Metagenome / Metatranscriptome Family F054121

Basic Information
Family ID	F054121
Family Type	Metagenome / Metatranscriptome
Number of Sequences	140
Average Sequence Length	42 residues
Representative Sequence	MDEPGEDPREARFLPILLYVLGFMAALALLALAAGWLLRHL
Number of Associated Samples	121
Number of Associated Scaffolds	140

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	62.32 %
% of genes near scaffold ends (potentially truncated)	23.57 %
% of genes from short scaffolds (< 2000 bps)	82.86 %
Associated GOLD sequencing projects	110
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.47

Most Common Taxonomy
Group	Bacteria (79.286 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere (7.143 % of family members)
Environment Ontology (ENVO)	Unclassified (36.429 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (47.857 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 47.83% β-sheet: 0.00% Coil/Unstructured: 52.17%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 140 Family Scaffolds
PF07690	MFS_1	42.86
PF07992	Pyr_redox_2	38.57
PF00070	Pyr_redox	3.57
PF00155	Aminotran_1_2	2.86
PF00795	CN_hydrolase	1.43
PF13432	TPR_16	0.71
PF00158	Sigma54_activat	0.71
PF00171	Aldedh	0.71
PF01329	Pterin_4a	0.71
PF14559	TPR_19	0.71
PF04952	AstE_AspA	0.71
PF13738	Pyr_redox_3	0.71

COG ID	Name	Functional Category	% Frequency in 140 Family Scaffolds
COG0014	Gamma-glutamyl phosphate reductase	Amino acid transport and metabolism [E]	0.71
COG1012	Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase	Lipid transport and metabolism [I]	0.71
COG2154	Pterin-4a-carbinolamine dehydratase	Coenzyme transport and metabolism [H]	0.71
COG4230	Delta 1-pyrroline-5-carboxylate dehydrogenase	Amino acid transport and metabolism [E]	0.71

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	81.43 %
Unclassified	root	N/A	18.57 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	81.43 %
Unclassified	root	N/A	18.57 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	79.29 %
Unclassified	root	N/A	18.57 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	2.14 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	18.57 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	13.57 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	3.57 %
unclassified Bacteria	no rank	All Organisms → cellular organisms → Bacteria → unclassified Bacteria	2.14 %
Sar	clade	All Organisms → cellular organisms → Eukaryota → Sar	1.43 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	0.71 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.71 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	0.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	18.57 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	10.71 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	3.57 %
bacterium HR12	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR12	2.14 %
Stramenopiles	clade	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles	1.43 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	0.71 %
Bacteroidetes/Chlorobi group	clade	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group	0.71 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	18.57 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	10.71 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	2.14 %
bacterium HR12	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR12	2.14 %
Bigyra	class	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Bigyra	1.43 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	0.71 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.71 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	18.57 %
Myxococcales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales	10.71 %
bacterium HR12	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR12	2.14 %
Labyrinthulomycetes	subclass	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Bigyra → Labyrinthulomycetes	1.43 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	0.71 %
Bifidobacteriales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Bifidobacteriales	0.71 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.71 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	18.57 %
bacterium HR12	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR12	2.14 %
Labyrinthulomycetes	subclass	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Bigyra → Labyrinthulomycetes	1.43 %
Sorangiineae	suborder	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae	0.71 %
Bifidobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Bifidobacteriales → Bifidobacteriaceae	0.71 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	0.71 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.71 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	18.57 %
bacterium HR12	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR12	2.14 %
Labyrinthulomycetes	subclass	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Bigyra → Labyrinthulomycetes	1.43 %
Bifidobacterium	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Bifidobacteriales → Bifidobacteriaceae → Bifidobacterium	0.71 %
Polyangiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae	0.71 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	0.71 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.71 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	18.57 %
bacterium HR12	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR12	2.14 %
Labyrinthulomycetes	subclass	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Bigyra → Labyrinthulomycetes	1.43 %
Chondromyces	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → Chondromyces	0.71 %
Bifidobacterium animalis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Bifidobacteriales → Bifidobacteriaceae → Bifidobacterium → Bifidobacterium animalis	0.71 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	0.71 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.71 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	18.57 %
bacterium HR12	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR12	2.14 %
Labyrinthulomycetes	subclass	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Bigyra → Labyrinthulomycetes	1.43 %
Bifidobacterium animalis subsp. lactis	subspecies	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Bifidobacteriales → Bifidobacteriaceae → Bifidobacterium → Bifidobacterium animalis → Bifidobacterium animalis subsp. lactis	0.71 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	0.71 %
Chondromyces	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → Chondromyces	0.71 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.71 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	18.57 %
bacterium HR12	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR12	2.14 %
Labyrinthulomycetes	subclass	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Bigyra → Labyrinthulomycetes	1.43 %
