Basic Information | |
---|---|
Family ID | F053879 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 140 |
Average Sequence Length | 41 residues |
Representative Sequence | GKMAYATKINFDKKKNNIELENYSSEPVRLNNLTLEVKK |
Number of Associated Samples | 113 |
Number of Associated Scaffolds | 140 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 3.57 % |
% of genes near scaffold ends (potentially truncated) | 95.00 % |
% of genes from short scaffolds (< 2000 bps) | 90.00 % |
Associated GOLD sequencing projects | 107 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.39 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (63.571 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (12.857 % of family members) |
Environment Ontology (ENVO) | Unclassified (41.429 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (52.143 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 25.37% Coil/Unstructured: 74.63% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 140 Family Scaffolds |
---|---|---|
PF13590 | DUF4136 | 7.86 |
PF00375 | SDF | 4.29 |
PF01925 | TauE | 2.14 |
PF12704 | MacB_PCD | 2.14 |
PF03976 | PPK2 | 1.43 |
PF16912 | Glu_dehyd_C | 1.43 |
PF00497 | SBP_bac_3 | 1.43 |
PF14417 | MEDS | 1.43 |
PF07228 | SpoIIE | 1.43 |
PF08031 | BBE | 1.43 |
PF14023 | DUF4239 | 1.43 |
PF09865 | DUF2092 | 1.43 |
PF13505 | OMP_b-brl | 1.43 |
PF06283 | ThuA | 1.43 |
PF00072 | Response_reg | 0.71 |
PF13191 | AAA_16 | 0.71 |
PF02604 | PhdYeFM_antitox | 0.71 |
PF05193 | Peptidase_M16_C | 0.71 |
PF00196 | GerE | 0.71 |
PF03795 | YCII | 0.71 |
PF13426 | PAS_9 | 0.71 |
PF04338 | DUF481 | 0.71 |
PF01734 | Patatin | 0.71 |
PF03781 | FGE-sulfatase | 0.71 |
PF07796 | DUF1638 | 0.71 |
PF02900 | LigB | 0.71 |
PF00665 | rve | 0.71 |
PF13360 | PQQ_2 | 0.71 |
PF02368 | Big_2 | 0.71 |
PF02954 | HTH_8 | 0.71 |
PF13517 | FG-GAP_3 | 0.71 |
PF07969 | Amidohydro_3 | 0.71 |
PF00248 | Aldo_ket_red | 0.71 |
PF00076 | RRM_1 | 0.71 |
PF03219 | TLC | 0.71 |
PF01654 | Cyt_bd_oxida_I | 0.71 |
PF01965 | DJ-1_PfpI | 0.71 |
PF07638 | Sigma70_ECF | 0.71 |
PF02518 | HATPase_c | 0.71 |
PF14100 | DUF6807 | 0.71 |
PF08240 | ADH_N | 0.71 |
PF01103 | Omp85 | 0.71 |
PF13442 | Cytochrome_CBB3 | 0.71 |
PF13492 | GAF_3 | 0.71 |
PF12833 | HTH_18 | 0.71 |
COG ID | Name | Functional Category | % Frequency in 140 Family Scaffolds |
---|---|---|---|
COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 2.14 |
COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 1.43 |
COG2326 | Polyphosphate kinase 2, PPK2 family | Energy production and conversion [C] | 1.43 |
COG4813 | Trehalose utilization protein | Carbohydrate transport and metabolism [G] | 1.43 |
COG1262 | Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domain | Posttranslational modification, protein turnover, chaperones [O] | 0.71 |
COG1271 | Cytochrome bd-type quinol oxidase, subunit 1 | Energy production and conversion [C] | 0.71 |
COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.71 |
COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 0.71 |
COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 0.71 |
COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.71 |
COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.71 |
COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.71 |
COG3137 | Putative salt-induced outer membrane protein YdiY | Cell wall/membrane/envelope biogenesis [M] | 0.71 |
COG3202 | ATP/ADP translocase | Energy production and conversion [C] | 0.71 |
COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.71 |
COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 0.71 |
COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 0.71 |
COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.71 |
COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 0.71 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 63.57 % |
Unclassified | root | N/A | 36.43 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2088090005|LWSO_GLQAYWI02IU2PI | Not Available | 525 | Open in IMG/M |
2140918013|NODE_2492_length_1017_cov_10.654867 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1049 | Open in IMG/M |
3300000955|JGI1027J12803_102435890 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
3300000956|JGI10216J12902_113396729 | Not Available | 669 | Open in IMG/M |
3300004081|Ga0063454_101660613 | Not Available | 554 | Open in IMG/M |
3300004114|Ga0062593_102009607 | Not Available | 642 | Open in IMG/M |
