126304_1057759113300010037Serpentine SoilVKLPIDTSAIAFLCAMPPEPVVDFQTCRPKADDNGEPLY
Ga0126315_1019983743300010038Serpentine SoilMKLPIDTSAIAFLCALAPEPVVDFETRRPRADENGEPLYVIQLL
Ga0126315_1040616523300010038Serpentine SoilMKLPIDTSAIAFLCALAPEPVIDFETKRPRADENGEPL
Ga0126315_1059575023300010038Serpentine SoilMKLPVDTSAIAFLCAVEAEPVVDFETKRPRADENG
Ga0126315_1069467033300010038Serpentine SoilLKLPIDTSAIAFLCAMPPEPVLDFQTCQTKADDNGEPLYVIRS*
Ga0126315_1127098213300010038Serpentine SoilVKLPIDTSAIAFLCAMPPEPVIDFETKRPRADENGEPL
Ga0126308_1073281923300010040Serpentine SoilVDTSAIAFLCALEPQPVLAFDTKQPRADENGEPLYVVQLIALGEGEA
Ga0126312_1003837013300010041Serpentine SoilMKLPIDTSAIAFLCALAPEPVVDFETRRPKADENGEPLYVIQLL
Ga0126312_1016738343300010041Serpentine SoilMKLPVDTSAIAFLCALAPEPVVDFETRRPRADENGEP
Ga0126312_1037948013300010041Serpentine SoilVDTSAIAFLCALEPQPVLAFDTKQPRADENGEPLYVVQ
Ga0126312_1061503733300010041Serpentine SoilVKLPVDTSAIAFLCALEPQPLLTFDTKQPRANENGE
Ga0126312_1071462623300010041Serpentine SoilMKLPVDTSAIAFLCALAPEPVVDFQTKQQRADENGEPLYVI*
Ga0126312_1111817623300010041Serpentine SoilMRLPVDTSAIAFLCAVEAEPVVDFETRRPKADENG
Ga0126312_1120209113300010041Serpentine SoilMKLPVDTSAIAFLCALEPQPVLAFDTKQQRADENGEPLYV
Ga0126314_1050984723300010042Serpentine SoilMKLPVDTSAIAFLCALEPQPLLRFDTKEPRADENGEPLYVVQLIALA
Ga0126310_1096016713300010044Serpentine SoilVKLPIDTSAIAFLCAMAPEPVVDFETRRPKADENGEPLYV
Ga0126310_1116355713300010044Serpentine SoilVKLPIDTSAIAFLCAMPPEPVVDFETRRPKADENGEPLYVLQLLVMGE
Ga0126311_1049523723300010045Serpentine SoilMKLPIDTSAIAFLCAMPPEPVVDFETRRPKADDNGEPL
Ga0126311_1130946023300010045Serpentine SoilMKLPVDTSAIAFRCALAPEPVGDFETRRPKADENGEPLYL
Ga0126306_1083238413300010166Serpentine SoilVKLPIDTSAIAFLCAMPPEPVVDFETRRPKADENGEPLYTVQLLVMGDDSADLIA
Ga0182000_1029981813300014487SoilVKLPIDTSAIAFLCAMPPEPVVDFETRRPKADENGEPLYVVQLL
Ga0184620_1018492323300018051Groundwater SedimentVKLPVDTSAIAFLCALEPHPLLDFQSKQQRADENGEPLYVVQ
Ga0184624_1013133013300018073Groundwater SedimentMKLPVDTSAIAFLCAVEAEPVVDFETERPRADENGEPLYVVQLIALTD
Ga0184624_1028083823300018073Groundwater SedimentVKLPVDTSAIAFLCAVEAEPVVDFETKRPRADENGEP
Ga0184640_1038970723300018074Groundwater SedimentMKLPVDTSSIAFLCALEPQPVLAFDTKQPRADENGE
Ga0184625_1044188623300018081Groundwater SedimentMKLPVDTSAIAFLCALEPRPVLAFDTKEQRADENGEPL
Ga0190265_1330106023300018422SoilVKLPIDTSAIAFLCALAPEPVVDFETRRPKADENGEPLYTVQLLVMGEDSA
Ga0190269_1073998613300018465SoilVKLPVDTSAIAFLCALEPQPVLAFDTKQPRADENGEPLYVVQLIALA
Ga0190269_1117591023300018465SoilMKLPVDTSAIAFLCALEPQPVLAFDTKQPRADENGEPLYLVQLIALAE
Ga0190268_1051261623300018466SoilMKLPVDTSAIAFLCALEPQPVLAFDTKQPRADENGERCMWCS
Ga0190268_1065577013300018466SoilMKLPVDTSAIAFLCAMAPEPVVDFETRRPKADENGEPL