Bifidobacterium animalis subsp. lactis CNCM I-2494	strain	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Bifidobacteriales → Bifidobacteriaceae → Bifidobacterium → Bifidobacterium animalis → Bifidobacterium animalis subsp. lactis → Bifidobacterium animalis subsp. lactis CNCM I-2494	0.71 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	0.71 %
Chondromyces	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → Chondromyces	0.71 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.71 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	18.57 %
bacterium HR12	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR12	2.14 %
Labyrinthulomycetes	subclass	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Bigyra → Labyrinthulomycetes	1.43 %
eudicotyledons	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons	0.71 %
Bifidobacterium animalis subsp. lactis CNCM I-2494	strain	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Bifidobacteriales → Bifidobacteriaceae → Bifidobacterium → Bifidobacterium animalis → Bifidobacterium animalis subsp. lactis → Bifidobacterium animalis subsp. lactis CNCM I-2494	0.71 %
Chondromyces	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → Chondromyces	0.71 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.71 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	18.57 %
bacterium HR12	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR12	2.14 %
Labyrinthulomycetes	subclass	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Bigyra → Labyrinthulomycetes	1.43 %
Gunneridae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae	0.71 %
Bifidobacterium animalis subsp. lactis CNCM I-2494	strain	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Bifidobacteriales → Bifidobacteriaceae → Bifidobacterium → Bifidobacterium animalis → Bifidobacterium animalis subsp. lactis → Bifidobacterium animalis subsp. lactis CNCM I-2494	0.71 %
Chondromyces	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → Chondromyces	0.71 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.71 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	18.57 %
bacterium HR12	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR12	2.14 %
Labyrinthulomycetes	subclass	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Bigyra → Labyrinthulomycetes	1.43 %
Pentapetalae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae	0.71 %
Bifidobacterium animalis subsp. lactis CNCM I-2494	strain	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Bifidobacteriales → Bifidobacteriaceae → Bifidobacterium → Bifidobacterium animalis → Bifidobacterium animalis subsp. lactis → Bifidobacterium animalis subsp. lactis CNCM I-2494	0.71 %
Chondromyces	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → Chondromyces	0.71 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.71 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	18.57 %
bacterium HR12	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR12	2.14 %
Labyrinthulomycetes	subclass	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Bigyra → Labyrinthulomycetes	1.43 %
rosids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids	0.71 %
Bifidobacterium animalis subsp. lactis CNCM I-2494	strain	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Bifidobacteriales → Bifidobacteriaceae → Bifidobacterium → Bifidobacterium animalis → Bifidobacterium animalis subsp. lactis → Bifidobacterium animalis subsp. lactis CNCM I-2494	0.71 %
Chondromyces	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → Chondromyces	0.71 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.71 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	18.57 %
bacterium HR12	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR12	2.14 %
Labyrinthulomycetes	subclass	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Bigyra → Labyrinthulomycetes	1.43 %
fabids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids	0.71 %
Bifidobacterium animalis subsp. lactis CNCM I-2494	strain	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Bifidobacteriales → Bifidobacteriaceae → Bifidobacterium → Bifidobacterium animalis → Bifidobacterium animalis subsp. lactis → Bifidobacterium animalis subsp. lactis CNCM I-2494	0.71 %
Chondromyces	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → Chondromyces	0.71 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.71 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	18.57 %
bacterium HR12	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR12	2.14 %
Labyrinthulomycetes	subclass	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Bigyra → Labyrinthulomycetes	1.43 %
Rosales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales	0.71 %
Bifidobacterium animalis subsp. lactis CNCM I-2494	strain	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Bifidobacteriales → Bifidobacteriaceae → Bifidobacterium → Bifidobacterium animalis → Bifidobacterium animalis subsp. lactis → Bifidobacterium animalis subsp. lactis CNCM I-2494	0.71 %
Chondromyces	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → Chondromyces	0.71 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.71 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	18.57 %
bacterium HR12	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR12	2.14 %
Labyrinthulomycetes	subclass	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Bigyra → Labyrinthulomycetes	1.43 %
Cannabaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Cannabaceae	0.71 %
Bifidobacterium animalis subsp. lactis CNCM I-2494	strain	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Bifidobacteriales → Bifidobacteriaceae → Bifidobacterium → Bifidobacterium animalis → Bifidobacterium animalis subsp. lactis → Bifidobacterium animalis subsp. lactis CNCM I-2494	0.71 %
Chondromyces	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → Chondromyces	0.71 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.71 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.71 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2170459002\|FZY7DQ102IE4MM	Not Available	510	Open in IMG/M
3300000886\|AL3A1W_1004307	All Organisms → cellular organisms → Bacteria	707	Open in IMG/M
3300001145\|JGI12682J13319_1000241	All Organisms → cellular organisms → Bacteria	6038	Open in IMG/M
3300003995\|Ga0055438_10011377	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales	1830	Open in IMG/M
3300004480\|Ga0062592_100127440	All Organisms → cellular organisms → Bacteria → Acidobacteria	1650	Open in IMG/M
3300004480\|Ga0062592_101283301	All Organisms → cellular organisms → Bacteria	690	Open in IMG/M
3300005328\|Ga0070676_10072782	All Organisms → cellular organisms → Bacteria	2067	Open in IMG/M
3300005330\|Ga0070690_100204760	All Organisms → cellular organisms → Bacteria	1375	Open in IMG/M
3300005338\|Ga0068868_102009747	Not Available	549	Open in IMG/M
3300005339\|Ga0070660_100824411	Not Available	781	Open in IMG/M
3300005347\|Ga0070668_101535585	Not Available	609	Open in IMG/M
