Basic Information | |
---|---|
Family ID | F053748 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 140 |
Average Sequence Length | 55 residues |
Representative Sequence | MRCCDQGAHIRERLTANRSDLTLQGGPNQHGTQKPRRTPRTNLSPPRLELQ |
Number of Associated Samples | 87 |
Number of Associated Scaffolds | 140 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 9.35 % |
% of genes near scaffold ends (potentially truncated) | 85.71 % |
% of genes from short scaffolds (< 2000 bps) | 97.14 % |
Associated GOLD sequencing projects | 86 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.27 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (62.857 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (82.143 % of family members) |
Environment Ontology (ENVO) | Unclassified (91.429 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (77.143 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 27.85% β-sheet: 0.00% Coil/Unstructured: 72.15% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.27 |
Powered by PDBe Molstar |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 62.86 % |
All Organisms | root | All Organisms | 37.14 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300005330|Ga0070690_101137203 | Not Available | 620 | Open in IMG/M |
3300005347|Ga0070668_102262578 | Not Available | 502 | Open in IMG/M |
3300005355|Ga0070671_101870969 | Not Available | 534 | Open in IMG/M |
3300005841|Ga0068863_100891473 | Not Available | 889 | Open in IMG/M |
3300009101|Ga0105247_11816508 | Not Available | 507 | Open in IMG/M |
3300009553|Ga0105249_12814263 | Not Available | 558 | Open in IMG/M |
3300009553|Ga0105249_13002391 | Not Available | 542 | Open in IMG/M |
3300009980|Ga0105135_126923 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 530 | Open in IMG/M |
3300009981|Ga0105133_123795 | Not Available | 556 | Open in IMG/M |
3300009981|Ga0105133_129337 | Not Available | 518 | Open in IMG/M |
3300009992|Ga0105120_1038611 | Not Available | 585 | Open in IMG/M |
3300009992|Ga0105120_1041497 | Not Available | 569 | Open in IMG/M |
3300009994|Ga0105126_1024172 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii | 680 | Open in IMG/M |
3300010396|Ga0134126_11399972 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 773 | Open in IMG/M |
3300014326|Ga0157380_12955651 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 541 | Open in IMG/M |
3300015270|Ga0182183_1050661 | Not Available | 616 | Open in IMG/M |
3300015270|Ga0182183_1094707 | Not Available | 504 | Open in IMG/M |
3300015273|Ga0182102_1003194 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 992 | Open in IMG/M |
3300015278|Ga0182099_1016833 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 753 | Open in IMG/M |
3300015278|Ga0182099_1055827 | Not Available | 546 | Open in IMG/M |
3300015280|Ga0182100_1047733 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 649 | Open in IMG/M |
3300015280|Ga0182100_1077587 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 550 | Open in IMG/M |
3300015290|Ga0182105_1011378 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 1026 | Open in IMG/M |
3300015290|Ga0182105_1053605 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 644 | Open in IMG/M |
3300015290|Ga0182105_1070629 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 586 | Open in IMG/M |
3300015293|Ga0182103_1007395 | Not Available | 1097 | Open in IMG/M |
3300015293|Ga0182103_1027703 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 762 | Open in IMG/M |
3300015301|Ga0182184_1054509 | Not Available | 622 | Open in IMG/M |
3300015301|Ga0182184_1091609 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 521 | Open in IMG/M |
3300015306|Ga0182180_1078776 | Not Available | 538 | Open in IMG/M |
3300015309|Ga0182098_1025781 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii | 857 | Open in IMG/M |
3300015309|Ga0182098_1036336 | Not Available | 772 | Open in IMG/M |
3300015311|Ga0182182_1011960 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 1073 | Open in IMG/M |
3300015311|Ga0182182_1030462 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 809 | Open in IMG/M |
3300015311|Ga0182182_1109969 | Not Available | 523 | Open in IMG/M |
3300015312|Ga0182168_1041279 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii | 783 | Open in IMG/M |
3300015312|Ga0182168_1089527 | Not Available | 595 | Open in IMG/M |
3300015312|Ga0182168_1102357 | Not Available | 565 | Open in IMG/M |