Ga0190268_1097421313300018466SoilMRLPVDTSAIAFLCALEPQPVLAFDTKQPRADENGEPLYVVQ
Ga0190268_1124519713300018466SoilVKLPIDTSAIAFLCAMPPEPVVDFETRRPKADENGEPLYVVQLLV
Ga0190268_1230097013300018466SoilMKLPVDTSAIAFLCAVEAEPVVDFETKRPRADENGE
Ga0190267_1015501523300019767SoilVKLPVDTSAIAFLCALEPQPVLAFDTKQPRADENGEPLYVVQLIALAEGE
Ga0190267_1050833113300019767SoilMKLPVDTSAIAFLCALPPEPVIDFQTKQPRADENGEP
Ga0190267_1143676513300019767SoilVKLPVDTSSIAFLCALEPQPVLAFDTKQPRADENGEPLLRGPADR
Ga0222623_1023181623300022694Groundwater SedimentMKLPVDTSALAFLCALEPQPVLAFDTKQPRADENGEPLYVVQLIALGEG
Ga0209846_101150633300027277Groundwater SandVKLPVDTSALAFLCAMPPEPVVDFETRRPKADENGEPLYVVQLIAMTDG
Ga0209795_1011977123300027718AgaveVKLPIDTSAIAFLCAMPPEPVVDFETKRPRADDNGEPLYVV
Ga0209814_1019023613300027873Populus RhizosphereVKLPIDTSAIAFLCAMPPEPVVDFETRRPKADENGEPLYT
Ga0209481_1034748323300027880Populus RhizosphereMKLPVDTSAIAFLCALEPQPVLDFETRQPRADGNGEPLYVVQLIALGE
Ga0207428_1083018923300027907Populus RhizosphereLKLPVDTSAIAFLCALEPQPVLDFETRRPRADENGEPLYVI
Ga0209382_1010667263300027909Populus RhizosphereVKLPVDTSAIAFLCALEPQPLLAFDTKQPRADENGEPLYV
Ga0209382_1213550513300027909Populus RhizosphereVKLPVDTSAIAFLCAVEAEPVVDFETKRPRADENG
Ga0247820_1111119223300028597SoilVKLPIDTSAIAFLCTLAPEPVIDFETKRPRADENGEPLY
Ga0307321_110099823300028704SoilMKLPVDTSAIAFLCALPPEPVIDFQTKQPRADENGEPLYVIQLL
Ga0307291_112409023300028707SoilVDAVACSEAAIAFLCAVEAEPVVDFETKRPRADENGEPLYLVQLIA
Ga0307293_1016115723300028711SoilMKLPVDTSAIAFLCAVEAEPVVDFETRRPKADENGEPLYLVQLIAMTD
Ga0307317_1027568623300028720SoilVKLPVDTSAIAFLCALEPQPLLAFDTKQPRADENGEPLY
Ga0307315_1028336513300028721SoilMKLPVDTSAIAFLCAVEAEPVVDFETKRPRADENGEPL
Ga0307319_1030647013300028722SoilMKLPVDTSAIAFLCALEPQPLLAFDTKQPRADENGEPLYVVQLIALGD
Ga0307318_1015286613300028744SoilMKLPVDTSAIAFLCAVEAEPVVDFETRRPRADENG
Ga0307320_1017672213300028771SoilVKLPIDTSAIAFLCAMPPEPVVDFETRRPKADENGEPLFVVQLLVMGED
Ga0307287_1010602813300028796SoilMKLPVDTSSIAFLCALEPQPVLAFDTKQPRADENGEPLYVVQLIALGE
Ga0307292_1027421613300028811SoilMKLPVDTSAIAFLCALEPQPVLAFDTKQPRADENGEPLYV
Ga0247825_1141551723300028812SoilMKLPVDTSAIAFLCALEPQPVLAFDTKQPRADENGEPLYVVQ
Ga0307296_1028204423300028819SoilMKLPVDTSSIAFLCALEPQPLLAFDTKQPRADGNG
Ga0307277_1001500813300028881SoilVKLPIDTSAIAFLCAMPPEPVVDFETRRPKADENGEPLYV
Ga0268259_1014932823300030499AgaveMRLPVDTSAIAFLCALEPQPVLAFDTKQPRADENGEPL
Ga0307408_10160471913300031548RhizosphereMKLPVDTSAMAFLCALEPQPLLAFDTKQPRADENG
Ga0307408_10211343713300031548RhizosphereMKLPVDTSAIAFLCALEPQPVVDFETKRPRADENGEPL
Ga0307405_1006162233300031731RhizosphereMKLPVDTSAIAFVCALAPEPVVDFETRRPKADENGEPLYVIQL
Ga0307405_1089324113300031731RhizosphereVKLPVDTSAIAFLCALEPQPLLRFDTKEPRADENGEP