3300005355\|Ga0070671_100569418	All Organisms → cellular organisms → Bacteria	978	Open in IMG/M
3300005356\|Ga0070674_101675035	All Organisms → cellular organisms → Bacteria	575	Open in IMG/M
3300005365\|Ga0070688_100060869	All Organisms → cellular organisms → Bacteria	2385	Open in IMG/M
3300005367\|Ga0070667_101980684	All Organisms → cellular organisms → Bacteria	549	Open in IMG/M
3300005437\|Ga0070710_10742426	All Organisms → cellular organisms → Bacteria	696	Open in IMG/M
3300005440\|Ga0070705_100212588	All Organisms → cellular organisms → Bacteria	1334	Open in IMG/M
3300005456\|Ga0070678_100294326	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Cannabaceae	1377	Open in IMG/M
3300005459\|Ga0068867_100021195	All Organisms → cellular organisms → Bacteria	4635	Open in IMG/M
3300005467\|Ga0070706_100487385	All Organisms → cellular organisms → Bacteria	1147	Open in IMG/M
3300005468\|Ga0070707_101923941	All Organisms → cellular organisms → Bacteria	559	Open in IMG/M
3300005543\|Ga0070672_100052751	All Organisms → cellular organisms → Bacteria	3176	Open in IMG/M
3300005546\|Ga0070696_102000512	Not Available	503	Open in IMG/M
3300005617\|Ga0068859_100130520	All Organisms → cellular organisms → Bacteria	2584	Open in IMG/M
3300005618\|Ga0068864_100722016	All Organisms → cellular organisms → Bacteria	975	Open in IMG/M
3300005764\|Ga0066903_101933626	All Organisms → cellular organisms → Bacteria	1131	Open in IMG/M
3300005764\|Ga0066903_103560683	All Organisms → cellular organisms → Bacteria	839	Open in IMG/M
3300005764\|Ga0066903_104992657	Not Available	704	Open in IMG/M
3300005841\|Ga0068863_100417303	All Organisms → cellular organisms → Bacteria	1314	Open in IMG/M
3300005841\|Ga0068863_100485511	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR12	1215	Open in IMG/M
3300005937\|Ga0081455_10007281	All Organisms → cellular organisms → Bacteria	11675	Open in IMG/M
3300005938\|Ga0066795_10038288	All Organisms → cellular organisms → Bacteria	1408	Open in IMG/M
3300006047\|Ga0075024_100102729	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Bifidobacteriales → Bifidobacteriaceae → Bifidobacterium → Bifidobacterium animalis → Bifidobacterium animalis subsp. lactis → Bifidobacterium animalis subsp. lactis CNCM I-2494	1255	Open in IMG/M
3300006237\|Ga0097621_100578541	All Organisms → cellular organisms → Bacteria	1025	Open in IMG/M
3300006358\|Ga0068871_101411188	All Organisms → cellular organisms → Bacteria	657	Open in IMG/M
3300006579\|Ga0074054_11472536	All Organisms → cellular organisms → Bacteria	628	Open in IMG/M
3300006844\|Ga0075428_100859644	All Organisms → cellular organisms → Bacteria	963	Open in IMG/M
3300006854\|Ga0075425_100398145	All Organisms → cellular organisms → Bacteria	1586	Open in IMG/M
3300006904\|Ga0075424_102461694	All Organisms → cellular organisms → Bacteria	545	Open in IMG/M
3300006931\|Ga0097620_101210586	All Organisms → cellular organisms → Bacteria	832	Open in IMG/M
3300009053\|Ga0105095_10033004	All Organisms → cellular organisms → Bacteria	2786	Open in IMG/M
3300009081\|Ga0105098_10365525	All Organisms → cellular organisms → Bacteria	709	Open in IMG/M
3300009814\|Ga0105082_1074422	Not Available	607	Open in IMG/M
3300009815\|Ga0105070_1049352	Not Available	778	Open in IMG/M
3300009837\|Ga0105058_1177740	Not Available	525	Open in IMG/M
3300010373\|Ga0134128_10166552	All Organisms → cellular organisms → Bacteria	2489	Open in IMG/M
3300010375\|Ga0105239_13306508	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → Chondromyces	525	Open in IMG/M
3300010397\|Ga0134124_11849707	All Organisms → cellular organisms → Bacteria	638	Open in IMG/M
3300010399\|Ga0134127_11086486	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR12	863	Open in IMG/M
3300010400\|Ga0134122_13241396	Not Available	510	Open in IMG/M
3300010401\|Ga0134121_10218832	All Organisms → cellular organisms → Bacteria → Proteobacteria	1654	Open in IMG/M
3300010867\|Ga0126347_1302594	All Organisms → cellular organisms → Bacteria	580	Open in IMG/M
3300012204\|Ga0137374_11264345	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Bigyra → Labyrinthulomycetes	512	Open in IMG/M
3300012212\|Ga0150985_110141534	Not Available	631	Open in IMG/M
3300012358\|Ga0137368_10752074	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales	608	Open in IMG/M
3300012899\|Ga0157299_10071112	All Organisms → cellular organisms → Bacteria	834	Open in IMG/M
3300012957\|Ga0164303_10515762	All Organisms → cellular organisms → Bacteria	769	Open in IMG/M
3300012971\|Ga0126369_12495169	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales	602	Open in IMG/M
3300012984\|Ga0164309_10388339	All Organisms → cellular organisms → Bacteria	1037	Open in IMG/M
3300012989\|Ga0164305_10207799	All Organisms → cellular organisms → Bacteria	1382	Open in IMG/M
3300013100\|Ga0157373_10687422	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales	749	Open in IMG/M
3300013102\|Ga0157371_11646283	Not Available	503	Open in IMG/M
3300013306\|Ga0163162_11422033	Not Available	789	Open in IMG/M
3300014324\|Ga0075352_1025274	All Organisms → cellular organisms → Bacteria	1274	Open in IMG/M
3300014829\|Ga0120104_1004865	Not Available	2383	Open in IMG/M
3300015168\|Ga0167631_1013693	All Organisms → cellular organisms → Bacteria	1236	Open in IMG/M
3300015168\|Ga0167631_1036333	All Organisms → cellular organisms → Bacteria	801	Open in IMG/M
3300015371\|Ga0132258_10374292	All Organisms → cellular organisms → Bacteria	3530	Open in IMG/M
3300015371\|Ga0132258_10625542	All Organisms → cellular organisms → Bacteria	2705	Open in IMG/M
3300015372\|Ga0132256_101771114	All Organisms → cellular organisms → Bacteria	726	Open in IMG/M
3300015373\|Ga0132257_100061296	All Organisms → cellular organisms → Bacteria	4224	Open in IMG/M
3300015373\|Ga0132257_104112460	All Organisms → cellular organisms → Bacteria	529	Open in IMG/M
3300015374\|Ga0132255_105240380	All Organisms → cellular organisms → Bacteria	549	Open in IMG/M
3300017792\|Ga0163161_10656449	All Organisms → cellular organisms → Bacteria → Proteobacteria	869	Open in IMG/M
3300017974\|Ga0187777_11222398	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Bigyra → Labyrinthulomycetes	550	Open in IMG/M
3300018056\|Ga0184623_10440699	All Organisms → cellular organisms → Bacteria	565	Open in IMG/M
3300018058\|Ga0187766_10245862	All Organisms → cellular organisms → Bacteria	1143	Open in IMG/M
3300018084\|Ga0184629_10003153	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales	6160	Open in IMG/M
3300018422\|Ga0190265_11115833	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	909	Open in IMG/M
3300018482\|Ga0066669_10637950	All Organisms → cellular organisms → Bacteria	936	Open in IMG/M
3300021081\|Ga0210379_10053465	All Organisms → cellular organisms → Bacteria	1613	Open in IMG/M
3300021432\|Ga0210384_10064191	All Organisms → cellular organisms → Bacteria	3314	Open in IMG/M