3300004114|Ga0062593_102754477 | Not Available | 560 | Open in IMG/M |
3300004156|Ga0062589_101163496 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
3300005093|Ga0062594_100724180 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
3300005330|Ga0070690_100322394 | All Organisms → cellular organisms → Bacteria | 1114 | Open in IMG/M |
3300005337|Ga0070682_102006186 | Not Available | 509 | Open in IMG/M |
3300005338|Ga0068868_101376041 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 658 | Open in IMG/M |
3300005345|Ga0070692_10941036 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
3300005345|Ga0070692_11107039 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 559 | Open in IMG/M |
3300005367|Ga0070667_100824242 | Not Available | 862 | Open in IMG/M |
3300005459|Ga0068867_100003584 | All Organisms → cellular organisms → Bacteria | 10921 | Open in IMG/M |
3300005543|Ga0070672_100272242 | All Organisms → cellular organisms → Bacteria | 1430 | Open in IMG/M |
3300005543|Ga0070672_100584016 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 972 | Open in IMG/M |
3300005546|Ga0070696_101147019 | Not Available | 655 | Open in IMG/M |
3300005718|Ga0068866_10098875 | All Organisms → cellular organisms → Bacteria | 1606 | Open in IMG/M |
3300005719|Ga0068861_102310004 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
3300005764|Ga0066903_100025849 | All Organisms → cellular organisms → Bacteria | 6461 | Open in IMG/M |
3300005834|Ga0068851_10594152 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → Sorangium → Sorangium cellulosum | 673 | Open in IMG/M |
3300005843|Ga0068860_100779268 | Not Available | 969 | Open in IMG/M |
3300006046|Ga0066652_101097261 | Not Available | 754 | Open in IMG/M |
3300006844|Ga0075428_100006867 | All Organisms → cellular organisms → Bacteria | 12646 | Open in IMG/M |
3300006846|Ga0075430_100073521 | All Organisms → cellular organisms → Bacteria | 2866 | Open in IMG/M |
3300006880|Ga0075429_101749977 | Not Available | 539 | Open in IMG/M |
3300006881|Ga0068865_101849056 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis | 546 | Open in IMG/M |
3300007004|Ga0079218_10205553 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1507 | Open in IMG/M |
3300007004|Ga0079218_10684187 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 958 | Open in IMG/M |
3300009094|Ga0111539_11128367 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
3300009098|Ga0105245_12672958 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
3300009100|Ga0075418_13139037 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae | 503 | Open in IMG/M |
3300009157|Ga0105092_10234518 | Not Available | 1029 | Open in IMG/M |
3300009167|Ga0113563_11730927 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → Candidatus Yanofskybacteria | 742 | Open in IMG/M |
3300009176|Ga0105242_10966729 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 857 | Open in IMG/M |
3300009177|Ga0105248_11244174 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 842 | Open in IMG/M |
3300009177|Ga0105248_11461136 | Not Available | 774 | Open in IMG/M |
3300010037|Ga0126304_10402762 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 914 | Open in IMG/M |
3300010038|Ga0126315_10443147 | Not Available | 821 | Open in IMG/M |
3300010399|Ga0134127_12440725 | Not Available | 602 | Open in IMG/M |
3300010401|Ga0134121_10536847 | All Organisms → cellular organisms → Bacteria | 1084 | Open in IMG/M |
3300010403|Ga0134123_11593987 | Not Available | 700 | Open in IMG/M |
3300011119|Ga0105246_11043520 | Not Available | 743 | Open in IMG/M |
3300012021|Ga0120192_10093702 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
3300012212|Ga0150985_108937052 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis | 856 | Open in IMG/M |
3300012469|Ga0150984_115317228 | Not Available | 542 | Open in IMG/M |
3300012502|Ga0157347_1051488 | Not Available | 569 | Open in IMG/M |
3300012895|Ga0157309_10316463 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 532 | Open in IMG/M |
3300012958|Ga0164299_11616962 | Not Available | 511 | Open in IMG/M |
3300012960|Ga0164301_10169626 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1358 | Open in IMG/M |
3300012984|Ga0164309_11452316 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 586 | Open in IMG/M |
3300013308|Ga0157375_11023780 | Not Available | 965 | Open in IMG/M |