Ga0307405_1100904723300031731RhizosphereLKLPIDTSAIAFLCAMPPEPVLDFQTCQTKADDNGEPLYVIRS
Ga0307413_1050837523300031824RhizosphereVKLPIDTSAIAFLCAMPPEPVVDFETRRPKADENGEPLYVVQLLVMGEAG
Ga0307413_1094662433300031824RhizosphereMKLPVDTSSIAFLCALEPQPVLAFDTKQPRADENGEPLYVV
Ga0307410_1069510733300031852RhizosphereLKLPIDTSAIAFLCAMPPEPVVDFQTCQPKADDNGEPLYVIRS
Ga0307410_1108180323300031852RhizosphereMKLPVDTSAIAFLCALEPQPVLDFETRRPRADENGEPLYVIQL
Ga0307410_1193515913300031852RhizosphereMKLPVDTSAIAFLCALEPQPVLAFDTKQQRADENGEPLYVVQLIALAEGE
Ga0307406_1003117863300031901RhizosphereMKLPVDTSAIAFLCALEPQPVLAFDTKQPRADENGEPLYVVQLIALAEG
Ga0307406_1013570733300031901RhizosphereMKLPVDTSSIAFLCALEPQPVLDFETRQPRADGNGEPLYVV
Ga0307406_1039691523300031901RhizosphereMKLPIDTSAIAFLCAMPPEPVVDFETRRPKADENGEPLYVVQ
Ga0307406_1096590913300031901RhizosphereMKLPVDTSAIAFLCAVEAEPVVDFETKRPRADENGEP
Ga0307406_1172613913300031901RhizosphereMKLPVDTSSIAFLCALEPQPVLAFDTKQPRADENG
Ga0307407_1004617213300031903RhizosphereMKLPVDTSAIAFLCALEPQPVLDFETRQPRADGNGEPLYVVQLIALG
Ga0307407_1055738313300031903RhizosphereMKLPVDTSAIAFLCALEPQPLLNFQSKEQRADENGE
Ga0307412_1085723813300031911RhizosphereVKLPIDTSAIAFLCAMPPEPVVDFETRRPKADENGEPLYVAQLLVMGED
Ga0307409_10019135833300031995RhizosphereMKLPVDTSAIAFLCALEPQPVLAFDTKQPRADENGEPLYVVQL
Ga0307409_10060229923300031995RhizosphereMKLPVDTSAIAFLCALEPQPVLAFDTKQPRADENGEPLYVV
Ga0307416_10082848613300032002RhizosphereMKLPVDTSAIAFLCAVEAEPVVDFETRRPKADENGEPLYLVQLI
Ga0307416_10115348423300032002RhizosphereMKLPVDTSAIAFLCAMPPEPVVDFETRRPKADENGEPLYLVQLLVM
Ga0307416_10152142723300032002RhizosphereMKLPVDTSSIAFLCALEPQPVLAFDTKQPRADENGEPLYVVQL
Ga0307416_10250561813300032002RhizosphereMRLPVDTSAIAFLCAVEAEPVVDFETRRPKADENGEPLYVV
Ga0307414_1005076143300032004RhizosphereVKLPIDTSAIAFLCAMPPEPVVDFETRRPKADENGEPLYVVQLLVMGEDSADLIA
Ga0307414_1015926633300032004RhizosphereMKLPVDTSAIAFLCAVEAEPVVDFETRRPKADENGEPLYLV
Ga0307411_1013553213300032005RhizosphereMKLPVDTSSIAFLCALEPQPVLAFDTKQPRADENGEPLYVVQ
Ga0307411_1065952513300032005RhizosphereMKLPVDTSSIAFLCALEPQPVLDFETRRPRADENGEPLYVIQLIALAE
Ga0307415_10045165413300032126RhizosphereVKLPVDTSSIAFLCALEPQPVLAFDTKQPRADENGEPLYVVQLIAL
Ga0307415_10064983023300032126RhizosphereVKLPIDTSAIAFLCAMPPEPVVDFETRRPKADENGEPLYVIQLLVMGEDSAD
Ga0307415_10233262423300032126RhizosphereMRLPVDTSSIAFLCALEPQPVLAFDTKQPRADENGEPLYVV
Ga0307415_10250848723300032126RhizosphereMKLPVDTSAIAFLCALEPQPVLAFDTKQPRADENGEPLY
Ga0272423_106967413300033168RockMKLPIDTTGVTFLCALAPEPLMDFETKRQKGDLNGEP
Ga0334913_050078_761_8863300034172Sub-Biocrust SoilVKLPIDTSAIAFLCALAPEPVVDFETRRPKADENGEPLYTVQ
Ga0334913_088452_535_6543300034172Sub-Biocrust SoilMKLPVDTSAIAFLCALAPEPVVDFETRRPKADENGEPLYL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.