3300021445\|Ga0182009_10079163	All Organisms → cellular organisms → Bacteria	1460	Open in IMG/M
3300021445\|Ga0182009_10802203	Not Available	515	Open in IMG/M
3300021478\|Ga0210402_10002907	All Organisms → cellular organisms → Bacteria	16357	Open in IMG/M
3300021559\|Ga0210409_10353848	All Organisms → cellular organisms → Bacteria	1319	Open in IMG/M
3300025315\|Ga0207697_10528703	Not Available	520	Open in IMG/M
3300025324\|Ga0209640_10809392	Not Available	737	Open in IMG/M
3300025899\|Ga0207642_10566367	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales	703	Open in IMG/M
3300025899\|Ga0207642_10858885	Not Available	580	Open in IMG/M
3300025903\|Ga0207680_10066514	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales	2217	Open in IMG/M
3300025905\|Ga0207685_10271175	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	829	Open in IMG/M
3300025910\|Ga0207684_11374393	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales	579	Open in IMG/M
3300025920\|Ga0207649_10529848	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	899	Open in IMG/M
3300025925\|Ga0207650_10041601	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales	3368	Open in IMG/M
3300025931\|Ga0207644_10166419	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales	1718	Open in IMG/M
3300025931\|Ga0207644_10575277	All Organisms → cellular organisms → Bacteria	934	Open in IMG/M
3300025934\|Ga0207686_11169792	All Organisms → cellular organisms → Bacteria	629	Open in IMG/M
3300025938\|Ga0207704_10101956	All Organisms → cellular organisms → Bacteria	1916	Open in IMG/M
3300025941\|Ga0207711_11214738	Not Available	695	Open in IMG/M
3300025942\|Ga0207689_10294891	All Organisms → cellular organisms → Bacteria	1344	Open in IMG/M
3300025981\|Ga0207640_10305972	All Organisms → cellular organisms → Bacteria	1259	Open in IMG/M
3300025981\|Ga0207640_12138085	Not Available	508	Open in IMG/M
3300026088\|Ga0207641_10088999	All Organisms → cellular organisms → Bacteria	2697	Open in IMG/M
3300026088\|Ga0207641_10296171	All Organisms → cellular organisms → Bacteria	1526	Open in IMG/M
3300026088\|Ga0207641_10464520	All Organisms → cellular organisms → Bacteria	1225	Open in IMG/M
3300026095\|Ga0207676_10716762	All Organisms → cellular organisms → Bacteria	970	Open in IMG/M
3300026095\|Ga0207676_12031628	Not Available	573	Open in IMG/M
3300026271\|Ga0209880_1107058	Not Available	562	Open in IMG/M
3300027667\|Ga0209009_1000216	All Organisms → cellular organisms → Bacteria	23297	Open in IMG/M
3300027722\|Ga0209819_10011407	All Organisms → cellular organisms → Bacteria	2876	Open in IMG/M
3300027731\|Ga0209592_1107948	All Organisms → cellular organisms → Bacteria	1014	Open in IMG/M
3300027909\|Ga0209382_10453553	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales	1420	Open in IMG/M
3300027915\|Ga0209069_10115105	All Organisms → cellular organisms → Bacteria	1310	Open in IMG/M
3300028592\|Ga0247822_10589107	All Organisms → cellular organisms → Bacteria	889	Open in IMG/M
3300028596\|Ga0247821_11209783	All Organisms → cellular organisms → Bacteria	514	Open in IMG/M
3300028792\|Ga0307504_10064106	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales	1086	Open in IMG/M
3300030336\|Ga0247826_11583184	All Organisms → cellular organisms → Bacteria	533	Open in IMG/M
3300031366\|Ga0307506_10054972	All Organisms → cellular organisms → Bacteria	1174	Open in IMG/M
3300031682\|Ga0318560_10319929	All Organisms → cellular organisms → Bacteria → Proteobacteria	837	Open in IMG/M
3300031720\|Ga0307469_10178409	All Organisms → cellular organisms → Bacteria	1630	Open in IMG/M
3300031720\|Ga0307469_10262547	All Organisms → cellular organisms → Bacteria	1398	Open in IMG/M
3300031720\|Ga0307469_10613506	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales	974	Open in IMG/M
3300031779\|Ga0318566_10388941	All Organisms → cellular organisms → Bacteria	687	Open in IMG/M
3300031834\|Ga0315290_10377895	All Organisms → cellular organisms → Bacteria	1242	Open in IMG/M
3300032092\|Ga0315905_11106753	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales	656	Open in IMG/M
3300032180\|Ga0307471_100403655	All Organisms → cellular organisms → Bacteria	1495	Open in IMG/M
3300032180\|Ga0307471_100894595	All Organisms → cellular organisms → Bacteria → Proteobacteria	1055	Open in IMG/M
3300032180\|Ga0307471_101771630	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	770	Open in IMG/M
3300032205\|Ga0307472_100438682	All Organisms → cellular organisms → Bacteria	1106	Open in IMG/M
3300032205\|Ga0307472_102028355	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	577	Open in IMG/M
3300032397\|Ga0315287_12654804	Not Available	534	Open in IMG/M
3300032516\|Ga0315273_10028489	All Organisms → cellular organisms → Bacteria	7419	Open in IMG/M
3300032782\|Ga0335082_10272162	All Organisms → cellular organisms → Bacteria	1572	Open in IMG/M
3300033408\|Ga0316605_11449150	Not Available	666	Open in IMG/M
3300033807\|Ga0314866_089432	All Organisms → cellular organisms → Bacteria	545	Open in IMG/M
3300034123\|Ga0370479_0108196	All Organisms → cellular organisms → Bacteria	740	Open in IMG/M
3300034178\|Ga0364934_0139852	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR12	916	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	62.14%
Host-Associated	Host-Associated	37.86%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	52.14%
Plants	Host-Associated → Plants	37.86%
Aquatic	Environmental → Aquatic	10.00%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	51.43%
Rhizoplane	Host-Associated → Plants → Rhizoplane	20.71%
Rhizosphere	Host-Associated → Plants → Rhizosphere	15.71%
Freshwater	Environmental → Aquatic → Freshwater	6.43%
Sediment	Environmental → Aquatic → Sediment	2.86%
Roots	Host-Associated → Plants → Roots	1.43%
Marine	Environmental → Aquatic → Marine	0.71%
Floodplain	Environmental → Terrestrial → Floodplain	0.71%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	30.71%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	15.71%
Loam	Environmental → Terrestrial → Soil → Loam	12.14%
Soil	Host-Associated → Plants → Rhizosphere → Soil	9.29%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	6.43%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	6.43%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	4.29%
Sediment	Environmental → Aquatic → Freshwater → Sediment	3.57%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	2.86%
Lake	Environmental → Aquatic → Freshwater → Lake	2.14%
Sand	Environmental → Terrestrial → Soil → Sand	2.14%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	1.43%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified	0.71%
Wetlands	Environmental → Aquatic → Marine → Wetlands	0.71%
Sediment	Environmental → Terrestrial → Floodplain → Sediment	0.71%