3300013308|Ga0157375_11780304 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → Sorangium → Sorangium cellulosum | 730 | Open in IMG/M |
3300014272|Ga0075327_1168897 | Not Available | 688 | Open in IMG/M |
3300014326|Ga0157380_10722404 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1004 | Open in IMG/M |
3300014326|Ga0157380_11633608 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
3300015200|Ga0173480_10005925 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4800 | Open in IMG/M |
3300015371|Ga0132258_10052349 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 9349 | Open in IMG/M |
3300015371|Ga0132258_13316246 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea | 1108 | Open in IMG/M |
3300015372|Ga0132256_100012352 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula | 7422 | Open in IMG/M |
3300015373|Ga0132257_100646282 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1310 | Open in IMG/M |
3300015373|Ga0132257_104343634 | Not Available | 516 | Open in IMG/M |
3300015374|Ga0132255_101953649 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea | 893 | Open in IMG/M |
3300016341|Ga0182035_11900400 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
3300018469|Ga0190270_11201764 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
3300018469|Ga0190270_11636194 | Not Available | 696 | Open in IMG/M |
3300018469|Ga0190270_12783581 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 552 | Open in IMG/M |
3300018476|Ga0190274_10047472 | All Organisms → cellular organisms → Bacteria | 3078 | Open in IMG/M |
3300018476|Ga0190274_13303103 | Not Available | 543 | Open in IMG/M |
3300018481|Ga0190271_13220181 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Ralstonia → Ralstonia pseudosolanacearum | 547 | Open in IMG/M |
3300020016|Ga0193696_1072048 | All Organisms → cellular organisms → Bacteria | 900 | Open in IMG/M |
3300022213|Ga0224500_10022473 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2691 | Open in IMG/M |
3300022756|Ga0222622_11206878 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 557 | Open in IMG/M |
3300022892|Ga0247753_1010231 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 958 | Open in IMG/M |
3300023169|Ga0247762_1228490 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Ralstonia → Ralstonia pseudosolanacearum | 526 | Open in IMG/M |
3300025903|Ga0207680_11190695 | Not Available | 543 | Open in IMG/M |
3300025920|Ga0207649_10662321 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 807 | Open in IMG/M |
3300025925|Ga0207650_10675855 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
3300025925|Ga0207650_10965135 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis | 725 | Open in IMG/M |
3300025926|Ga0207659_10664292 | Not Available | 891 | Open in IMG/M |
3300025926|Ga0207659_10718752 | Not Available | 856 | Open in IMG/M |
3300025926|Ga0207659_11645516 | Not Available | 547 | Open in IMG/M |
3300025932|Ga0207690_10636884 | Not Available | 873 | Open in IMG/M |
3300025937|Ga0207669_10848969 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 760 | Open in IMG/M |
3300025940|Ga0207691_10303648 | All Organisms → cellular organisms → Bacteria | 1371 | Open in IMG/M |
3300025942|Ga0207689_10320239 | All Organisms → cellular organisms → Bacteria | 1287 | Open in IMG/M |
3300025942|Ga0207689_10467298 | All Organisms → cellular organisms → Bacteria | 1055 | Open in IMG/M |
3300025960|Ga0207651_10358256 | Not Available | 1230 | Open in IMG/M |
3300025960|Ga0207651_11092671 | Not Available | 715 | Open in IMG/M |
3300025972|Ga0207668_10108261 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2080 | Open in IMG/M |
3300025986|Ga0207658_10188150 | All Organisms → cellular organisms → Bacteria | 1714 | Open in IMG/M |
3300025986|Ga0207658_10951571 | Not Available | 783 | Open in IMG/M |
3300026023|Ga0207677_10468878 | All Organisms → cellular organisms → Bacteria | 1082 | Open in IMG/M |
3300026035|Ga0207703_10499199 | All Organisms → cellular organisms → Bacteria | 1142 | Open in IMG/M |
3300026088|Ga0207641_11232609 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → Sorangium → Sorangium cellulosum | 748 | Open in IMG/M |
3300026088|Ga0207641_11707577 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
3300026089|Ga0207648_10010178 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis | 8943 | Open in IMG/M |
3300026089|Ga0207648_11694683 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