3300015313|Ga0182164_1053382 | Not Available | 716 | Open in IMG/M |
3300015315|Ga0182120_1061913 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii | 685 | Open in IMG/M |
3300015315|Ga0182120_1098443 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 577 | Open in IMG/M |
3300015317|Ga0182136_1068290 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 663 | Open in IMG/M |
3300015317|Ga0182136_1097213 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii | 582 | Open in IMG/M |
3300015318|Ga0182181_1053642 | Not Available | 656 | Open in IMG/M |
3300015319|Ga0182130_1025650 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 891 | Open in IMG/M |
3300015319|Ga0182130_1046544 | Not Available | 739 | Open in IMG/M |
3300015319|Ga0182130_1129681 | Not Available | 514 | Open in IMG/M |
3300015320|Ga0182165_1028147 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 919 | Open in IMG/M |
3300015324|Ga0182134_1072212 | Not Available | 664 | Open in IMG/M |
3300015324|Ga0182134_1075744 | Not Available | 652 | Open in IMG/M |
3300015325|Ga0182148_1038413 | Not Available | 811 | Open in IMG/M |
3300015325|Ga0182148_1100974 | Not Available | 581 | Open in IMG/M |
3300015326|Ga0182166_1025486 | Not Available | 918 | Open in IMG/M |
3300015326|Ga0182166_1100451 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 580 | Open in IMG/M |
3300015326|Ga0182166_1128486 | Not Available | 528 | Open in IMG/M |
3300015329|Ga0182135_1108868 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 580 | Open in IMG/M |
3300015330|Ga0182152_1040529 | Not Available | 831 | Open in IMG/M |
3300015330|Ga0182152_1054211 | Not Available | 751 | Open in IMG/M |
3300015331|Ga0182131_1053785 | Not Available | 756 | Open in IMG/M |
3300015331|Ga0182131_1102500 | Not Available | 596 | Open in IMG/M |
3300015333|Ga0182147_1068148 | Not Available | 725 | Open in IMG/M |
3300015333|Ga0182147_1141072 | Not Available | 543 | Open in IMG/M |
3300015334|Ga0182132_1044831 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii | 845 | Open in IMG/M |
3300015334|Ga0182132_1074736 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 702 | Open in IMG/M |
3300015334|Ga0182132_1165356 | Not Available | 507 | Open in IMG/M |
3300015335|Ga0182116_1042108 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 898 | Open in IMG/M |
3300015336|Ga0182150_1087997 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 649 | Open in IMG/M |
3300015338|Ga0182137_1086480 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 686 | Open in IMG/M |
3300015339|Ga0182149_1172442 | Not Available | 504 | Open in IMG/M |
3300015340|Ga0182133_1100823 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii | 662 | Open in IMG/M |
3300015348|Ga0182115_1059891 | Not Available | 1136 | Open in IMG/M |
3300015348|Ga0182115_1205372 | Not Available | 631 | Open in IMG/M |
3300015348|Ga0182115_1257500 | Not Available | 555 | Open in IMG/M |
3300015348|Ga0182115_1273975 | Not Available | 535 | Open in IMG/M |
3300015349|Ga0182185_1105618 | Not Available | 812 | Open in IMG/M |
3300015349|Ga0182185_1279882 | Not Available | 509 | Open in IMG/M |
3300015350|Ga0182163_1064844 | Not Available | 1060 | Open in IMG/M |
3300015350|Ga0182163_1108954 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii | 845 | Open in IMG/M |
3300015350|Ga0182163_1175558 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii | 669 | Open in IMG/M |
3300015352|Ga0182169_1189856 | Not Available | 672 | Open in IMG/M |
3300015352|Ga0182169_1229319 | Not Available | 605 | Open in IMG/M |
3300015352|Ga0182169_1295457 | Not Available | 523 | Open in IMG/M |
3300015353|Ga0182179_1143221 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii | 741 | Open in IMG/M |
3300015354|Ga0182167_1120005 | Not Available | 967 | Open in IMG/M |
3300015354|Ga0182167_1303495 | Not Available | 566 | Open in IMG/M |
3300015354|Ga0182167_1342121 | Not Available | 524 | Open in IMG/M |
3300017408|Ga0182197_1107166 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 575 | Open in IMG/M |
3300017408|Ga0182197_1124110 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 543 | Open in IMG/M |
3300017408|Ga0182197_1142152 | Not Available | 515 | Open in IMG/M |
3300017412|Ga0182199_1111762 | Not Available | 638 | Open in IMG/M |
3300017412|Ga0182199_1115514 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii | 630 | Open in IMG/M |
3300017412|Ga0182199_1145510 | Not Available | 576 | Open in IMG/M |
3300017412|Ga0182199_1197326 | Not Available | 510 | Open in IMG/M |
3300017414|Ga0182195_1064625 | Not Available | 810 | Open in IMG/M |
3300017414|Ga0182195_1202591 | Not Available | 522 | Open in IMG/M |
3300017421|Ga0182213_1133164 | Not Available | 696 | Open in IMG/M |
3300017422|Ga0182201_1136537 | Not Available | 513 | Open in IMG/M |
3300017432|Ga0182196_1024314 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 939 | Open in IMG/M |
3300017432|Ga0182196_1102104 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 584 | Open in IMG/M |
3300017439|Ga0182200_1158709 | Not Available | 509 | Open in IMG/M |
3300017440|Ga0182214_1112352 | Not Available | 587 | Open in IMG/M |
3300017440|Ga0182214_1116973 | Not Available | 577 | Open in IMG/M |
3300017445|Ga0182198_1052394 | Not Available | 833 | Open in IMG/M |
3300017445|Ga0182198_1074935 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 735 | Open in IMG/M |
3300017445|Ga0182198_1118611 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii | 621 | Open in IMG/M |
3300017445|Ga0182198_1148526 | Not Available | 570 | Open in IMG/M |
3300017446|Ga0182217_1134189 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 582 | Open in IMG/M |
3300017447|Ga0182215_1162260 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 519 | Open in IMG/M |
3300017693|Ga0182216_1051021 | Not Available | 889 | Open in IMG/M |
3300025931|Ga0207644_10657510 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 873 | Open in IMG/M |
3300025986|Ga0207658_11855382 | Not Available | 550 | Open in IMG/M |
3300026095|Ga0207676_12023826 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 575 | Open in IMG/M |
3300028056|Ga0268330_1059317 | Not Available | 513 | Open in IMG/M |
3300028058|Ga0268332_1078345 | Not Available | 505 | Open in IMG/M |
3300028142|Ga0268347_1003699 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 972 | Open in IMG/M |
3300028470|Ga0268307_1016658 | Not Available | 571 | Open in IMG/M |
3300028473|Ga0268319_1002021 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 1057 | Open in IMG/M |
3300028523|Ga0268313_1007752 | Not Available | 664 | Open in IMG/M |
3300028529|Ga0268311_1029116 | Not Available | 507 | Open in IMG/M |
3300032464|Ga0214492_1004730 | Not Available | 2036 | Open in IMG/M |
3300032467|Ga0214488_1084702 | Not Available | 696 | Open in IMG/M |
3300032514|Ga0214502_1408615 | Not Available | 509 | Open in IMG/M |
3300032593|Ga0321338_1017970 | Not Available | 2012 | Open in IMG/M |
3300032593|Ga0321338_1195156 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 727 | Open in IMG/M |
3300032593|Ga0321338_1195390 | Not Available | 726 | Open in IMG/M |
3300032625|Ga0214501_1087952 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 987 | Open in IMG/M |
3300032689|Ga0214497_1115261 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 574 | Open in IMG/M |
3300032699|Ga0214494_1047780 | Not Available | 824 | Open in IMG/M |
3300032758|Ga0314746_1093281 | Not Available | 695 | Open in IMG/M |
3300032822|Ga0314740_1031393 | Not Available | 797 | Open in IMG/M |
3300032826|Ga0314732_128466 | Not Available | 536 | Open in IMG/M |
3300032844|Ga0314743_1119811 | Not Available | 595 | Open in IMG/M |
3300032845|Ga0314727_1001628 | Not Available | 2233 | Open in IMG/M |
3300032914|Ga0314750_1081829 | Not Available | 751 | Open in IMG/M |
3300032914|Ga0314750_1133115 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 579 | Open in IMG/M |
3300032915|Ga0314749_1126591 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 545 | Open in IMG/M |
3300032959|Ga0314738_1069706 | Not Available | 629 | Open in IMG/M |
3300033538|Ga0314755_1168540 | Not Available | 557 | Open in IMG/M |
3300033542|Ga0314769_1254137 | Not Available | 590 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Switchgrass Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere | 82.14% |
Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere | 5.00% |
Switchgrass Associated | Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated | 4.29% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.86% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.14% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.43% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.71% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.71% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.71% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009980 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_219 metaG | Host-Associated | Open in IMG/M |
3300009981 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_208 metaG | Host-Associated | Open in IMG/M |
3300009992 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_108 metaG | Host-Associated | Open in IMG/M |
3300009994 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_171 metaG | Host-Associated | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300015270 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015273 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015278 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015280 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015290 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015293 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015301 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015306 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015309 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015311 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015312 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015313 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015315 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015317 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015318 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015319 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015320 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015324 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015325 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015326 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015329 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015330 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015331 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015333 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015334 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015335 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015336 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015338 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015339 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015340 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015348 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015349 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015350 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015352 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015353 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015354 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017408 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017412 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017414 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017421 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017422 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017432 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017439 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017440 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017445 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017446 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017447 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017693 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028056 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
3300028058 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028142 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028470 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
3300028473 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028523 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028529 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300032464 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032467 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_31MAY2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032514 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_12SEP2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032593 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032625 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032689 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_12JUL2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032699 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032758 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_17JUL2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032822 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032826 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_26JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032844 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_17JUL2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032845 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_05JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032914 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032915 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032959 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_26JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300033538 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300033542 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_18SEP2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0070690_1011372031 | 3300005330 | Switchgrass Rhizosphere | GAHIRERLTANRFDLTLQGGPNQHGTRMPRRTTRTNPSPPRLELQNHPTFI* |
Ga0070668_1022625781 | 3300005347 | Switchgrass Rhizosphere | GDQGAHVRERLTANRSDLTLQGGPNQHGTYLPRRTIRTNHSPPRLELQNRPTCI* |
Ga0070671_1018709691 | 3300005355 | Switchgrass Rhizosphere | SDQGAHIRERLTANRFDLTLQGGPNQHGTRMPRRTTRTNHSPPRLELQEPAQRHMVSRA* |
Ga0068863_1008914732 | 3300005841 | Switchgrass Rhizosphere | MRCCDQGAHIQERLTANRSDLTLQGGPNQHGTQKFRRTPRTNLSPPRLELQEPAQ* |
Ga0105247_118165081 | 3300009101 | Switchgrass Rhizosphere | MLRRSDQGAHIRERLTANQFDLTLQGGPNQHGTSMPRRTTRTNHSPPCLELQEPA |
Ga0105249_128142631 | 3300009553 | Switchgrass Rhizosphere | HGDQGAHNRERLTANRSDLTLQGGPNQHGTQKLRQTPHTDLSPLRLELQNRPTYK* |
Ga0105249_130023911 | 3300009553 | Switchgrass Rhizosphere | MRCCDQGAHIRERLTAKRSDLTLQGGPNQHGTQKPRRTPRANPSPPRLEL* |
Ga0105135_1269231 | 3300009980 | Switchgrass Associated | M*LEDQGAHVRERLAANRSDLTLQGGPNQHGTYLPRRTIHANHSPPRLELQEPAQ |
Ga0105133_1237951 | 3300009981 | Switchgrass Associated | MRCCDKGAHILERLTANRSDLTLQGGPNQHGTYLPRRTIHANHSPPRLELQEPAQ |
Ga0105133_1293371 | 3300009981 | Switchgrass Associated | MRCCDQGAHIRERLTANRSDLTLQGGPNQHGTQKPRRTPRTNISPPRLELEEPAQRH |
Ga0105120_10386111 | 3300009992 | Switchgrass Associated | MRCCDQGAHIRERLTANRSDLTLQGEPNQHGTRMPRRTTRTNHSPPRLELQEPAQRHM |
Ga0105120_10414971 | 3300009992 | Switchgrass Associated | MRCCDQGAHIRERLAANRYVITLQGGPNQHGTHMSRQTIRANHSPPHLELQDRPT |
Ga0105126_10241721 | 3300009994 | Switchgrass Associated | MRCCDQGAPIRERLTANRSDLTLQGRPNQHGMHRPRQTTRTNHSPLRFELQNRPTYIL |
Ga0134126_113999721 | 3300010396 | Terrestrial Soil | MRCCDQGTHIRERLTANRSDLILQGGPNEHGTQKPRRTIRTNLSPPRLELQY |
Ga0157380_129556511 | 3300014326 | Switchgrass Rhizosphere | MRCCDQGAHIRERLTANRSDLTLQGEPNQHGTRVPRRTTRTNHSLPRLELQEPAQQ |
Ga0182183_10506611 | 3300015270 | Switchgrass Phyllosphere | MQQRDQGPHNRDTANRFDLTLQGRPNQHGTRMPRRTTRTNPSPPRLELQNHPT |
Ga0182183_10947071 | 3300015270 | Switchgrass Phyllosphere | MRRGDQGAHIRERLTANRSNLTLQDGPNQHGTHRPHRTTRTNHSLSCLELQDRPTIIWSAEL |
Ga0182102_10031942 | 3300015273 | Switchgrass Phyllosphere | MM*LGDQGAHVRE*LTANRFDLTLQGGPNQHGTHKPRQTTRTNLSPPRLELQDR |
Ga0182099_10168331 | 3300015278 | Switchgrass Phyllosphere | M*LGDQGAHVRERLTANRFNLTLQGGPNQHSTQKPRRTTRTNPSPPRLELQD |
Ga0182099_10558271 | 3300015278 | Switchgrass Phyllosphere | MRCCDQGAHNRERLTANRFDLTLQGGPNQHGTHKPRQTTRTNISPPRLEL |
Ga0182100_10477331 | 3300015280 | Switchgrass Phyllosphere | MSRSDQGAHVRERLTANQFDLTLQGGTNQHGTQKPCRTPLTDISTPRLELQDRP |
Ga0182100_10775871 | 3300015280 | Switchgrass Phyllosphere | MRRCDQGAHIREQLMANRYVLTLQGRPNQHSTHRPRRTTRTNHSPPRFELQN |
Ga0182105_10113781 | 3300015290 | Switchgrass Phyllosphere | MRCSDQGAHIRERLTANRSDLTLQGEPNQHGTSMPRRTTRTNHSPPRLELQEPAQRHI |
Ga0182105_10536051 | 3300015290 | Switchgrass Phyllosphere | MRRSDQGAHVRERLTANRFDLTLQCGPNQHGTQKPRRTPRTNLSPPRLELQEPAQR |
Ga0182105_10706291 | 3300015290 | Switchgrass Phyllosphere | MRRSDQGAHIRERLTVNRSDLTLQGGPNQHGTQKPRRTPRTNLSPPRLELQEPA |
Ga0182103_10073951 | 3300015293 | Switchgrass Phyllosphere | MRRSDQGAHIRERLTANRFDLTLQRGPNQHGTRMPRRTTRTNHSPPRLELQNRSTFI* |
Ga0182103_10277031 | 3300015293 | Switchgrass Phyllosphere | MLRRSDQGAHIRERLTANRFDLTLQGGPNQRGTCMPHRTSRTNPSPPRLELQNRPTF |
Ga0182184_10545091 | 3300015301 | Switchgrass Phyllosphere | M*LGDQGAHVRERLTANRFVLTLQGGPNQHGMQKPRRTPRTDISPPRLELQDRPTIIWSAELNV |
Ga0182184_10916091 | 3300015301 | Switchgrass Phyllosphere | MRCCDQDAHIRERLTANRSDLTLQGEPNQHGTYWPRRTIRTNHSPPRL |
Ga0182180_10787761 | 3300015306 | Switchgrass Phyllosphere | MRRSDQGAHIRERLTANRSDLTLQGGSNQHGTYLPRRTIHANHSPPRLELQEPAQRHMVS |
Ga0182098_10257811 | 3300015309 | Switchgrass Phyllosphere | MRCCDQGAHNRERLAANRSDLTLQGGPNQHGTHLPRRTIHANHSPPRLELQNRPTYI* |
Ga0182098_10363361 | 3300015309 | Switchgrass Phyllosphere | MRCCDQGAHIRERLTANRSDLTLQGGPNQHGTYLPRRTIRTNHSPPRLEL |
Ga0182182_10119601 | 3300015311 | Switchgrass Phyllosphere | MRCCDQGAHIRERLAANRSDLTLQGGPKHGTHTSRQTIRTNHSPPRLKLQNR |
Ga0182182_10304621 | 3300015311 | Switchgrass Phyllosphere | MRCCDQGSHIRERLTANRSDLTLQGGPNQHGTQKPRRTPRTNLSPPRLELQEPAQRNMVSRA |
Ga0182182_11099692 | 3300015311 | Switchgrass Phyllosphere | MRRSDQGAHIRERLTANRSDLTLQGGPNQHDTYLPRRTIHANHSPPRLELQELAQRHMVSRAQ |
Ga0182168_10412791 | 3300015312 | Switchgrass Phyllosphere | MRRSDQGAHIRERLTVNRSDLTLQGGPNQHGTYLPRRTIYANHSPPCLELQEPAQRHM |
Ga0182168_10895271 | 3300015312 | Switchgrass Phyllosphere | MRCCDQGAHIRERLIANRSDLTLQGGPNQHGTHLPRRTIHANNSPPRLELQEPAQRHIVSRA |
Ga0182168_11023571 | 3300015312 | Switchgrass Phyllosphere | LGDPGAHVRERLTVNRSDLTLQGVPNQHGTHMARRTIRANHSPPRLELQDRPTSV* |
Ga0182164_10533821 | 3300015313 | Switchgrass Phyllosphere | MRYCDQGAHIRERLTANRSVLTLQGGPNQHGTYLPRRTIQTNHSPPRLELQNRPT |
Ga0182120_10619131 | 3300015315 | Switchgrass Phyllosphere | MRRSDQGAHIRERLTANRSDLTLQGGPYQHGTQKPRRTPRTDVSPPRLELQDRPT |
Ga0182120_10984432 | 3300015315 | Switchgrass Phyllosphere | MRCCDEGAYNRERLTANRSDLTLQGGPNQHGMHLPRRTIHANHSPPRLELQNRPT |
Ga0182136_10682901 | 3300015317 | Switchgrass Phyllosphere | M*LGDQGAHVRERLTANRFDLTLQGGPNQHGTHKPRQTTRTSISPPRLKLQDRPTIIWSAELNV |
Ga0182136_10972131 | 3300015317 | Switchgrass Phyllosphere | M*LEDQGAHVRERLTANRSDLTLQGGPNQHGTQKLRQTPHTDLSPPRLELQEPAQRHMVS |
Ga0182136_11142841 | 3300015317 | Switchgrass Phyllosphere | MFHIILLRCDAVDQGAHIRERPTANRSDLTLQGGPNEHGTQKPRRTPRTNLSPPHLELQEPAQRH |
Ga0182181_10536421 | 3300015318 | Switchgrass Phyllosphere | MRCCDQGAHIRERLTANRSDLTLQGEPNQHGTHKPRRTIRVNHSPPRLELQNRTTY |
Ga0182130_10256501 | 3300015319 | Switchgrass Phyllosphere | MRRSDQGAHIRERLMANRSDLTLQGGPNQHGTHKPRRTTRTSHSPPYLE |
Ga0182130_10465441 | 3300015319 | Switchgrass Phyllosphere | MMRRSDQGAHIRERLTANRSDLTLQGGPNQHGTYLPRRTIHANHSPPRLELQEPAQ |
Ga0182130_11296811 | 3300015319 | Switchgrass Phyllosphere | M*LEDQGAHIRERLTAN*FDLTLQVEPNQHVTHKPRRSPRTDLSPPRLELQE |
Ga0182165_10281471 | 3300015320 | Switchgrass Phyllosphere | M*LGDQGSHVRERLTANRLDLTLQGGPNQHGTQKHRRTTRTNPSPPRLELHDRTTIIW |
Ga0182134_10722121 | 3300015324 | Switchgrass Phyllosphere | MRHSDQGAHIRERLTANRFDLTLQGGPNQHGTRMPRRTTRTNYSPPRLELQNRPTVI* |
Ga0182134_10757441 | 3300015324 | Switchgrass Phyllosphere | M*LGDQGAHVRERLTANRFDLTLQGGPNQHGTQNPRWTTRTNPSPPRLELQDRPT |
Ga0182148_10384132 | 3300015325 | Switchgrass Phyllosphere | MRRSDQGAHNRERQTVYRFDLTLQGGPNQHGTRMPRRTTRTNPSPPRLELQNRPTYI* |
Ga0182148_11009741 | 3300015325 | Switchgrass Phyllosphere | MRRSDQGAQLRERLTANRFDLTLQGGPNQYGVYLPRRTIRANHFSLRLKLQNRPTC |
Ga0182166_10254861 | 3300015326 | Switchgrass Phyllosphere | SHYYDAVLRSSAHIRERLTANRSDLTLQGGPNQQGTYLPRQTIHAYHSPSRLELQDHPTII* |
Ga0182166_11004511 | 3300015326 | Switchgrass Phyllosphere | MCSDQGAHIRERLTANRSDLTLQGGPNQHGTHLPRRTIHANHSPPRLE |
Ga0182166_11284861 | 3300015326 | Switchgrass Phyllosphere | MRCCDQGAHIRERLTANRSDLTLQGGPNQHGTQKPRRTPRTNLSPSRL |
Ga0182135_11088681 | 3300015329 | Switchgrass Phyllosphere | MRCCDQGTYNRERLTANRSDLTLQGGPNQHGTHLPRRTMHANHFPPRLELQNRSTC |
Ga0182152_10405291 | 3300015330 | Switchgrass Phyllosphere | RRSDQGAHIRERLTANRFDLTLQGGPNQHSTQNPRRTPRTDLSPPRLELQNHPTFI* |
Ga0182152_10542111 | 3300015330 | Switchgrass Phyllosphere | MQCYDQGAHNRERLTANQSDLTLQGGPNQHGTHLPRRTIHANHSPPRLELQNR |
Ga0182131_10537851 | 3300015331 | Switchgrass Phyllosphere | MRRSDQGAHIRERMTANRSDLTLQGGPNQHGTFLPRRTIHANHYPPRLELQNRPTCV* |
Ga0182131_11025001 | 3300015331 | Switchgrass Phyllosphere | MRCCDQGAHIRERLTANRSDLTLQGGPNQHGTYLPRRTIQTNHSPPRLELQEP |
Ga0182147_10681481 | 3300015333 | Switchgrass Phyllosphere | MRRSDQGAHIRERLTANRSDLTLQGGPNQHDTCMPRRTTRTNPSTSRLELQNRPTYI* |
Ga0182147_11410721 | 3300015333 | Switchgrass Phyllosphere | MRCCGQGAHIRERLTANRSALTLQGEPNQHGTRMPRRTTRTNHSPPRL |
Ga0182132_10448311 | 3300015334 | Switchgrass Phyllosphere | MRCCDQGAHNRERLTANRSDLTLQGRPNQHGMHLPRRTIHANHFSLRFEL |
Ga0182132_10747361 | 3300015334 | Switchgrass Phyllosphere | M*LGDQGAHVRERLTANRFDLTLQGGPNQHGTQKPRRTTRTNHSPPRLELQDRPTII*SAELN |
Ga0182132_11653561 | 3300015334 | Switchgrass Phyllosphere | MFRFNTTMRCCDQGAHVRKRLTANQSDLTLQGGPNQHGTYLPRRTIRANHSPFRLEL |
Ga0182116_10421081 | 3300015335 | Switchgrass Phyllosphere | M*LGDQGAHVRERLTAN*FDLTLQGGPNQHGTQKPRRTPRTDLSPPRLKLQDRP |
Ga0182150_10879971 | 3300015336 | Switchgrass Phyllosphere | MMRCCDQGAHIRERLTANRSDLTLQGGPNQHGTQKPRRTPRTNLSPPRLELQE |
Ga0182137_10864801 | 3300015338 | Switchgrass Phyllosphere | MRCSDQGAHVRERLTANRFDLTLQGEPNQHGTYLSRRTIHASHSPPRLKLQEPAQQ |
Ga0182149_11724421 | 3300015339 | Switchgrass Phyllosphere | M*LGDQGAHVRERLTANRFDLTLQGGPNQHGTHKTRQTTRTNISPPRLELQDRPTIIWSAEL |
Ga0182133_11008231 | 3300015340 | Switchgrass Phyllosphere | MRCCDQGAHIRERLAANQSVITLQGGPNQHGTQRPRRTSHTNLSPPRLELQEPAQRHMVSRAQ |
Ga0182115_10598912 | 3300015348 | Switchgrass Phyllosphere | MWCCEQGAHIQERLTANRFDITLQGGPNQHDMYKPHRTTRTNHSPPRLELQDRPTIIWS |
Ga0182115_12053721 | 3300015348 | Switchgrass Phyllosphere | DQGAHIRERLTANQFDLTLQGRPNQHGTQKPRRTLRANPSPLRLEL* |
Ga0182115_12575001 | 3300015348 | Switchgrass Phyllosphere | MRCCDQGAHIRERLTANRSDLTLQGGPNQHGTYLPRRTIHANHSPPRLELQ |
Ga0182115_12739751 | 3300015348 | Switchgrass Phyllosphere | MRRSDQGAHIRERLTANRFDLTLQSGPHQHGTHMSRRTIRTNHSPPHLELQEPAQRYI |
Ga0182185_11056181 | 3300015349 | Switchgrass Phyllosphere | MMRCCNQGAHIRERLAANRSVLTLQGEPNQHVTHKPHRTTRTNHSPPRLE |
Ga0182185_12798821 | 3300015349 | Switchgrass Phyllosphere | MSRSDQGAHVRERPTANRFDLTLQGGPNQHGTHRPRRTTRTNHSPSRLELQDRTTSV |
Ga0182163_10648441 | 3300015350 | Switchgrass Phyllosphere | MRCCDQGAHIRERLAANRSDLTLQIGPNQHGTHLSRRTIHANNSHPHLELQN |
Ga0182163_11089541 | 3300015350 | Switchgrass Phyllosphere | MQCYDQGAHIREQLTANRFNLNLQGGPNQHGMHISRRTTRTNHSPPCFELQNRPTY |
Ga0182163_11755581 | 3300015350 | Switchgrass Phyllosphere | MRCCDQGAHNRERLAANRSDLTLQGGPNQHGTHLPRRTIHANHSPPRLELQNRP |
Ga0182169_11898561 | 3300015352 | Switchgrass Phyllosphere | MRCCDQGAHIRERLTANRSDLTLQGGPNQHGAYLPRRTIRTNYFHPRLELQEPAQRHIVSRAQCE |
Ga0182169_12293191 | 3300015352 | Switchgrass Phyllosphere | SDQGAHVRERLTANQSDLTLQDGPNQPGMYLPHRTIHAYHSPPRLELQDRPTII* |
Ga0182169_12954571 | 3300015352 | Switchgrass Phyllosphere | MWCCDQGAHIRERLTANRSDLTLQGGPNQHGTQKPRRTPRTNLSPPRLELQELAQR |
Ga0182179_11432211 | 3300015353 | Switchgrass Phyllosphere | MRCCDQGSHNRERLAANRSDLTLQGGPNQHGTHLPRRTIHANHSPPRLELQNRPTYI* |
Ga0182167_11200051 | 3300015354 | Switchgrass Phyllosphere | MRCCDQGARIRERLTANRSVLTSQGGPNQHGVQKPRRTPHTNLSPPRLE |
Ga0182167_13034952 | 3300015354 | Switchgrass Phyllosphere | MFHSILLRCDAFDHGAHVRERLTANRFDLTLQGGPNQHGTHRSRRTTRTNYSPPRLELQEPAQRHIVS* |
Ga0182167_13421211 | 3300015354 | Switchgrass Phyllosphere | MMWCCDQGAHNRERLTANQSDLTLQGGPNQHGTHLLRRTIHANHSPPRLELQNRPTYI* |
Ga0182197_11071661 | 3300017408 | Switchgrass Phyllosphere | MLRLGDQGAHVRERQTANRFDLTLQGGSNQHSMYLPRPTIRANISPPRLELQNRPPA |
Ga0182197_11241101 | 3300017408 | Switchgrass Phyllosphere | MXLGDQGAHIRERLTANRFDLTLQGGPNQHGTQKPHRTPRTELSPPRLELQELAQRHM |
Ga0182197_11421521 | 3300017408 | Switchgrass Phyllosphere | MXLGDQGAHVRERLMANRFDLTLQGGPNQHGMQKPRRTTRTNPSPPRLELQDRPTI |
Ga0182199_11117621 | 3300017412 | Switchgrass Phyllosphere | MRCCDQGAHIRERLAANRSDLTLQGGPNQHGTYWPCRTLRANHFPPRLELQDRPTI |
Ga0182199_11155141 | 3300017412 | Switchgrass Phyllosphere | MRCCDQGAHNRERLAANLSDLTLQGGPNQHGTHLPRRTIHANHSPPRLELQNRPTYI |
Ga0182199_11455101 | 3300017412 | Switchgrass Phyllosphere | MRRSDQGAHIRERLTANRSDLTLQGGPNQHGTYLPRRTIHANHSPPRLELQDRPTSV |
Ga0182199_11973261 | 3300017412 | Switchgrass Phyllosphere | MRCCDQGAHIRERLAANRSDLTLQGGPNQHGTQKPRRTPRTNLSPPRLELQE |
Ga0182195_10646251 | 3300017414 | Switchgrass Phyllosphere | MRRSDQGAHLRERLTANRFNLTLQGGPNQHGMHMPRRTTRANPSPPRLELQNRPTYI |
Ga0182195_12025911 | 3300017414 | Switchgrass Phyllosphere | MXLGDQGAHIRERLTANRFDLTLQGGPNQHGTQKPRQTPRTNLSPPCLELQNRPTC |
Ga0182213_11331641 | 3300017421 | Switchgrass Phyllosphere | MRRSDQGAHIRERLTANRSDLTLQGGPNQHGTYLPCRTIHANHSPPHLELQELAQRHMVSRAQRE |
Ga0182201_11365371 | 3300017422 | Switchgrass Phyllosphere | MRRSDQGAQLRERLTANRFDLTLQGGHNQHGTHMSRWIIRTNHSPPHLELQEPAQRHIVSRA |
Ga0182196_10243141 | 3300017432 | Switchgrass Phyllosphere | MRCCDQGAHIRERLTANRSDLTLQGGPNQHGTQKPRRTPRTNLSPPRLELQEPAQRHMVSRAQR |
Ga0182196_11021041 | 3300017432 | Switchgrass Phyllosphere | MRRSDQGSHIRERLTANRFDLTLQGGPNQHGTRMPRRTTRTNPFPPRLELQNRPTY |
Ga0182200_11587091 | 3300017439 | Switchgrass Phyllosphere | MRRGDQGAHIRERLMANRSDLTLQGGPNPHVTYLPRRTIHANHSPPRLEL |
Ga0182214_11123521 | 3300017440 | Switchgrass Phyllosphere | MQQRDQGPHKLRDTANRFDLTLQGGPNQHGTQKLRRTPHTNLSPPCLELQNRP |
Ga0182214_11169731 | 3300017440 | Switchgrass Phyllosphere | MRRSDQGAHIRERLTANRFDLTLQGGPNQYGTRMPRRTTRTNHSPLRLELQNHPT |
Ga0182198_10523941 | 3300017445 | Switchgrass Phyllosphere | MRLGDQSAHIRERLTANRSDLTLKGRPNQHGTLKPRRTTRTNHSPPRLELQ |
Ga0182198_10749351 | 3300017445 | Switchgrass Phyllosphere | MXLRDQGPHDRETANRSDLTFQGEPNQHGTQKPRRTPRTNFSLPRLELQNRPT |
Ga0182198_11186111 | 3300017445 | Switchgrass Phyllosphere | MMWCCDQGAHNRERLTANQSDLTLQGGPNQHGTHLLRRTIHANHSPPRLE |
Ga0182198_11485261 | 3300017445 | Switchgrass Phyllosphere | MRCCDQGAHIRERLTANQSVITLQGGPNQHGTQKPRRTSRTNLSPPRLELQKPAQRHMV |
Ga0182217_11341891 | 3300017446 | Switchgrass Phyllosphere | MRRSDQGAHVRERLTANRFDLTLQGGPNQHGTRMPRRTTRTNRSPPGLELQEPAHRHM |
Ga0182215_11622601 | 3300017447 | Switchgrass Phyllosphere | MSRSDQGAHVRERPTANRFDLTLQGGPNQHGTHRSRRTTRTNHSSSRLELQDR |
Ga0182216_10510211 | 3300017693 | Switchgrass Phyllosphere | MRRSDQGAHIRERLTANQVDLTLQGGPNQHGTHMPRWTTRINPSPSRLELQNRP |
Ga0207644_106575102 | 3300025931 | Switchgrass Rhizosphere | MRCCDQGAHIRERLTVNRSYLTLQGGPNQHGTYRPRRTPRTNHSPPHLELQDRPTIIWSAELNV |
Ga0207658_118553821 | 3300025986 | Switchgrass Rhizosphere | MRRSDQGAHIRERLTANRFDLTLQGGPNQHGTQKPRRTTRTNPSPPRLELQDRPTIIW |
Ga0207676_120238261 | 3300026095 | Switchgrass Rhizosphere | MPQLETTLXHSDQGAHVRERLTANRFDLTLQGGPNQHGTHRSRRTTRTNYSPPRLELQEPAQR |
Ga0268330_10593171 | 3300028056 | Phyllosphere | VLRSSAHIRERLTANRSDLTLQGGPNQQGMYLPRQTIHAYHSPSRLELQDHPT |
Ga0268332_10783451 | 3300028058 | Phyllosphere | MRCCDKGAHIRERLMANRSDLTLQGGPNQHGTYLPRRTIRTNHSPPRLELQDR |
Ga0268347_10036991 | 3300028142 | Phyllosphere | MXLGDQGAHVRERLTANRFDLTLQGGPNQHGTQKPRRTTRTNPSPPHLELQNHP |
Ga0268307_10166581 | 3300028470 | Phyllosphere | MRCSDQGAHVRERLTANRFDLTLQGGPNQHGTQKPRRTTRTNRSPPRLELQDRPTIIWSA |
Ga0268319_10020211 | 3300028473 | Phyllosphere | MRRSDQGAHIRERLTANRSDLTLQGGPNQYGTYLPHRTIHANHSPPRLELQEPAQRHMVSRA |
Ga0268313_10077521 | 3300028523 | Phyllosphere | MRRSDQGAHIRERLMANRSDLTLQGGPNQHGTYLPRRTIHANHSPPRLELQDRPTSV |
Ga0268311_10291161 | 3300028529 | Phyllosphere | MQCYDQGAHNRERLTANQSDLTLQGGPNQHGTHLLRRTIHANHSPPRLELQNRPTYI |
Ga0214492_10047302 | 3300032464 | Switchgrass Phyllosphere | MRCCDQGAHIRERPTANRSDLTLQGGPNQHGTQKPRRTPRTNISPPRLELQEPAQRHMVS |
Ga0214488_10847021 | 3300032467 | Switchgrass Phyllosphere | MWCCDQGAHIRERLTANRSDLTLQGGPNQHGTYLPRRTIRTNHSPPRLEL |
Ga0214502_14086151 | 3300032514 | Switchgrass Phyllosphere | MMRCCDQGAHIRERLTANRSALTLQGEPNQHGTRMPRRTTGTNHSPSRLE |
Ga0321338_10179701 | 3300032593 | Switchgrass Phyllosphere | MRCCDQGAHIRERPTANRSDLTLQGGPNQHGTQKPRRTPRTNLSPPRLELQEPAQRHMVS |
Ga0321338_11951561 | 3300032593 | Switchgrass Phyllosphere | MRCCDQGAHIRERLTANRSDLTLQGGPNQHGTQKPRRTPRTNLSPPPLELQEPAQRH |
Ga0321338_11953902 | 3300032593 | Switchgrass Phyllosphere | MRCCDQCAHIRERLTANRSDLTLQGGPNQHGTYLPRRTIRANHSPPRLE |
Ga0214501_10879522 | 3300032625 | Switchgrass Phyllosphere | MRRSDQGAHIRERLMANRFDLTLQGGPNQHGMYLPHRIIRTNHSLPCLELQNRP |
Ga0214497_11152611 | 3300032689 | Switchgrass Phyllosphere | MRCCDQGAHIRERLTANRSDLTLQGGPNQHGTQKPRRTPRTNLSPPRLELQ |
Ga0214494_10477801 | 3300032699 | Switchgrass Phyllosphere | MWCRDQGAHIRERLTANRSVLTSQGGPNQHGVQKPRRTPHTNLSPPRLELQEPAQRHMV |
Ga0314746_10932811 | 3300032758 | Switchgrass Phyllosphere | MRRSDQGAHIRERLMANRFNLTLQGEPNQHGMRLPRRTTRTNHSPPRLELQEP |
Ga0314740_10313931 | 3300032822 | Switchgrass Phyllosphere | MRCCDQGAHIRERLTANRSDLTLQGGPNQHGTQKSRRTPRTNISPPRLELQEPAQR |
Ga0314732_1284661 | 3300032826 | Switchgrass Phyllosphere | MRCCDQGAHIRERLTANRSDLTLQGGPNQHGTYLPRRTIRTNHSPPRLELQEPAQRHMVSRAQ |
Ga0314743_11198111 | 3300032844 | Switchgrass Phyllosphere | MRCCDQGTHIRERLTANRSDLTLQGGPNQHGTYLPRRTIRTNHSPPRLELQEPAQRHM |
Ga0314727_10016281 | 3300032845 | Switchgrass Phyllosphere | LEDQGAHVRERLTANRSDLTLQGGPNQHGTHMPRRTIRANHSPPRLELQDRHTSV |
Ga0314750_10818291 | 3300032914 | Switchgrass Phyllosphere | DQGAHIRERLTANRSDLTLQGGPNQHGMHKPRRTTRTNHSPPRLEL |
Ga0314750_11331151 | 3300032914 | Switchgrass Phyllosphere | MRCCDQGAHIRERLTANRSDLTLQGGPNQHGTYLPRRTIHANHSPPRLELQEPA |
Ga0314749_11265911 | 3300032915 | Switchgrass Phyllosphere | MXLGDQGAHVRERLTANRFDLTLQGGLNQYGTHKPCQTTRTNLSPLRLELQDR |
Ga0314738_10697061 | 3300032959 | Switchgrass Phyllosphere | MRCCDQGGHIRERLTSNRSDLILQGGPNQHGTYLPRRTIRTNNSPLRLELQNRPT |
Ga0314755_11685401 | 3300033538 | Switchgrass Phyllosphere | MXLGDQGAHVRERLTANRFDLTLQGGLNQHGTHKPRQTTRTNLFPLRLELQ |
Ga0314769_12541371 | 3300033542 | Switchgrass Phyllosphere | MRCCDQGAHIRERLTANRSDLTLQGGPNQHGTQKPRRTPRTNISPPRLELQEPAQRHMVS |
⦗Top⦘ |