Soil	Host-Associated → Plants → Rhizoplane → Soil	0.71%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	15.71%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	15.00%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	9.29%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	9.29%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	6.43%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	6.43%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	5.00%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	5.00%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	4.29%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	3.57%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	2.86%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	2.14%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	2.14%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	2.14%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	1.43%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost	1.43%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	1.43%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost	1.43%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	1.43%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified → Unclassified	0.71%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	0.71%
Unclassified	Environmental → Terrestrial → Soil → Loam → Unclassified	0.71%
Unclassified	Environmental → Terrestrial → Floodplain → Sediment → Unclassified	0.71%
Unclassified	Host-Associated → Plants → Rhizoplane → Soil → Unclassified	0.71%

Habitat	Taxonomy	Distribution
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	7.14%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	5.71%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	5.00%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	5.00%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	5.00%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	4.29%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	3.57%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	3.57%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	3.57%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	2.86%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	2.86%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	2.86%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	2.14%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	2.14%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	2.14%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	2.14%
Groundwater Sand	Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand	2.14%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	2.14%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	1.43%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	1.43%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	1.43%
Glacier Forefield Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil	1.43%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	1.43%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost	1.43%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	1.43%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	1.43%
Soil	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil	1.43%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	1.43%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	1.43%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	1.43%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	1.43%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	1.43%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	1.43%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	0.71%
Freshwater	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater	0.71%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	0.71%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	0.71%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	0.71%
Grass Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil	0.71%
Untreated Peat Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil	0.71%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	0.71%
Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland	0.71%
Soil	Environmental → Terrestrial → Soil → Loam → Unclassified → Soil	0.71%
Sediment	Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment	0.71%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere	0.71%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere	0.71%
Corn, Switchgrass And Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	0.71%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere	0.71%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.71%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.71%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.71%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	0.71%
Boreal Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil	0.71%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2170459002	Grass soil microbial communities from Rothamsted Park, UK - March 2009 direct MP BIO 1O1 lysis 0-21 cm	Environmental	Open in IMG/M
3300000886	Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-65cm-3A)- 1 week illumina	Environmental	Open in IMG/M
3300001145	Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2	Environmental	Open in IMG/M
3300003995	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D2	Environmental	Open in IMG/M
3300004480	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4	Environmental	Open in IMG/M
3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Host-Associated	Open in IMG/M
3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Environmental	Open in IMG/M
3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Host-Associated	Open in IMG/M
3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Host-Associated	Open in IMG/M
3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Host-Associated	Open in IMG/M
3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Host-Associated	Open in IMG/M
3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Host-Associated	Open in IMG/M
3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Environmental	Open in IMG/M
3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Host-Associated	Open in IMG/M
3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Environmental	Open in IMG/M
3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Environmental	Open in IMG/M
3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Host-Associated	Open in IMG/M
3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Host-Associated	Open in IMG/M
3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Environmental	Open in IMG/M
3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Environmental	Open in IMG/M
3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Host-Associated	Open in IMG/M
3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Environmental	Open in IMG/M
3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Host-Associated	Open in IMG/M