3300026089|Ga0207648_12195656 | Not Available | 513 | Open in IMG/M |
3300027675|Ga0209077_1091066 | Not Available | 843 | Open in IMG/M |
3300027909|Ga0209382_10066081 | All Organisms → cellular organisms → Bacteria | 4279 | Open in IMG/M |
3300027909|Ga0209382_10069754 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4155 | Open in IMG/M |
3300027909|Ga0209382_12141083 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
3300028380|Ga0268265_12170535 | Not Available | 562 | Open in IMG/M |
3300028381|Ga0268264_10817213 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
3300028782|Ga0307306_10085257 | Not Available | 827 | Open in IMG/M |
3300031170|Ga0307498_10470705 | Not Available | 508 | Open in IMG/M |
3300031226|Ga0307497_10292616 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 744 | Open in IMG/M |
3300031716|Ga0310813_10771326 | Not Available | 863 | Open in IMG/M |
3300031724|Ga0318500_10541841 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
3300031847|Ga0310907_10260691 | Not Available | 857 | Open in IMG/M |
3300031852|Ga0307410_10658861 | Not Available | 879 | Open in IMG/M |
3300031854|Ga0310904_10739678 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
3300031854|Ga0310904_10856467 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 639 | Open in IMG/M |
3300031908|Ga0310900_11757706 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
3300031912|Ga0306921_10553033 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp. TBR-22 | 1335 | Open in IMG/M |
3300031940|Ga0310901_10558421 | Not Available | 520 | Open in IMG/M |
3300031943|Ga0310885_10307694 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 821 | Open in IMG/M |
3300031944|Ga0310884_10556041 | Not Available | 680 | Open in IMG/M |
3300031944|Ga0310884_10774348 | Not Available | 585 | Open in IMG/M |
3300031995|Ga0307409_100700677 | Not Available | 1012 | Open in IMG/M |
3300032000|Ga0310903_10092541 | Not Available | 1270 | Open in IMG/M |
3300032013|Ga0310906_10411716 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 896 | Open in IMG/M |
3300032013|Ga0310906_11449536 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
3300032017|Ga0310899_10107979 | Not Available | 1134 | Open in IMG/M |
3300032043|Ga0318556_10626446 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
3300032075|Ga0310890_10057632 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2255 | Open in IMG/M |
3300032144|Ga0315910_10641463 | Not Available | 824 | Open in IMG/M |
3300032144|Ga0315910_11271249 | Not Available | 575 | Open in IMG/M |
3300032179|Ga0310889_10357325 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 717 | Open in IMG/M |
3300032256|Ga0315271_11266055 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
3300033418|Ga0316625_101788224 | Not Available | 596 | Open in IMG/M |
3300033482|Ga0316627_101778832 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 633 | Open in IMG/M |
3300033488|Ga0316621_10930373 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
3300033551|Ga0247830_10942507 | Not Available | 688 | Open in IMG/M |
3300034120|Ga0335056_0296469 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp. TBR-22 | 898 | Open in IMG/M |
3300034420|Ga0373918_0142929 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
3300034659|Ga0314780_185228 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 12.86% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 11.43% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 7.14% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 6.43% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.71% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 5.00% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 5.00% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 3.57% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.86% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.86% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.14% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.14% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.14% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.14% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.43% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.43% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.43% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.43% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.43% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.43% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.43% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.43% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.43% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.43% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Sediment | 0.71% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.71% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.71% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.71% |
Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.71% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.71% |
Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.71% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.71% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.71% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.71% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.71% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.71% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.71% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.71% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.71% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.71% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Arabidopsis Rhizosphere | 0.71% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.71% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.71% |
Sediment Slurry | Engineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry | 0.71% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2088090005 | Sediment microbial communities from Lake Washington, Seattle, for Methane and Nitrogen Cycles, original sample replicate 1 | Environmental | Open in IMG/M |
2140918013 | Soil microbial communities from Great Prairies - Iowa soil (MSU Assemblies) | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300012021 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T1 | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Host-Associated | Open in IMG/M |
3300012895 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S208-509C-2 | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014272 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailB_D1 | Environmental | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
3300020016 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1 | Environmental | Open in IMG/M |
3300022213 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_4_1 | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300022892 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S169-409R-5 | Environmental | Open in IMG/M |
3300023169 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L081-202R-4 | Environmental | Open in IMG/M |
3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027675 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 (SPAdes) | Environmental | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028782 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193 | Environmental | Open in IMG/M |
3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031940 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2 | Environmental | Open in IMG/M |
3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
3300032144 | Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil | Environmental | Open in IMG/M |
3300032179 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2 | Environmental | Open in IMG/M |
3300032256 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top | Environmental | Open in IMG/M |
3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
3300033488 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D1_C | Environmental | Open in IMG/M |
3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
3300034120 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172 | Environmental | Open in IMG/M |
3300034420 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - A1A4.1 | Engineered | Open in IMG/M |
3300034659 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
LWSO_04183240 | 2088090005 | Freshwater Sediment | EMRFGADGKGEGRMAYMTQINFSKKTNTVELENYSSEAVRLNELRLEVRK |
Iowa-Corn-GraphCirc_02648000 | 2140918013 | Soil | DKAGNGEGKMAYGTQILFDKKKNNIVLENYSSEPVRLNQLKLEVRK |
JGI1027J12803_1024358902 | 3300000955 | Soil | KMSVATKISLSKDKQQLELENYGSEPVRLNNIHKIK* |
JGI10216J12902_1133967291 | 3300000956 | Soil | YATQITFDKKTNSIELENYSSEPVRLNNLELEVKK* |
Ga0063454_1016606131 | 3300004081 | Soil | KGVGKMAVATKIDYDKKKKQLVLENYSSEPVRLNEVKIEK* |
Ga0062593_1020096072 | 3300004114 | Soil | KGEGRMAYAARINFDKKKNNIELENYSSEPVRLNLLVLEVKK* |
Ga0062593_1027544771 | 3300004114 | Soil | LEGEGKLAYYTKIRFDKDKNTMELENYSSEPVRLQNLKAKVKS* |
Ga0062589_1011634962 | 3300004156 | Soil | KGQGKMAYATKIRFDKNNNNVELENFTSEPVRLNNLRLEVKK* |
Ga0062594_1007241803 | 3300005093 | Soil | NSAGKGEGRMAYATQINFDKKKNTIELENYSSEPVRLNNLELEVRKK* |
Ga0070690_1003223942 | 3300005330 | Switchgrass Rhizosphere | DAEGKGQGKMAYATKITFDKNKNNVELENFTSEPVRLNNLRLEVRK* |
Ga0070682_1020061862 | 3300005337 | Corn Rhizosphere | GKGVGKMAVATKIEFDKKKKQLVLENYSSEPVRLNEVKIEK* |
Ga0068868_1013760411 | 3300005338 | Miscanthus Rhizosphere | FDSQGKGQGKMAYATKIAFDKEKNNVELENYSSEPVRLNNLSLEVKK* |
Ga0070692_109410362 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | FDAEGKGQGKMAYATKITFDKNKNNVELENFTSEPVRLNNLRLEVRK* |
Ga0070692_111070391 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | GKCAVATKIDFNKEKKVVEIENYGSEPVRLNEVKVKVKS* |
Ga0070667_1008242423 | 3300005367 | Switchgrass Rhizosphere | LTGEGRMLWFTQIQMDKKKGLIELENYSSEPVRLNNLKLEQVK* |
Ga0068867_1000035848 | 3300005459 | Miscanthus Rhizosphere | FDSQGKGQGKMAYATKIAFDKKKNNVELENYSSEPVRLNNLSLEVKK* |
Ga0070672_1002722421 | 3300005543 | Miscanthus Rhizosphere | GKGEGKMAVATKIKFDKEKKVIELENYATEPVRLNNLTAKVKS* |
Ga0070672_1005840162 | 3300005543 | Miscanthus Rhizosphere | KMAYATRISFDKKKNQIELENYSSEPVRLNNLVLEVRK* |
Ga0070696_1011470191 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | DKDGKGQGKMAVATKIDFDKDKKVVQIENYGSEPVRLNEVKVKVKS* |
Ga0068866_100988751 | 3300005718 | Miscanthus Rhizosphere | GEGKASVATKISFDKDKNQVELENYSSEPVRLNNVKVEK* |
Ga0068861_1023100042 | 3300005719 | Switchgrass Rhizosphere | GRMAYGARIDFDKKKNQIALENYSSEPVRLNNLKLEVKK* |
Ga0066903_1000258491 | 3300005764 | Tropical Forest Soil | GKMAYATKITFDKKKKTVELENYSSEPVRLTTVKSEKG* |
Ga0068851_105941522 | 3300005834 | Corn Rhizosphere | GEGKMAVATKIDFDKKNKQIELENYGSEPVRLNNLQVKVKS* |
Ga0068860_1007792681 | 3300005843 | Switchgrass Rhizosphere | KDNTGEGKISVATKITLNKKDNTVELENYQSEPVRLNNIRVVK* |
Ga0066652_1010972611 | 3300006046 | Soil | MAYATQIKFDKKNNSIELENYSSEPVRLNNLELEVRN* |
Ga0075428_10000686713 | 3300006844 | Populus Rhizosphere | MAYATQINFDKKKNSIELENYSSEPVRLNELKLEVKK* |
Ga0075430_1000735215 | 3300006846 | Populus Rhizosphere | EGRMAYATQINFDKKKNSIELENYSSEPVRLNELKLEVKK* |
Ga0075429_1017499771 | 3300006880 | Populus Rhizosphere | AYETQINFDKKKNTVELENYSSEPVRLNNLELEVRKK* |
Ga0068865_1018490561 | 3300006881 | Miscanthus Rhizosphere | MHFDKDGKGEGRMSWFTQINFDKKKQVIEIENYSSEPVRLNNLKLEDVK* |
Ga0079218_102055531 | 3300007004 | Agricultural Soil | DRSGKGEGKMAYATQIAFDKKKNSIELENYSSEPVRLNNLTLEVRK* |
Ga0079218_106841873 | 3300007004 | Agricultural Soil | LFEMRFDKSGKGEVKMAYATQILFDKKTNSIELENYASEPVRLNNLVLEVKK* |
Ga0111539_111283672 | 3300009094 | Populus Rhizosphere | MDVTGVGKGAVATKIVFNKKKNVVELENYSSEPVRLNEVKIQK* |
Ga0105245_126729581 | 3300009098 | Miscanthus Rhizosphere | AGKGEGRMSYALQINFDKKKNNIELENYSSEPVRLNNLVLETKK* |
Ga0075418_131390371 | 3300009100 | Populus Rhizosphere | GKMAVATKISFDKKKNTMELENYSSEPVRLNNLTVKVVK* |
Ga0105092_102345182 | 3300009157 | Freshwater Sediment | MAVATKILFDAKKKVIEIENYSSEPVRLNQLKLEVVK* |
Ga0113563_117309272 | 3300009167 | Freshwater Wetlands | YATKINFDRDKKVMEIENYSSEPVRLNNLKVKVKS* |
Ga0105242_109667292 | 3300009176 | Miscanthus Rhizosphere | SGKGEGRMAYATQINFDKKKNAIELENYSSEPVRLNNIKVEK* |
Ga0105248_112441742 | 3300009177 | Switchgrass Rhizosphere | EGKLAYATQINFDKKKNAIELENYSSEPVRLNNLVLEVKKK* |
Ga0105248_114611361 | 3300009177 | Switchgrass Rhizosphere | KLAYATQITFDKKKNTIELENYSSERVRLNNLVLEVKK* |
Ga0126304_104027621 | 3300010037 | Serpentine Soil | EGKMAVATKISFDKTKKQIELENYSSEPVRLNNLTMKVKS* |
Ga0126315_104431471 | 3300010038 | Serpentine Soil | GKLAYATKIRFDKDKKVLEIENYSSEPVRLNNVKVKART* |
Ga0134127_124407251 | 3300010399 | Terrestrial Soil | MAVATKIDFDKKKKQLVLENYSSEPVRLNEVKIEK* |
Ga0134121_105368473 | 3300010401 | Terrestrial Soil | GKMAYATQINFDKKKNAIELENYSSEPVRLNNLVLEVKKK* |
Ga0134123_115939872 | 3300010403 | Terrestrial Soil | GKDGKGVGKMAVATKIEFDKKKKQLVLENYSSEPVRLNEVKLEK* |
Ga0105246_110435202 | 3300011119 | Miscanthus Rhizosphere | TGEGRMLWFTQIQMDKKKGIIELENYSSEAVRLNNLKLEQVK* |
Ga0120192_100937021 | 3300012021 | Terrestrial | MAVATKISFDKKKKQIELENYSSEPVRLNEVKVKVKT* |
Ga0150985_1089370522 | 3300012212 | Avena Fatua Rhizosphere | MEMHFDKDGKGEGRMSWFTQINFDKKKEAIEIENYSSEPVRLNNLKLEQVK* |
Ga0150984_1153172281 | 3300012469 | Avena Fatua Rhizosphere | KGEGKMAYATKIMFDKKTNSIELENYSSEPVRLNNLVLEAKK* |
Ga0157347_10514881 | 3300012502 | Arabidopsis Rhizosphere | GKGVGKMAVATKIEFDKKKRQLVLENYSSEPVRLNEVKIEK* |
Ga0157309_103164631 | 3300012895 | Soil | VDQPRANGEGEGKLAYYTKIRFDKEKKVMEIENYSSEPVRLNNLKVKVKS* |
Ga0164299_116169622 | 3300012958 | Soil | GKGEGKLAYATKIRFDKEKKVLELENYSSEPVRLQNVEVKPRT* |
Ga0164301_101696262 | 3300012960 | Soil | AYATQISFDKKKNSIELENYSSEPVRLNELRLEVKN* |
Ga0164309_114523162 | 3300012984 | Soil | GKMAVATKIDFNKEKKVVEIENYGSEPVRLNEVKVKVKS* |
Ga0157375_110237801 | 3300013308 | Miscanthus Rhizosphere | EMHFDKSGKGEGKMAYATQISFDKKKNQIELENYSSEPVRLNELKLEVKN* |
Ga0157375_117803041 | 3300013308 | Miscanthus Rhizosphere | KMAVATKIDFDKKNKQIELENYGSEPVRLNNLQVKVKS* |
Ga0075327_11688972 | 3300014272 | Natural And Restored Wetlands | GKMAVATKIEFDRKNQQMVLENFASEPVRLNEIRIRK* |
Ga0157380_107224041 | 3300014326 | Switchgrass Rhizosphere | GKMAYATKIAFDKKKNNVELENYSSEPVRLNNLSLEVKK* |
Ga0157380_116336081 | 3300014326 | Switchgrass Rhizosphere | AAVATKIVFNKKKNIVELENYSSEPVRLNNIKVDK* |
Ga0173480_100059255 | 3300015200 | Soil | DGAGNGQGKLAYGTKIMFDKKKNNVEIENYGTEPVRLNNLKLEVKK* |
Ga0132258_100523498 | 3300015371 | Arabidopsis Rhizosphere | KMAYATKIAFDKKKNNVELENYSSEPVRLNNLSLEVKK* |
Ga0132258_133162463 | 3300015371 | Arabidopsis Rhizosphere | FTQISFDKAKKSIELEYYSSEPVRLNNLKIENRK* |
Ga0132256_1000123521 | 3300015372 | Arabidopsis Rhizosphere | GKMAVATKIEFDKKKKQLVLENYSSEPVRLNEVKIEK* |
Ga0132257_1006462821 | 3300015373 | Arabidopsis Rhizosphere | MAYATQISFDKKKNSIELENYSSEPVRLNELRLEVKN* |
Ga0132257_1043436341 | 3300015373 | Arabidopsis Rhizosphere | GRMAYAARINFDKKKNNIELENYSSEPVRLNLLVLEVKK* |
Ga0132255_1019536491 | 3300015374 | Arabidopsis Rhizosphere | EGKMAWFTQISFDKAKKSIELEYYSSEPVRLNNLKIENRK* |
Ga0182035_119004001 | 3300016341 | Soil | GKMAYATKINFDKKKNNIELENYSSEPVRLNNLTLEVKK |
Ga0190270_112017641 | 3300018469 | Soil | KMAVATKIEFDKKKKQMVLENYASEPVRLNEIKIEK |
Ga0190270_116361942 | 3300018469 | Soil | DKSGKGEGRMAVMTQIMFDKKKQTIELENYSSEPVRLNNLTLEVKK |
Ga0190270_127835811 | 3300018469 | Soil | KGEGKLAYATQINFDKKTNSIELENYSTEPVRLNNLELEVRK |
Ga0190274_100474723 | 3300018476 | Soil | VFEMRFDGAGNGQGKLAYGTKIMFDKKKNNVEIENYGTEPVRLNNLKLEVKK |
Ga0190274_133031033 | 3300018476 | Soil | QMQFNKEGKGEGRMAYATQITFDKKTNSIELENYSSEPVRLNNLELEVKK |
Ga0190271_132201812 | 3300018481 | Soil | AYGTKIMFDKKKNNVEIENYGTEPVRLNNLKLEVRK |
Ga0193696_10720481 | 3300020016 | Soil | KDGTGEGRMLWFTQIQMDKKKGIIELENYSSEAVRLNNLKLENVK |
Ga0224500_100224733 | 3300022213 | Sediment | GKMAYATQIAFDKKKNTIELENYSSEPVRLNELKLEVRK |
Ga0222622_112068781 | 3300022756 | Groundwater Sediment | GQGKMAVATKISFDKKKNAIELENYSSEPVRLNNVKVKVKT |
Ga0247753_10102312 | 3300022892 | Soil | MAVATKIDFDKDKKVVQIENYGSEPVRLNEVKVKVKS |
Ga0247762_12284901 | 3300023169 | Plant Litter | PFSVFEMRFDGAGNGQGKLAYGTKIMFDKKKNNVEIENYGTEPVRLNNLKLEVKK |
Ga0207680_111906951 | 3300025903 | Switchgrass Rhizosphere | GRMSWFTQIDFDKKKQVIEIENYSSEPVRLNNLKLEDVK |
Ga0207649_106623212 | 3300025920 | Corn Rhizosphere | VNKDGEGEGKLAYATKIHFDKEKKIVEIENYSSEPVRLQNVKVKVKS |
Ga0207650_106758552 | 3300025925 | Switchgrass Rhizosphere | KDLTGEGRMLWFTQIQMDKKKGIIELENYSSEPVRLNNLKLENVK |
Ga0207650_109651352 | 3300025925 | Switchgrass Rhizosphere | KGEGRMSWFTQIDFDKKKQVIEIENYSSEPVRLNNLKLEDVK |
Ga0207659_106642923 | 3300025926 | Miscanthus Rhizosphere | KAGKGEGRLAYATQISFDKKKNSIEIENYSSEPVRLNELKLESKK |
Ga0207659_107187521 | 3300025926 | Miscanthus Rhizosphere | TGVGKAAVATQIIYNKKKNVVELENYSSEPVRLNNLKIEK |
Ga0207659_116455161 | 3300025926 | Miscanthus Rhizosphere | GKGEGKMAYATQISFDKKKNSIELENYSSEPVRLNNLELEVKK |
Ga0207690_106368841 | 3300025932 | Corn Rhizosphere | MAVATKISFDKEKKVMELENYSSEPVRLNNLTVKVKS |
Ga0207669_108489692 | 3300025937 | Miscanthus Rhizosphere | GQGKMAYATKIAFDKKKNNVELENYSSEPVRLNNLSLEVKK |
Ga0207691_103036481 | 3300025940 | Miscanthus Rhizosphere | AGKGQGKMAYATRISFDKKKNQIELENYSSEPVRLNNLVLEVRK |
Ga0207689_103202391 | 3300025942 | Miscanthus Rhizosphere | GEGKMAVATKIDFDKKNKQIELENYGSEPVRLNNLQVKVKS |
Ga0207689_104672981 | 3300025942 | Miscanthus Rhizosphere | YGTRIVFDKKKNNIELENYGSEPVRLNNLKLEVKN |
Ga0207651_103582562 | 3300025960 | Switchgrass Rhizosphere | GKMSYATKITFDKKKNNVELENYASEPVRLNNLTLEVKK |
Ga0207651_110926712 | 3300025960 | Switchgrass Rhizosphere | SGKGEGRMAYATQISFDKKKNSIELENYSSEPVRLNELKLEVKK |
Ga0207668_101082613 | 3300025972 | Switchgrass Rhizosphere | YATQILFDKKKNQIELENYSSEPVRLNNLELEVKKK |
Ga0207658_101881501 | 3300025986 | Switchgrass Rhizosphere | DSQGKGQGKMAYATKIAFDKKKNNVELENYSSEPVRLNNVKVEK |
Ga0207658_109515711 | 3300025986 | Switchgrass Rhizosphere | LWFTQIQMDKKKGIIELENYSSEAVRLNNLKLEQVK |
Ga0207677_104688783 | 3300026023 | Miscanthus Rhizosphere | RMSYALQINFDKKKNNIELENYSSEPVRLNNLELESRK |
Ga0207703_104991993 | 3300026035 | Switchgrass Rhizosphere | KCAVATKIDFNKEKKVVEIENYGSEPVRLNEVKVKVKS |
Ga0207641_112326092 | 3300026088 | Switchgrass Rhizosphere | MAVATKIDFDKKNKQIELENYGSEPVRLNNLQVKVKS |
Ga0207641_117075772 | 3300026088 | Switchgrass Rhizosphere | MAVATKISLNKDKQQLELENYGSEPVRLNNIHKIK |
Ga0207648_100101781 | 3300026089 | Miscanthus Rhizosphere | AYATKIAFDKKKNNVELENYSSEPVRLNNLSLEVKK |
Ga0207648_116946832 | 3300026089 | Miscanthus Rhizosphere | GRMLWFTQIQMDKKKGIIELENYSSEAVRLNNLKLENVK |
Ga0207648_121956562 | 3300026089 | Miscanthus Rhizosphere | SYATKITFGKKKNNVELENYASEPVRLNNLTLEVKK |
Ga0209077_10910661 | 3300027675 | Freshwater Sediment | DKSGKGEGRMAYATQITFNKKKNAIELEYYSSEPVRLNNLKLEVVK |
Ga0209382_100660816 | 3300027909 | Populus Rhizosphere | DGKGEGRMAYATQIMFDKKKNTIELENYSSEPVRLNNLELEVRKK |
Ga0209382_100697541 | 3300027909 | Populus Rhizosphere | PFTIFEMRFDKSGKGEGKVAWGTQIRFDKKNNNIELENYSTEPVRLNNLVLSVKK |
Ga0209382_121410832 | 3300027909 | Populus Rhizosphere | GKMAYATQIKFDKKTNSIELENYSTEPVRLNNLELEVKK |
Ga0268265_121705352 | 3300028380 | Switchgrass Rhizosphere | RIKKDGTGVGKAAVATQIIYNKKKNVVELENYSSEPVRLNNIKIEK |
Ga0268264_108172131 | 3300028381 | Switchgrass Rhizosphere | MSYALQINFDKKKNNIELENYSSEPVRLNNLVLETKK |
Ga0307306_100852572 | 3300028782 | Soil | QFDKSGKGEGRMAYGTKIEFDKKKQVIDLENYSSEPVRLNQLQLKTK |
Ga0307498_104707052 | 3300031170 | Soil | LEMHFDKAGKGEGRMAVYTQLNFNDKKKALEIENWGSEPVRLNQLTLEVKK |
Ga0307497_102926162 | 3300031226 | Soil | EGKLAYATQITFDKKKNTIELENYSSERVRLNNLVLEVKK |
Ga0310813_107713262 | 3300031716 | Soil | RGKMAYATKIRFDKNKNNVELENFSSEPVRLNNLRLEVRK |
Ga0318500_105418412 | 3300031724 | Soil | GRMAYGTQIRFDQRNNNIVLEHYASEPVRLNQLTLEVRK |
Ga0310907_102606911 | 3300031847 | Soil | EGKMAVATKISFDKKKNAIELENYSSEPVRLNNVKVKVKT |
Ga0307410_106588613 | 3300031852 | Rhizosphere | SGKGVGKMAVATKIDFDKKKRQMVLENYASEPVRLNEVKIEK |
Ga0310904_107396782 | 3300031854 | Soil | MAVGTMISFDKKKNTVELENYASEPVRLNSLKVRTAK |
Ga0310904_108564672 | 3300031854 | Soil | HFGPDGKGEGRLAYATQISFDKKKNSIEIENYSSEPVRLNELKLEQKK |
Ga0310900_117577061 | 3300031908 | Soil | EGKGQGKMAYATKITFDKNKNNVELENFTSEPVRLNNLRLEVRK |
Ga0306921_105530331 | 3300031912 | Soil | EIRIKTNGEGEGKMALATKIAYNKKKNAIELENYSTEPVRLQNVRVEATK |
Ga0310901_105584211 | 3300031940 | Soil | GKGEGRMAYATQISFDKKKNSIELENYSSEPVRLNELKLEVKK |
Ga0310885_103076941 | 3300031943 | Soil | VATKISFDKEKKQIELENYASEPVRLNNLTVKVKS |
Ga0310884_105560412 | 3300031944 | Soil | AAVATKIIFNKKKNVVELENYSSEPVRLNNIKIEK |
Ga0310884_107743482 | 3300031944 | Soil | DKSGKGEGRMAYATQINFDKKKNSIELENYSSEPVRLNELKLEVKK |
Ga0307409_1007006773 | 3300031995 | Rhizosphere | KMAVATKIDFDKKKRQMVLENYASEPVRLNEVKIEK |
Ga0310903_100925411 | 3300032000 | Soil | FQMHFNKAGKGEGKMAYATQISFDKKKNSIELENYSSEPVRLNELKLEVKK |
Ga0310906_104117161 | 3300032013 | Soil | EGRMAYATQISFDKKKQAIELENYSSEPVRLNQLVLEVKK |
Ga0310906_114495362 | 3300032013 | Soil | EGKMAVATKIDFNKSKNTVELENYSSEPVRLQNLKIKAG |
Ga0310899_101079792 | 3300032017 | Soil | MAYATQIKFDKKNNSIELENYSSEPVRLNNLELEVRN |
Ga0318556_106264462 | 3300032043 | Soil | KMAYATKITFDKKKNTVELENYSSEPVRLNTVKVEKG |
Ga0310890_100576323 | 3300032075 | Soil | GVGKAAVATKIIFNKKKNVVELENYSSEPVRLNNIKIEK |
Ga0315910_106414631 | 3300032144 | Soil | KGVGKLGYATQISLDKKKNSIELENYSSEPVRLNNLVLEVKRK |
Ga0315910_112712492 | 3300032144 | Soil | EGEGRMAYATQITFDKKKNTVELENYSSEPVRLNQLKLEPKK |
Ga0310889_103573251 | 3300032179 | Soil | QGKCAVATKIDFNKEKKVVEIENYGSEPVRLNEVKVKVKS |
Ga0315271_112660551 | 3300032256 | Sediment | MAYATQISFDKKKNAIELENYASEPVRLNNLVLEKGK |
Ga0316625_1017882242 | 3300033418 | Soil | NEGEGEGKFAVATKIAFDKDAKKIELENWGSEPVRLNAVKVKVKK |
Ga0316627_1017788321 | 3300033482 | Soil | EMRFDKAGKGEGRMAYATQITFDKAKNAIELENYSSEPVRLNNLELQVRK |
Ga0316621_109303731 | 3300033488 | Soil | VAVATKITFDRKANQVELENYSSEPVRLNNVKVKV |
Ga0247830_109425072 | 3300033551 | Soil | SGKGVGKMAVATKIEFDKKKKQMVLENYASEPVRLNEIKIEK |
Ga0335056_0296469_16_129 | 3300034120 | Freshwater | MSVATKITFDKKDQRIELENWSSEPVRLNEVKVSPKK |
Ga0373918_0142929_11_124 | 3300034420 | Sediment Slurry | MAVATMIDYDKDKKQLILENYSSEPLRLSKVTVKEKK |
Ga0314780_185228_420_533 | 3300034659 | Soil | MAYATQIKFDKKSNSIELENYSSEPVRLNNLELEVRK |
⦗Top⦘ |