3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Host-Associated	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated	Open in IMG/M
3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Host-Associated	Open in IMG/M
3300005938	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191	Environmental	Open in IMG/M
3300006047	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013	Environmental	Open in IMG/M
3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)	Host-Associated	Open in IMG/M
3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Host-Associated	Open in IMG/M
3300006579	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006844	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Host-Associated	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300006904	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3	Host-Associated	Open in IMG/M
3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2)	Host-Associated	Open in IMG/M
3300009053	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015	Environmental	Open in IMG/M
3300009081	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015	Environmental	Open in IMG/M
3300009814	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60	Environmental	Open in IMG/M
3300009815	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10	Environmental	Open in IMG/M
3300009837	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30	Environmental	Open in IMG/M
3300010373	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4	Environmental	Open in IMG/M
3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Host-Associated	Open in IMG/M
3300010397	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4	Environmental	Open in IMG/M
3300010399	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3	Environmental	Open in IMG/M
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental	Open in IMG/M
3300010401	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1	Environmental	Open in IMG/M
3300010867	Boreal forest soil eukaryotic communities from Alaska, USA - C3-5 Metatranscriptome (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300012204	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG	Environmental	Open in IMG/M
3300012212	Combined assembly of Hopland grassland soil	Host-Associated	Open in IMG/M
3300012358	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG	Environmental	Open in IMG/M
3300012899	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2	Environmental	Open in IMG/M
3300012957	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG	Environmental	Open in IMG/M
3300012971	Tropical forest soil microbial communities from Panama - MetaG Plot_1	Environmental	Open in IMG/M
3300012984	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG	Environmental	Open in IMG/M
3300012989	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG	Environmental	Open in IMG/M
3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Host-Associated	Open in IMG/M
3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Host-Associated	Open in IMG/M
3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Host-Associated	Open in IMG/M
3300014324	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D1	Environmental	Open in IMG/M
3300014829	Permafrost microbial communities from Nunavut, Canada - A10_35cm_6M	Environmental	Open in IMG/M
3300015168	Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G4A, Ice margin, adjacent to proglacial lake)	Environmental	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015372	Soil combined assembly	Host-Associated	Open in IMG/M
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Host-Associated	Open in IMG/M
3300017974	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG	Environmental	Open in IMG/M
3300018056	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1	Environmental	Open in IMG/M
3300018058	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG	Environmental	Open in IMG/M
3300018084	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1	Environmental	Open in IMG/M
3300018422	Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T	Environmental	Open in IMG/M
3300018482	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118	Environmental	Open in IMG/M
3300021081	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo	Environmental	Open in IMG/M
3300021432	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M	Environmental	Open in IMG/M
3300021445	Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG	Environmental	Open in IMG/M
3300021478	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M	Environmental	Open in IMG/M
3300021559	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M	Environmental	Open in IMG/M
3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)	Host-Associated	Open in IMG/M
3300025324	Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes)	Environmental	Open in IMG/M
3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026271	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191 (SPAdes)	Environmental	Open in IMG/M
3300027651	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes)	Environmental	Open in IMG/M
3300027667	Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes)	Environmental	Open in IMG/M
3300027678	Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes)	Environmental	Open in IMG/M
3300027722	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes)	Environmental	Open in IMG/M
3300027731	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 (SPAdes)	Environmental	Open in IMG/M
3300027909	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)	Host-Associated	Open in IMG/M
3300027915	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)	Environmental	Open in IMG/M
3300028592	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30	Environmental	Open in IMG/M
3300028596	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glycerol_Day14	Environmental	Open in IMG/M
3300028792	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S	Environmental	Open in IMG/M
3300030336	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1	Environmental	Open in IMG/M
3300031366	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_S	Environmental	Open in IMG/M
3300031682	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22	Environmental	Open in IMG/M
3300031720	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515	Environmental	Open in IMG/M
3300031779	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22	Environmental	Open in IMG/M
3300031834	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0	Environmental	Open in IMG/M
3300032092	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121	Environmental	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M
3300032205	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05	Environmental	Open in IMG/M
3300032397	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0	Environmental	Open in IMG/M
3300032516	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0	Environmental	Open in IMG/M
3300032782	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1	Environmental	Open in IMG/M
3300033408	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCT	Environmental	Open in IMG/M
3300033807	Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_10	Environmental	Open in IMG/M
3300034123	Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_01D_15	Environmental	Open in IMG/M
3300034178	Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.47
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.47
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F054121

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
E1_02034080	2170459002	Grass Soil	VRREPDPTKTPFVSILLYVMGFMGGLALLAYAAACFLRH
AL3A1W_10043072	3300000886	Permafrost	MDESEEGPRGTRFLPILLYVLGFMGALALLAVAAAWLLRRL*
JGI12682J13319_10002415	3300001145	Forest Soil	LGGQAEDPQKTRFLSILLYVMGFVGGLALLAWAVAWLLRHG*
Ga0055438_100113773	3300003995	Natural And Restored Wetlands	MDEPGGDPRRTPFLALLLYVLGFMGALALLALLAAWALRRL*
Ga0062592_1001274403	3300004480	Soil	GASMDEPPDDDPRSTPFLAILLYVLGFMLALAVLALAAGWLLKRLA*
Ga0062592_1012833012	3300004480	Soil	MGEEPEDDPRRTPFLAILIYVLGFMLALAVLALAAGWLLKRLA*
Ga0070676_100727822	3300005328	Miscanthus Rhizosphere	MDEDPGDPDEQDSARFLPILLYVLGFMVALALLAAAAAWLLKRFA*
Ga0070690_1002047602	3300005330	Switchgrass Rhizosphere	MSDEPPGDDPGRTPFLAILLYVLGFMFALALLALAAGWILKHLA*
Ga0068868_1020097472	3300005338	Miscanthus Rhizosphere	MGEEPEDDPRRTPFLAILLYVLGFMLALAVLALAAGWLLKRLA*
Ga0070660_1008244112	3300005339	Corn Rhizosphere	MDEDPGDPDEQDSARFLPILLYVLGFMLALALLAAAAAWLLKRFA*
Ga0070668_1015355852	3300005347	Switchgrass Rhizosphere	MSDEPPGDDPGRTPFLAILLYVLGFMFALALLALAAGWVLKHLA*
Ga0070671_1005694182	3300005355	Switchgrass Rhizosphere	MDDEPPGDDPGRTPFLAILLYVLGFMFALALLALAAGWVLKHLA*
Ga0070674_1016750352	3300005356	Miscanthus Rhizosphere	HPWMSDEPPGDDPGRTPFLAILLYVLGFMFALALLALAAGWILKHIA*
Ga0070688_1000608693	3300005365	Switchgrass Rhizosphere	MSNEPPGDDPGRTPFLAILLYVLGFMFALALLALAAGWILKHLA*
Ga0070667_1019806842	3300005367	Switchgrass Rhizosphere	MDDEPDGDDPGRTPFLAILLYVLGFMFALALLALAAGWILKHLA*
Ga0070710_107424262	3300005437	Corn, Switchgrass And Miscanthus Rhizosphere	MPEPPDEDPSRTPFLAILLYVLGFMLALAVLAYAAAWILRHLA*
Ga0070705_1002125882	3300005440	Corn, Switchgrass And Miscanthus Rhizosphere	MDDPENDPNANRFLPILLYVLGFMFALALAALVAGWLLRHL*
Ga0070678_1002943262	3300005456	Miscanthus Rhizosphere	MSDEPPGDDPGRTPFLAILLYVLGFMFALALLALAAGWILKHIA*
Ga0068867_1000211952	3300005459	Miscanthus Rhizosphere	MDEDSGDRDEQDSARFLPILLYVLGFMVALALLAAAAAWLLKRFA*
Ga0070706_1004873852	3300005467	Corn, Switchgrass And Miscanthus Rhizosphere	MGEPGDDPDKTPFLPILLYVLGFMGALALAALAVGWLLRHL*
Ga0070707_1019239411	3300005468	Corn, Switchgrass And Miscanthus Rhizosphere	MNDEPEEDSEKTRFLPILAYVLGFMAALALLALAAGWLLRHL*
Ga0070672_1000527513	3300005543	Miscanthus Rhizosphere	MDEPPGDDPGRTPFLAILLYVLGFMFALALLALAAGWILKHLA*
Ga0070696_1020005122	3300005546	Corn, Switchgrass And Miscanthus Rhizosphere	MTGTDPPEDNPRNTPFLSILLYVMGFMGGLALLAYAVAWLLRHR*
Ga0068859_1001305202	3300005617	Switchgrass Rhizosphere	MGEEPEDDLRRTPFLAILLYVLGFMLALAVLALAAGWLLKRLA*
Ga0068864_1007220162	3300005618	Switchgrass Rhizosphere	MDDRGDDPRNTPFLAILAYVLGFMGALALLAWVLARLMRH*
Ga0066903_1019336262	3300005764	Tropical Forest Soil	MTEPGDDPRRTPFLAILLYVLGFMLALAVLALAAGWLLKHLA*
Ga0066903_1035606832	3300005764	Tropical Forest Soil	MPDDPRQTPFLSILLYVLGFMGALALLALAGAWLLRHL*
Ga0066903_1049926572	3300005764	Tropical Forest Soil	MSDDPRQTPFLSILLYVLGFMGALALLALAGAWVLHHLR*
Ga0068863_1004173032	3300005841	Switchgrass Rhizosphere	MDDRGNDPRNTPFLAILAYVLGFMGALGLLAWLLARLMRH*
Ga0068863_1004855111	3300005841	Switchgrass Rhizosphere	MDDRGDDPRNTPFLAILAYVLGFMGALALLAWVLARLMRP*
Ga0081455_100072814	3300005937	Tabebuia Heterophylla Rhizosphere	MDEDRKKPGGPDEESPPRFLPILLYVLGFMLALALLAAAAAWLLRRLG*
Ga0066795_100382882	3300005938	Soil	LGGQAEDPQKTPFLSILLYVMGFMGGLALLAWAVAWLLR*
Ga0075024_1001027293	3300006047	Watersheds	MSADPEDDPRNTPFLAILAYVLGFMGALALAAWIIARLLRRG*
Ga0097621_1005785411	3300006237	Miscanthus Rhizosphere	RGSMDDPGQDPNANRFLPILLYVLGFMFALALAALVAGWLMRHL*
Ga0068871_1014111882	3300006358	Miscanthus Rhizosphere	MSNEPPGDDPGRTPFLAILLYVLGFMFALALLALAAGWILKHIA*
Ga0074054_114725361	3300006579	Soil	MGEPGEDPRESRFVPILLYVLGFMAALALAALAAGWLLRHR*
Ga0075428_1008596442	3300006844	Populus Rhizosphere	MDEDPGDRDEQDSARFLPILLYVLGFMVALALLAAAAAWLLKRFA*
Ga0075425_1003981452	3300006854	Populus Rhizosphere	MDDPRQTRFLSILVYVLGFMGALALLALAGAWLLRHLS*
Ga0075424_1024616941	3300006904	Populus Rhizosphere	GEPPGDDPGRTPFLAILLYVLGFMFALALLALAAGWILKHLA*
Ga0097620_1012105862	3300006931	Switchgrass Rhizosphere	HPWMSDEPPGDDPGRTPFLAILLYVLGFMFALALLALAAGWILKHLA*
Ga0105095_100330044	3300009053	Freshwater Sediment	MDDGEGGDPRYARFLPILLYVLGFMAALALLALAAGWLLKRFG*
Ga0105098_103655252	3300009081	Freshwater Sediment	MDEDPDDPRSARFLPILLYVLGFMLALALLAAAAAWLLKRLG*
Ga0105082_10744221	3300009814	Groundwater Sand	MDEPEDDPRRARFLPILLYVLGFMLALALAALAAGWL
Ga0105070_10493521	3300009815	Groundwater Sand	MDEPEDDPRRARFLPILLYVLGFMLALALAALAAGWLLRRLA*
Ga0105058_11777402	3300009837	Groundwater Sand	MDEPEDDSRRTRFLPILLYVLGFMLALALAALAAGWLLRRLA*
Ga0134128_101665523	3300010373	Terrestrial Soil	MDDPEDDPNANRFLPILLYVLGFMFALALAALVAGWLLRHL*
Ga0105239_133065081	3300010375	Corn Rhizosphere	MDEPPDDDPRSTPFLAILLYVLGFMLALAVLALAAGWLLKRLA*
Ga0134124_118497073	3300010397	Terrestrial Soil	GASMDEPPGDDPGRTPFLAILLYVLGFMFALALLALAAGWILKHLA*
Ga0134127_110864862	3300010399	Terrestrial Soil	MDEDPGDPDEQDSARFLPILLYVLGFMVALALLAAAAAWLLKRF
Ga0134122_132413962	3300010400	Terrestrial Soil	MDDPQEDPNANRFLPILLYVLGFMLALALAALVAGWLLRHL*
Ga0134121_102188322	3300010401	Terrestrial Soil	MDDPQEDPNANRFLPILLYVLGFMLALALAALVAGWLMRHL*
Ga0126347_13025942	3300010867	Boreal Forest Soil	EDPRNTPFLAILLYVLGFMGALALLAWALARLLRHG*
Ga0137374_112643452	3300012204	Vadose Zone Soil	MRTPKEDPRQTPFLSIVLYIFGFMVALALLAWAGAWLMHHI*
Ga0150985_1101415342	3300012212	Avena Fatua Rhizosphere	MTDEPPGDDPGRTPFIAILLYVLGFMFALALLALAAGWVLK
Ga0137368_107520742	3300012358	Vadose Zone Soil	MDEPGEDPRDTPFLAILLYVLGFMGVLALAALLAAWLLRRL*
Ga0157299_100711122	3300012899	Soil	PGASMDEPPDDDPRSTPFLAILLYVLGFMLALAVLALAAGWLLKRLA*
Ga0164303_105157622	3300012957	Soil	EDPRRTSFLSLLLYVLGFMGGLALLAYGAAWLLRHH*
Ga0126369_124951692	3300012971	Tropical Forest Soil	MDERGEDPNENRFLPILLYVLGFMGALALAALLVGWLLRHL*
Ga0164309_103883392	3300012984	Soil	VSAPEEDPRNTPFLSILLYVIGFMVALGALAFVTAWLLRR*
Ga0164305_102077992	3300012989	Soil	VSAPEDDPRNTPFLSILLYVIGFMVALGALAFVTAWLLRR*
Ga0157373_106874222	3300013100	Corn Rhizosphere	MDDPENDPNTSRFLPILLYVLGFMFALALAALVAGWLLRHL*
Ga0157371_116462832	3300013102	Corn Rhizosphere	MSNEPPGDDPGRAPFLAILLYVLGFMFALALLALAAGWILKHLA*
Ga0163162_114220332	3300013306	Switchgrass Rhizosphere	MGEEPEDDPRRTPFLSILLYVLGFMLALAVLALAAGWLLK
Ga0075352_10252741	3300014324	Natural And Restored Wetlands	MSDKEGGDPRNTPFLSILLYVLGFMGAVALLAFAAAWLLKRF*
Ga0120104_10048651	3300014829	Permafrost	MDESEEGPRGTRFLPILLYVLGFMGALALLAVAAAWLLR
Ga0167631_10136932	3300015168	Glacier Forefield Soil	MGERGEKPRDARFLPLLLYVLGFMLALAVLALLAAWLLRRL*
Ga0167631_10363332	3300015168	Glacier Forefield Soil	MSAEPEEDPRNTPFLAILFYVLGFMGALALLAWALARLLRHG*
Ga0132258_103742922	3300015371	Arabidopsis Rhizosphere	MDDPGQDPNANRFLPILLYVLGFMFALALAALVAGWLMRHL*
Ga0132258_106255422	3300015371	Arabidopsis Rhizosphere	MDDPEDDDPRNARFLPILLYVLGFMGALALLALAAAWLLRRFG*
Ga0132256_1017711142	3300015372	Arabidopsis Rhizosphere	MNDEPPGDDPGRTPFLAILLYVLGFMFALALLALAAGWILKHIA*
Ga0132257_1000612962	3300015373	Arabidopsis Rhizosphere	VSAPEEDPRNTPFLSILLYVIGFMVALGVLAFVTAWLLRK*
Ga0132257_1041124602	3300015373	Arabidopsis Rhizosphere	GRTPFLAILLYVLGFMFALALLALAAGWILKHLA*
Ga0132255_1052403802	3300015374	Arabidopsis Rhizosphere	MNDEPPGDDPGRTPFLAILLYVLGFMFALALLALAAGWILKHLA*
Ga0163161_106564492	3300017792	Switchgrass Rhizosphere	MDEDPGDPDEQDSARFLPILLYVLGFMVALALLAAAAAWLLKRFA
Ga0187777_112223982	3300017974	Tropical Peatland	VADESDREPRDARFLPILLYVLGFMGGLALLALAAAWLLRRL
Ga0184623_104406992	3300018056	Groundwater Sediment	MDEPGEDPREARFLPILLYVLGFMAALALLALAAGWLLRHL
Ga0187766_102458622	3300018058	Tropical Peatland	MSSDPRQTPFLSILLYVLGFMGALALLAFIGAWLLRHLG
Ga0184629_100031533	3300018084	Groundwater Sediment	MSDEPGDDDPRNTPFLAILLYVLGFMGALALAAWILARLLRRL
Ga0190265_111158332	3300018422	Soil	MIVHMPDEDPSKPPFLPILGYVLGFMLLLALLAFATAALLHLD
Ga0066669_106379501	3300018482	Grasslands Soil	DGRRKTVDDDPRKTSFLSILLYVLGFMGGLALLAWAAAWLIRQH
Ga0210379_100534652	3300021081	Groundwater Sediment	MSDEPGDDDPRNTPFLAILLYVLRFMGALALAAWILARLLRRL
Ga0210384_100641913	3300021432	Soil	MGDDPRQTPFLSILLYVLGFMGALGLLALLGAWLLRRL
Ga0182009_100791632	3300021445	Soil	MDERPDDDDPTRTPFLAILLYVLGFMLALALLALAAGWLLKRLA
Ga0182009_108022031	3300021445	Soil	LTNEEEDPRNTRFASILFYVLGIMLALGALAFAAVRLLRR
Ga0210402_100029077	3300021478	Soil	MSADPEEDPRNTPFLAILLYVLGFMGALALLAWVLARLLRHA
Ga0210409_103538482	3300021559	Soil	MGEPGDDPRETRFLSTLLYVLGFMGALALAALAAAWLLRHF
Ga0207697_105287032	3300025315	Corn, Switchgrass And Miscanthus Rhizosphere	MSNEPPGDDPGRTPFLAILLYVLGFMFALALLALAAGW
Ga0209640_108093921	3300025324	Soil	MDEPEDDSRRTRFLPILLYVLGFMLALALLALAAGWLLRRLA
Ga0207642_105663672	3300025899	Miscanthus Rhizosphere	MDDPENDPNANRFLPILLYVLGFMFALALAALVAGWLLRHL
Ga0207642_108588851	3300025899	Miscanthus Rhizosphere	MDEDSGDRDEQDSARFLPILLYVLGFMVALALLAAAAAWLLKRFA
Ga0207680_100665142	3300025903	Switchgrass Rhizosphere	MSDEPPGDDPGRTPFLAILLYVLGFMFALALLALAAGWILKHLA
Ga0207685_102711752	3300025905	Corn, Switchgrass And Miscanthus Rhizosphere	MDDRGDDPRNTPFLAILAYVLGFMGALALLAWVLARLMRH
Ga0207684_113743932	3300025910	Corn, Switchgrass And Miscanthus Rhizosphere	MGEPGDDPDKTPFLPILLYVLGFMGALALAALAVGWLLRHL
Ga0207649_105298482	3300025920	Corn Rhizosphere	MSDEPPGDDPGRTPFLAILLYVLGFMFALALLALAAGWILKHIA
Ga0207650_100416013	3300025925	Switchgrass Rhizosphere	MSNEPPGDDPGRTPFLAILLYVLGFMFALALLALAAGWILKHLA
Ga0207644_101664193	3300025931	Switchgrass Rhizosphere	MDDEPPGDDPGRTPFLAILLYVLGFMFALALLALAAGWVLKH
Ga0207644_105752771	3300025931	Switchgrass Rhizosphere	MDDEPPGDDPGRTPFLAILLYVLGFMFALALLALAAGWILKHLA
Ga0207686_111697922	3300025934	Miscanthus Rhizosphere	DEDPGDPDEQDSARFLPILLYVLGFMVALALLAAAAAWLLKRFA
Ga0207704_101019563	3300025938	Miscanthus Rhizosphere	MDEPPGDDPGRTPFLAILLYVLGFMFALALLALAAGWILKHLA
Ga0207711_112147381	3300025941	Switchgrass Rhizosphere	MDEDPGDPDEQDSARFLPILLYVLGFMVALALLAAAAAWLLK
Ga0207689_102948913	3300025942	Miscanthus Rhizosphere	MDEPPDDDPRSTPFLAILLYVLGFMLALAVLALAAGWLLKRLA
Ga0207640_103059722	3300025981	Corn Rhizosphere	MDEDPGDRDEQDSARFLPILLYVLGFMVALALLAAAAAWLLKRFA
Ga0207640_121380852	3300025981	Corn Rhizosphere	DDPRSTPFLAILLYVLGFMLALAVLALAAGWLLKRLA
Ga0207641_100889993	3300026088	Switchgrass Rhizosphere	MDDRGDDPRNTPFLAILAYVLGFMGALALLAWVLARLMRP
Ga0207641_102961713	3300026088	Switchgrass Rhizosphere	MDDRGNDPRNTPFLAILAYVLGFMGALGLLAWLLARLMRH
Ga0207641_104645202	3300026088	Switchgrass Rhizosphere	MDDPDDDPRQARFLPILLYVLGFMGALALLAFAAAWLLRRFG
Ga0207676_107167621	3300026095	Switchgrass Rhizosphere	ARHPWMSDEPPGDDPGRTPFLAILLYVLGFMFALALLALAAGWILKHLA
Ga0207676_120316281	3300026095	Switchgrass Rhizosphere	MRDEPPGDDPGRTPFLAILLYVLGFMFALALLALAAGWILKHLA
Ga0209880_11070582	3300026271	Soil	LGGQAEDPQKTPFLSILLYVMGFMGGLALLAWAVAWLLR
Ga0209217_11027452	3300027651	Forest Soil	LTPPEEDPRRTSLASLLLYVLGFMGILAVLAFLAVWLLRR
Ga0209009_100021625	3300027667	Forest Soil	LGGQAEDPQKTRFLSILLYVMGFVGGLALLAWAVAWLLRHG
Ga0209011_10126432	3300027678	Forest Soil	LTPPEEDPRRTSLASLLLYVLGFMGILAVLAFLAVWWLRR
Ga0209819_100114073	3300027722	Freshwater Sediment	MDEDPDDPRSARFLPILLYVLGFMLALALLAAAAAWLLKRLG
Ga0209592_11079482	3300027731	Freshwater Sediment	MDDGEGGDPRYARFLPILLYVLGFMAALALLALAAGWLLKRFG
Ga0209382_104535532	3300027909	Populus Rhizosphere	MDEDPGDPDAQDSARFLPILLYVLGFMLALALLAAAAAWLLKRFA
Ga0209069_101151052	3300027915	Watersheds	MSADPEDDPRNTPFLAILAYVLGFMGALALAAWIIARLLRRG
Ga0247822_105891072	3300028592	Soil	MDDPGRAPGKTPFFPILLYVLGFMAILALAALAAAWLLRHL
Ga0247821_112097832	3300028596	Soil	SMDEDPGDPDEQDSARFLPILLYVLGFMVALALLAAAAAWLLKRFA
Ga0307504_100641062	3300028792	Soil	MDDPGEDPGENRFLPILFYVLGFMGALALLALAAAWLLRRL
Ga0247826_115831842	3300030336	Soil	MDDPGRAPGKTPFLPILLYVLGFMAILALAALAAAWLLRHL
Ga0307506_100549722	3300031366	Soil	MDDPGDDPRNTPFLAILAYVLGFMGALALLAWVLARLMRH
Ga0318560_103199292	3300031682	Soil	MDDPEDDPNATRFLPILLYVLGFMFALALAALAAGWVLKHL
Ga0307469_101784092	3300031720	Hardwood Forest Soil	MAETEPPEDNPRNTRFLSILLYVMGFMGGLALLAYAVAWLLRHR
Ga0307469_102625471	3300031720	Hardwood Forest Soil	MPDDPRQTRFLSILIYVLGFMGALALLALAGAWLLRHLS
Ga0307469_106135062	3300031720	Hardwood Forest Soil	MPDDPRQTPFLSMLLYVLGFMGALGLLALLGAWLLRRL
Ga0318566_103889412	3300031779	Soil	SMDDPEDDPNATRFLPILLYVLGFMFALALAALAAGWVLKHL
Ga0315290_103778952	3300031834	Sediment	MDDPGDDPRNTPFVAILAYVLGFMGALALLAWVLARLMRH
Ga0315905_111067532	3300032092	Freshwater	MGDPGEEPGSPRFLPILLYVLGFMGAVALLALAVAWLLRRFG
Ga0307471_1004036552	3300032180	Hardwood Forest Soil	MVETEPPEENPRNTPFLSILLYVMGFMGGLALLAYAVAWLLRHR
Ga0307471_1008945952	3300032180	Hardwood Forest Soil	MSDDPRQTRFLSILIYVLGFMGALALLALAAAWLLRHLS
Ga0307471_1017716301	3300032180	Hardwood Forest Soil	MGEPGDDPRETRFLSILLYVLGFMGALALAALAAAWLLRHF
Ga0307472_1004386822	3300032205	Hardwood Forest Soil	MAETEPPGDNPRNTPFLSILLYVMGFMGGLALLAYAVAWLLRHR
Ga0307472_1020283552	3300032205	Hardwood Forest Soil	LSDAPGGDPRNTPFLAILVYVLGFMLALALLAWLLARLLR
Ga0315287_126548041	3300032397	Sediment	MSVDPEDDPRNTPFLALLAYVLGFMGALALAAWIIARLLRRA
Ga0315273_100284895	3300032516	Sediment	VNDAPGDDDPRNTPFLSILLYVLGFMGALALLAWVLARLMRS
Ga0335082_102721622	3300032782	Soil	VRRETDPTRTRFVSALLYVLGFMTALALLAYAAAWLLHRH
Ga0316605_114491502	3300033408	Soil	MDDPEDDDPRYARFLPILLYVLGFMGALALLALAAGWLLRRFG
Ga0314866_089432_437_544	3300033807	Peatland	DPRRTSFLAILLYVLGFMGALALAAWILAALLRRG
Ga0370479_0108196_443_574	3300034123	Untreated Peat Soil	MDDPEDDDPRNARFLPILLYVLGFMAALALLALAAGWLLKRFA
Ga0364934_0139852_799_915	3300034178	Sediment	MSDEPGDDDPRNTPFLAILLYVLGFMGALALAAWILARL

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign