Metagenome / Metatranscriptome Family F053731

Basic Information
Family ID	F053731
Family Type	Metagenome / Metatranscriptome
Number of Sequences	140
Average Sequence Length	41 residues
Representative Sequence	MCVFGAIDDPQFEEQQQDQDFGGPDQQQFEEGKWTLDHVFDP
Number of Associated Samples	87
Number of Associated Scaffolds	140

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Eukaryota
% of genes with valid RBS motifs	0.72 %
% of genes near scaffold ends (potentially truncated)	38.57 %
% of genes from short scaffolds (< 2000 bps)	99.29 %
Associated GOLD sequencing projects	86
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.28

Most Common Taxonomy
Group	Eukaryota (60.714 % of family members)
NCBI Taxonomy ID	2759
Taxonomy	All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (65.000 % of family members)
Environment Ontology (ENVO)	Unclassified (85.000 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant surface (79.286 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 12.86% β-sheet: 0.00% Coil/Unstructured: 87.14%
Feature Viewer

Powered by Feature Viewer

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	60.71 %
Unclassified	root	N/A	39.29 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	60.71 %
Unclassified	root	N/A	39.29 %

Name	Rank	Taxonomy	Distribution
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	60.71 %
Unclassified	root	N/A	39.29 %

Name	Rank	Taxonomy	Distribution
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	60.71 %
Unclassified	root	N/A	39.29 %

Name	Rank	Taxonomy	Distribution
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	60.71 %
Unclassified	root	N/A	39.29 %

Name	Rank	Taxonomy	Distribution
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	60.71 %
Unclassified	root	N/A	39.29 %

Name	Rank	Taxonomy	Distribution
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	60.71 %
Unclassified	root	N/A	39.29 %

Name	Rank	Taxonomy	Distribution
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	60.71 %
Unclassified	root	N/A	39.29 %

Name	Rank	Taxonomy	Distribution
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	60.71 %
Unclassified	root	N/A	39.29 %

Name	Rank	Taxonomy	Distribution
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	60.71 %
Unclassified	root	N/A	39.29 %

Name	Rank	Taxonomy	Distribution
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	60.71 %
Unclassified	root	N/A	39.29 %

Name	Rank	Taxonomy	Distribution
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	60.71 %
Unclassified	root	N/A	39.29 %

Name	Rank	Taxonomy	Distribution
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	60.71 %
Unclassified	root	N/A	39.29 %

Name	Rank	Taxonomy	Distribution
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	60.71 %
Unclassified	root	N/A	39.29 %

Name	Rank	Taxonomy	Distribution
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	60.71 %
Unclassified	root	N/A	39.29 %

Name	Rank	Taxonomy	Distribution
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	60.71 %
Unclassified	root	N/A	39.29 %

Name	Rank	Taxonomy	Distribution
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	60.71 %
Unclassified	root	N/A	39.29 %

Name	Rank	Taxonomy	Distribution
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	60.71 %
Unclassified	root	N/A	39.29 %

Name	Rank	Taxonomy	Distribution
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	60.71 %
Unclassified	root	N/A	39.29 %

Name	Rank	Taxonomy	Distribution
Panicodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae	60.71 %
Unclassified	root	N/A	39.29 %

Name	Rank	Taxonomy	Distribution
Paniceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	60.71 %
Unclassified	root	N/A	39.29 %

Name	Rank	Taxonomy	Distribution
Panicinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae	58.57 %
Unclassified	root	N/A	39.29 %
Cenchrinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae	2.14 %

Name	Rank	Taxonomy	Distribution
Panicum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	58.57 %
Unclassified	root	N/A	39.29 %
Setaria	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria	2.14 %

Name	Rank	Taxonomy	Distribution
Panicum sect. Hiantes	section	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes	58.57 %
Unclassified	root	N/A	39.29 %
Setaria viridis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria viridis	2.14 %

Name	Rank	Taxonomy	Distribution
Panicum virgatum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	58.57 %
Unclassified	root	N/A	39.29 %
Setaria viridis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria viridis	2.14 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300005445\|Ga0070708_101721507	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	583	Open in IMG/M
3300005467\|Ga0070706_101789336	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	559	Open in IMG/M
3300005544\|Ga0070686_100305347	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	1181	Open in IMG/M
3300005618\|Ga0068864_101878481	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	604	Open in IMG/M
3300005841\|Ga0068863_101417685	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	702	Open in IMG/M
3300009553\|Ga0105249_11850464	Not Available	676	Open in IMG/M
3300009975\|Ga0105129_102116	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	955	Open in IMG/M
3300009975\|Ga0105129_112450	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	598	Open in IMG/M
3300009975\|Ga0105129_117567	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	539	Open in IMG/M
3300009976\|Ga0105128_109968	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	645	Open in IMG/M
3300009977\|Ga0105141_105263	Not Available	1097	Open in IMG/M
3300009977\|Ga0105141_114317	Not Available	689	Open in IMG/M
3300009980\|Ga0105135_115056	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	638	Open in IMG/M
3300009981\|Ga0105133_101402	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	1179	Open in IMG/M
3300009981\|Ga0105133_118186	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	603	Open in IMG/M
3300009989\|Ga0105131_109695	Not Available	812	Open in IMG/M
3300009989\|Ga0105131_131627	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	567	Open in IMG/M
3300009990\|Ga0105132_108388	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	828	Open in IMG/M
3300009992\|Ga0105120_1019399	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	740	Open in IMG/M
3300009992\|Ga0105120_1027605	Not Available	659	Open in IMG/M
3300009992\|Ga0105120_1033736	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	615	Open in IMG/M
3300009992\|Ga0105120_1039396	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	580	Open in IMG/M
3300009992\|Ga0105120_1040363	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	575	Open in IMG/M
3300009994\|Ga0105126_1002551	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	1397	Open in IMG/M
3300009994\|Ga0105126_1035357	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	600	Open in IMG/M
3300009995\|Ga0105139_1019857	Not Available	994	Open in IMG/M
3300009995\|Ga0105139_1089367	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria viridis	586	Open in IMG/M
3300010371\|Ga0134125_11032911	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	901	Open in IMG/M
3300010400\|Ga0134122_10322522	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	1334	Open in IMG/M
3300010400\|Ga0134122_10730916	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	935	Open in IMG/M
3300010401\|Ga0134121_11492842	Not Available	691	Open in IMG/M
3300010403\|Ga0134123_12590752	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	574	Open in IMG/M
3300012949\|Ga0153798_10311834	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	501	Open in IMG/M
3300013306\|Ga0163162_13166686	Not Available	528	Open in IMG/M
3300014325\|Ga0163163_12967216	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	529	Open in IMG/M
3300014325\|Ga0163163_13264323	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	506	Open in IMG/M
3300014968\|Ga0157379_11407289	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	676	Open in IMG/M
3300014968\|Ga0157379_11715604	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	615	Open in IMG/M
3300015280\|Ga0182100_1008229	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	1087	Open in IMG/M
3300015280\|Ga0182100_1078943	Not Available	547	Open in IMG/M
3300015284\|Ga0182101_1012033	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	974	Open in IMG/M
3300015290\|Ga0182105_1055656	Not Available	636	Open in IMG/M
3300015290\|Ga0182105_1098937	Not Available	520	Open in IMG/M
3300015293\|Ga0182103_1009698	Not Available	1017	Open in IMG/M
3300015293\|Ga0182103_1068807	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria viridis	578	Open in IMG/M
3300015293\|Ga0182103_1089288	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	530	Open in IMG/M
3300015293\|Ga0182103_1093884	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	521	Open in IMG/M
3300015297\|Ga0182104_1038051	Not Available	749	Open in IMG/M
3300015297\|Ga0182104_1048102	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	694	Open in IMG/M
3300015301\|Ga0182184_1033062	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	732	Open in IMG/M
3300015301\|Ga0182184_1092317	Not Available	519	Open in IMG/M
3300015306\|Ga0182180_1009556	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	1165	Open in IMG/M
3300015306\|Ga0182180_1022307	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	848	Open in IMG/M
3300015309\|Ga0182098_1056675	Not Available	669	Open in IMG/M
3300015309\|Ga0182098_1060572	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	655	Open in IMG/M
3300015310\|Ga0182162_1050543	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria viridis	708	Open in IMG/M
3300015310\|Ga0182162_1122154	Not Available	515	Open in IMG/M
3300015311\|Ga0182182_1031800	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	798	Open in IMG/M
3300015312\|Ga0182168_1128947	Not Available	515	Open in IMG/M
3300015313\|Ga0182164_1088409	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	597	Open in IMG/M
3300015315\|Ga0182120_1018148	Not Available	1024	Open in IMG/M
3300015315\|Ga0182120_1115215	Not Available	542	Open in IMG/M
3300015316\|Ga0182121_1076498	Not Available	654	Open in IMG/M
3300015316\|Ga0182121_1088466	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	618	Open in IMG/M
3300015316\|Ga0182121_1129652	Not Available	528	Open in IMG/M
3300015318\|Ga0182181_1101961	Not Available	526	Open in IMG/M
3300015319\|Ga0182130_1079707	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	616	Open in IMG/M
3300015320\|Ga0182165_1049709	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	759	Open in IMG/M
3300015320\|Ga0182165_1107939	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	570	Open in IMG/M
3300015325\|Ga0182148_1107123	Not Available	568	Open in IMG/M
3300015326\|Ga0182166_1135341	Not Available	517	Open in IMG/M
3300015328\|Ga0182153_1051134	Not Available	756	Open in IMG/M
3300015329\|Ga0182135_1070579	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	682	Open in IMG/M
3300015329\|Ga0182135_1096226	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	608	Open in IMG/M
3300015330\|Ga0182152_1041513	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	824	Open in IMG/M
3300015330\|Ga0182152_1077316	Not Available	661	Open in IMG/M
3300015330\|Ga0182152_1084966	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	638	Open in IMG/M
3300015330\|Ga0182152_1131661	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	537	Open in IMG/M
3300015330\|Ga0182152_1156514	Not Available	500	Open in IMG/M
3300015331\|Ga0182131_1062903	Not Available	715	Open in IMG/M
3300015332\|Ga0182117_1080309	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	689	Open in IMG/M
3300015333\|Ga0182147_1085719	Not Available	665	Open in IMG/M
3300015333\|Ga0182147_1104160	Not Available	615	Open in IMG/M
3300015333\|Ga0182147_1126517	Not Available	569	Open in IMG/M
3300015333\|Ga0182147_1148460	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	532	Open in IMG/M
3300015334\|Ga0182132_1065895	Not Available	736	Open in IMG/M
3300015334\|Ga0182132_1078882	Not Available	688	Open in IMG/M
3300015334\|Ga0182132_1160237	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	514	Open in IMG/M
3300015335\|Ga0182116_1033500	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	972	Open in IMG/M
3300015335\|Ga0182116_1135625	Not Available	570	Open in IMG/M
3300015336\|Ga0182150_1022144	Not Available	1035	Open in IMG/M
3300015336\|Ga0182150_1070763	Not Available	703	Open in IMG/M
3300015336\|Ga0182150_1117867	Not Available	579	Open in IMG/M
3300015337\|Ga0182151_1126840	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	563	Open in IMG/M
3300015339\|Ga0182149_1108763	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	613	Open in IMG/M
3300015340\|Ga0182133_1044557	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	900	Open in IMG/M
3300015348\|Ga0182115_1192377	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	654	Open in IMG/M
3300015349\|Ga0182185_1109152	Not Available	801	Open in IMG/M
3300015349\|Ga0182185_1256285	Not Available	533	Open in IMG/M
3300015352\|Ga0182169_1107191	Not Available	897	Open in IMG/M
3300015352\|Ga0182169_1152804	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	753	Open in IMG/M
3300015352\|Ga0182169_1210646	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	635	Open in IMG/M
3300015353\|Ga0182179_1226663	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	599	Open in IMG/M
3300015354\|Ga0182167_1279956	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	596	Open in IMG/M
3300015354\|Ga0182167_1299270	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	571	Open in IMG/M
3300017408\|Ga0182197_1132598	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	529	Open in IMG/M
3300017414\|Ga0182195_1128746	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	627	Open in IMG/M
3300017414\|Ga0182195_1173520	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	557	Open in IMG/M
3300017414\|Ga0182195_1204435	Not Available	520	Open in IMG/M
3300017421\|Ga0182213_1147946	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	661	Open in IMG/M
3300017422\|Ga0182201_1064004	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	666	Open in IMG/M
3300017432\|Ga0182196_1015233	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	1090	Open in IMG/M
3300017435\|Ga0182194_1115361	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	561	Open in IMG/M
3300017439\|Ga0182200_1040231	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	814	Open in IMG/M
3300017439\|Ga0182200_1053705	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	741	Open in IMG/M
3300017439\|Ga0182200_1085350	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	634	Open in IMG/M
3300017439\|Ga0182200_1147772	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	522	Open in IMG/M
3300017445\|Ga0182198_1024907	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	1067	Open in IMG/M
3300017445\|Ga0182198_1110527	Not Available	637	Open in IMG/M
3300017445\|Ga0182198_1162420	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	550	Open in IMG/M
3300017445\|Ga0182198_1174603	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	534	Open in IMG/M
3300017694\|Ga0182211_1090050	Not Available	715	Open in IMG/M
3300025931\|Ga0207644_10317217	Not Available	1260	Open in IMG/M
3300025972\|Ga0207668_11888851	Not Available	538	Open in IMG/M
3300026088\|Ga0207641_11849912	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	605	Open in IMG/M
3300028054\|Ga0268306_1033145	Not Available	512	Open in IMG/M
3300028062\|Ga0268342_1045364	Not Available	501	Open in IMG/M
3300028064\|Ga0268340_1080825	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	516	Open in IMG/M
3300028149\|Ga0268353_118485	Not Available	521	Open in IMG/M
3300028153\|Ga0268320_1003882	Not Available	901	Open in IMG/M
3300028379\|Ga0268266_10922826	Not Available	845	Open in IMG/M
3300028477\|Ga0268309_1002524	Not Available	915	Open in IMG/M
3300032465\|Ga0214493_1030047	Not Available	1228	Open in IMG/M
3300032697\|Ga0214499_1092113	Not Available	926	Open in IMG/M
3300032761\|Ga0314733_1113654	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	501	Open in IMG/M
3300032812\|Ga0314745_1049226	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	907	Open in IMG/M
3300032914\|Ga0314750_1072080	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	801	Open in IMG/M
3300033526\|Ga0314761_1076052	Not Available	747	Open in IMG/M
3300033530\|Ga0314760_1150576	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	568	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	93.57%
Environmental	Environmental	5.71%
Engineered	Engineered	0.71%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	93.57%
Terrestrial	Environmental → Terrestrial	5.71%
Bioreactor	Engineered → Bioreactor	0.71%

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	69.29%
Unclassified	Host-Associated → Plants → Unclassified	15.00%
Soil	Environmental → Terrestrial → Soil	5.71%
Rhizosphere	Host-Associated → Plants → Rhizosphere	5.00%
Rhizoplane	Host-Associated → Plants → Rhizoplane	2.86%
Roots	Host-Associated → Plants → Roots	1.43%
Unclassified	Engineered → Bioreactor → Unclassified	0.71%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	69.29%
Unclassified	Host-Associated → Plants → Unclassified → Unclassified	15.00%
Unclassified	Environmental → Terrestrial → Soil → Unclassified	3.57%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	2.86%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	2.86%
Loam	Environmental → Terrestrial → Soil → Loam	2.14%
Soil	Host-Associated → Plants → Rhizosphere → Soil	2.14%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	1.43%
Unclassified	Engineered → Bioreactor → Unclassified → Unclassified	0.71%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	69.29%
Unclassified	Host-Associated → Plants → Unclassified → Unclassified → Unclassified	15.00%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	3.57%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	2.86%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	2.86%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	2.14%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	2.14%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	1.43%
Unclassified	Engineered → Bioreactor → Unclassified → Unclassified → Unclassified	0.71%

Habitat	Taxonomy	Distribution
Switchgrass Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere	65.00%
Switchgrass Associated	Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated	15.00%
Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere	4.29%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	3.57%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	2.14%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	2.14%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	2.14%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	1.43%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	1.43%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	0.71%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.71%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.71%
Switchgrass Degrading	Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Switchgrass Degrading	0.71%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Environmental	Open in IMG/M
3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Environmental	Open in IMG/M
3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Environmental	Open in IMG/M
3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Host-Associated	Open in IMG/M
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated	Open in IMG/M
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated	Open in IMG/M
3300009975	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_187 metaG	Host-Associated	Open in IMG/M
3300009976	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_186 metaG	Host-Associated	Open in IMG/M
3300009977	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_91 metaG	Host-Associated	Open in IMG/M
3300009980	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_219 metaG	Host-Associated	Open in IMG/M
3300009981	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_208 metaG	Host-Associated	Open in IMG/M
3300009989	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_197 metaG	Host-Associated	Open in IMG/M
3300009990	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_206 metaG	Host-Associated	Open in IMG/M
3300009992	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_108 metaG	Host-Associated	Open in IMG/M
3300009994	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_171 metaG	Host-Associated	Open in IMG/M
3300009995	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_227 metaG	Host-Associated	Open in IMG/M
3300010371	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1	Environmental	Open in IMG/M
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental	Open in IMG/M
3300010401	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1	Environmental	Open in IMG/M
3300010403	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3	Environmental	Open in IMG/M
3300012949	Switchgrass enrichment cultures co-assembly	Engineered	Open in IMG/M
3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Host-Associated	Open in IMG/M
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated	Open in IMG/M
3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Host-Associated	Open in IMG/M
3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Host-Associated	Open in IMG/M
3300015280	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015284	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015290	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015293	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015297	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015301	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015306	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015309	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015310	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015311	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015312	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015313	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015315	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015316	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015318	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015319	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015320	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015325	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015326	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015328	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015329	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015330	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015331	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015332	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015333	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015334	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015335	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015336	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015337	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015339	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015340	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015348	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015349	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015352	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015353	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015354	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017408	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017414	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017421	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017422	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017432	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017435	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017439	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017445	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017694	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028054	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_15MAY2017_LD1	Host-Associated	Open in IMG/M
3300028062	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_28AUG2017_LD1	Host-Associated	Open in IMG/M
3300028064	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_28AUG2017_LD1	Host-Associated	Open in IMG/M
3300028149	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_18SEP2017_LD1	Host-Associated	Open in IMG/M
3300028153	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_26JUN2017_LD1	Host-Associated	Open in IMG/M
3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300028477	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_05JUN2017_LD1	Host-Associated	Open in IMG/M
3300032465	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032697	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032761	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_26JUN2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032812	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_17JUL2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032914	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300033526	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_28AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300033530	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_28AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.28
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.28
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F053731

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0070708_1017215071	3300005445	Corn, Switchgrass And Miscanthus Rhizosphere	MCVCDAIDDQQFEEQHQDQDFGGPDQQQFEEGKWTLDHVFDP*
Ga0070706_1017893361	3300005467	Corn, Switchgrass And Miscanthus Rhizosphere	MCVCDAIDDPQFEEQQQDQGFGGPDQQQFEEGKWTLDHIFDP*
Ga0070686_1003053473	3300005544	Switchgrass Rhizosphere	MCVCDAIDDPQFEEQQQDQGFGGPDQQQFEEGKWTLDHVFDP*
Ga0068864_1018784812	3300005618	Switchgrass Rhizosphere	MCVCDAIDDPQFEEQQQDQGFGGPDQQQFEEGKWT
Ga0068863_1014176851	3300005841	Switchgrass Rhizosphere	MCVCDAIDDPQFEEQQQDQGFGGPDQQQFEEGKWTL
Ga0105249_118504642	3300009553	Switchgrass Rhizosphere	MCVFGALDGPQFEEQQQDQDFGGPDQQQFEEGKWTLDHVFDP*
Ga0105129_1021162	3300009975	Switchgrass Associated	MCVCDAIDDPQFEEQQQDQDFGGPDQQQFEEGKWTLDHVFDP*
Ga0105129_1124501	3300009975	Switchgrass Associated	MCVFGTIDDPQFVEQQQDQDFGGLDQQQFEEGKWTLDHIFDP*
Ga0105129_1175672	3300009975	Switchgrass Associated	MCVFGAIDDPQLEEQQDQDFGGPDQQQFEEGKWTFDHAFDP*
Ga0105128_1099681	3300009976	Switchgrass Associated	MCVFDAIDDPQFEEQQQDQDFRGPDQQQFEEGKWTPDHVFDP*
Ga0105141_1052631	3300009977	Switchgrass Associated	MCVFGALDDQQFEEQRQDQDFGGPDQQQFEEGKWTLDHVFDP*
Ga0105141_1143171	3300009977	Switchgrass Associated	MCAFGAIDDPQFEEQQQDQGFGGPDQQQFEEGKWTLDHIFDP*
Ga0105135_1150561	3300009980	Switchgrass Associated	MCVFGAIDDPQFEEQQQDQDFGGPDQQQFEEAKWTLDHVSDP*
Ga0105133_1014023	3300009981	Switchgrass Associated	MCLCDAIDDPQFEEQQQDQGFGGPDQQQFEEGKWTLDHAFDP*
Ga0105133_1181861	3300009981	Switchgrass Associated	MCVCDAIDDPQFKELQQDQGFGGPDQQQFEEGKWTLDHVFDP*
Ga0105131_1096951	3300009989	Switchgrass Associated	LVACMCVCDAIDDPQFEEQQQDQGFGGPDQQQFEEGKWTLDHVFDP*
Ga0105131_1316271	3300009989	Switchgrass Associated	MCVFGEIDDPQFEEQQLDQGFGIPDQQQFEEGKWTFDHVFDP*
Ga0105132_1083882	3300009990	Switchgrass Associated	MCVFGAIDDQPFEQQQDQDFGGPDQQQFEEGKWTLDHAFVP*
Ga0105120_10193991	3300009992	Switchgrass Associated	MCVFGAIDDQPFEQQQDQDFGGPDQQQFEEGKWTLDHAFDP*
Ga0105120_10276051	3300009992	Switchgrass Associated	MCVFGALDDQQFEEQQQDQDFGGPDQQQFEEGKWTLDHIFDP*
Ga0105120_10337361	3300009992	Switchgrass Associated	MCVFGAIDDPQFEEQQQDHGFGGPDQQQFEEGKWTLDHVFDP*
Ga0105120_10393961	3300009992	Switchgrass Associated	MCVFDAIDDPQFEEQQQDQDFGGPDQQQFEEGKWTL
Ga0105120_10403631	3300009992	Switchgrass Associated	MCVCNAIDDPQFEQQQDQGFGGLDQQQFEEGKWTLD
Ga0105126_10025512	3300009994	Switchgrass Associated	MCVFGAIDDPQFKEQQQDQDFGGPDQQQFEEGKWTLDHVFDP*
Ga0105126_10353571	3300009994	Switchgrass Associated	MCVFGAIDDPQFEEQQQDQDFGGPDQQQFEEGKWTLD
Ga0105139_10198572	3300009995	Switchgrass Associated	MCVCDAIDDPQFEEQQQDQGFGGPDQQQFEEGKWTLDHVL
Ga0105139_10893671	3300009995	Switchgrass Associated	DDPQFEEQQQDQDFGGPDQQQFEEGKWTLDHVFDP*
Ga0134125_110329111	3300010371	Terrestrial Soil	MCVFGVIDDQQFEEQHQDQDFGGPDQQQFEEGKWTLDHVLTHE
Ga0134122_103225221	3300010400	Terrestrial Soil	MCVFGAIDDQQFEGQQQDQDFGGPDQQQFEEGKWTLDHVFDP*
Ga0134122_107309161	3300010400	Terrestrial Soil	MCVFGAIDDPQFEEQQQDQGFGGPDQQQFEEGKWILDHIFDP*
Ga0134121_114928422	3300010401	Terrestrial Soil	CMCVCDAIDDPQFEEQQQDQGFGGPDQQQFEEGKWTLDHFF*
Ga0134123_125907521	3300010403	Terrestrial Soil	MCVFGAIDDPQFVEQQQDQDFGGPDQQQFEEGKWTLDHAFVP*
Ga0153798_103118341	3300012949	Switchgrass Degrading	MCVFGAIDDQQFEEQHQDQDFGGPDQQQFEEGKWTLDHVFDP*
Ga0163162_131666861	3300013306	Switchgrass Rhizosphere	MCNAIDDPQFEEQQQDQGFGGPDQQQFEEGKWTLDHAFDP*
Ga0163163_129672161	3300014325	Switchgrass Rhizosphere	MCVFGAIDDLQFEEQQQDQDFGGPDQQQFEEGKWTLDHVFDP*
Ga0163163_132643231	3300014325	Switchgrass Rhizosphere	MCVSGAIDDPQFEEQQQDQGFGGPDQQQFEKGKWTLDHVFDP*
Ga0157380_128508971	3300014326	Switchgrass Rhizosphere	VSYCLYLFVCMCVCDAIDDPQFEEQQQDQDFRGPDQQQFEEGKWTLDHAFVP*
Ga0157379_114072892	3300014968	Switchgrass Rhizosphere	MCVFGAIDDPQFEKQQQDQDFGGPDQPQFEEDKWTLDHAFDP*
Ga0157379_117156042	3300014968	Switchgrass Rhizosphere	MCVCDAIDDPQFEEQQQDQDFGGPDQQQFEESKWTLDHVFDP*
Ga0182100_10082291	3300015280	Switchgrass Phyllosphere	MCVFGAIDNPQFEEQQQDQDFGGPDQQQFEEGKWILDHVF
Ga0182100_10789432	3300015280	Switchgrass Phyllosphere	MYVFGAIDDPQFEEQQQDQGFEGPDQQQFEEGKWTLDHIFDP*
Ga0182101_10120331	3300015284	Switchgrass Phyllosphere	MCVFGAIDDPQFEEQQQDQGFEGPDQQQFEEGKWTLDHAFDP*
Ga0182105_10556561	3300015290	Switchgrass Phyllosphere	MCVCDAIYDPQFEEQLQDQGFGGPDQQQFEEGKWTL
Ga0182105_10989371	3300015290	Switchgrass Phyllosphere	VFGAIDGPQFEEQQQDQDFGGPDQQQFEEGKWTFDHAFDP*
Ga0182103_10096981	3300015293	Switchgrass Phyllosphere	MCVFGAIDDPHFEEQQQDLDFGGPDQQQFEEGKWILDHVFDP*
Ga0182103_10688071	3300015293	Switchgrass Phyllosphere	MCVFGAIDDPQFEEQHQDQGFEGPDQQHFEQGKWILDHAFDP*
Ga0182103_10892881	3300015293	Switchgrass Phyllosphere	MCAFGAIDDPQFEEQQQDQDFRGPDQQQFEEGKWTLDHVFDP*
Ga0182103_10938841	3300015293	Switchgrass Phyllosphere	MCVFGAIDDPQFEEQHQDQGFEGPDQQQFEEGKWTLDHAFDP*
Ga0182104_10380511	3300015297	Switchgrass Phyllosphere	DPQFEEQQQDQGFGGPDQQQFEEGKWTLDHVFDP*
Ga0182104_10481021	3300015297	Switchgrass Phyllosphere	MCVFGAINDPQFEEQQQDQGFEGPDQQQFEEGKWTLDHIFDP*
Ga0182184_10330621	3300015301	Switchgrass Phyllosphere	MCVFGAIDDPQFEEQQQDQGFGGPDQQQFEEGKWTLDHVFDP
Ga0182184_10923171	3300015301	Switchgrass Phyllosphere	MCVFGALDGPQFEEQQQDQDFGGPDQQQFEEGKWTLDHTFDP*
Ga0182180_10095561	3300015306	Switchgrass Phyllosphere	MCVCDAIDDPQFEEQQQDQGFEGPDQQQFEEGKWTLDHAF*
Ga0182180_10223072	3300015306	Switchgrass Phyllosphere	MCVFGAIDDPQFEEQQDQDFGGPDQQQFEEGNWTLDHAFVL*
Ga0182098_10566751	3300015309	Switchgrass Phyllosphere	MCDAIDDPQFEEQQQDQGFGGPDQQQFEEGKWTLDHVFDP*
Ga0182098_10605722	3300015309	Switchgrass Phyllosphere	MCVFGAIDDPQFEEQQQDQDFGGPDQQQFEEGKWTLDHVFDP*
Ga0182162_10505431	3300015310	Switchgrass Phyllosphere	MFMCEFGAIDDPQFKEQQQDQDFGGPDQQQFEEGKWTLDHAFDL*
Ga0182162_11221541	3300015310	Switchgrass Phyllosphere	DDQPFEQRQDQDFGGPDQHQFEKGKWTLDHAFDP*
Ga0182182_10318001	3300015311	Switchgrass Phyllosphere	MCAFGAIDDPQFEEQQQDQGFGGPDQQQFEEGKWTFDHAFDP*
Ga0182168_11289471	3300015312	Switchgrass Phyllosphere	GAIDDPRFEKQQQDQDFGGPDQPQFEEDKWTLDHAFDP*
Ga0182164_10884091	3300015313	Switchgrass Phyllosphere	MCVFGAIDDPQFEEQQQDQDFGGPDQQQFEEGKWTLDHVF
Ga0182120_10181482	3300015315	Switchgrass Phyllosphere	MCVFGAIDDPQFEEQQQDQGFGGPDQQQFEEGKWTLDHIFDP*
Ga0182120_11152151	3300015315	Switchgrass Phyllosphere	MCVFAAIDDPQFEEQQVQDFGGPDQQQFEEGKWTLDHVFDP*
Ga0182121_10764981	3300015316	Switchgrass Phyllosphere	CTCVCDAIDDPQFEEQQQDQGFGGPDQQQFEEGKWTLDHVFDP*
Ga0182121_10884662	3300015316	Switchgrass Phyllosphere	MCVFGAIDGPQFEEQQQDQDFGGPDQQHLEEGKWTLDHVFDP*
Ga0182121_11296522	3300015316	Switchgrass Phyllosphere	VFGAIDDPQFEEQQQDQGFEGPDQQQFEEGKWTLDHAF*
Ga0182181_11019612	3300015318	Switchgrass Phyllosphere	VCDAIDDPQFKEQQQDQDFGGPDQQQFEEGKWTLDHVYDP*
Ga0182130_10797071	3300015319	Switchgrass Phyllosphere	MCVCGAIDDPQFEEQQQDQGFGGPDQQQFEEGKWTLDHIFDP*
Ga0182165_10497091	3300015320	Switchgrass Phyllosphere	MCVFGAIDDPQFEEQQQDQGFGGPDQQQFEEGKWTLDHFF*
Ga0182165_11079391	3300015320	Switchgrass Phyllosphere	MCVCDAIDDPQFEEQQQDQGFGGPDQQQFEEGKWTLDH
Ga0182148_11071231	3300015325	Switchgrass Phyllosphere	MCVFGALDYPQFEEQQQDQGFGGMDQQQFEEGKWTLDHVFDP*
Ga0182166_11353411	3300015326	Switchgrass Phyllosphere	MCVFGVIDDPQFEEQQQDQGFEGPDQQQFEEGKWSLDHAFVP*
Ga0182153_10511342	3300015328	Switchgrass Phyllosphere	MCVFGAIDDPQFEGQQQDQGFEGPDQQHCEQGKWTLDHVFCPKQN
Ga0182135_10705791	3300015329	Switchgrass Phyllosphere	MCVFGAIDNPQFEEQQHDQDFRGPDQQQFVEGKWTLDHAFIP*
Ga0182135_10962261	3300015329	Switchgrass Phyllosphere	MCVFGAIDDQQFEEQQQDQDFGGPDQQQFEEGKWTLDHVCDP*
Ga0182152_10415131	3300015330	Switchgrass Phyllosphere	MCVFGAIDDQQFEEQHQDQDFGGPDQQQFEEGKWTLDHIL
Ga0182152_10773161	3300015330	Switchgrass Phyllosphere	VCMCVFGAIDDPQFKEQQQDQDFGGPDQQQFEEGKWTLDHVFDP*
Ga0182152_10849661	3300015330	Switchgrass Phyllosphere	MCVFGAIDGPQFEEQQQDQDFGGPDQQQFEEGKWTLDH
Ga0182152_11316611	3300015330	Switchgrass Phyllosphere	MCVFGAIDDQQYEGQQQDQGFEGMDPQQFEEGKWTLDH
Ga0182152_11565141	3300015330	Switchgrass Phyllosphere	MCVCDAIDDPQFEEQQQDQDFGGPDLQQFEEGKWTLDHVFDP*
Ga0182131_10629031	3300015331	Switchgrass Phyllosphere	MCLCDAIDDPQFEEQQQDQDFGGPDQQQFEEGKWTLDHVFDP*
Ga0182117_10803092	3300015332	Switchgrass Phyllosphere	MCVFGAIDDQQFEEQHQDQDFGGPDQQQFEEGKWTLDH
Ga0182147_10857192	3300015333	Switchgrass Phyllosphere	YCLYLFACMCVCDAIDDPQFEEQQQDQGFGGPDQQQFEEGKWTLDHIFDP*
Ga0182147_11041602	3300015333	Switchgrass Phyllosphere	MCVFGAIDDQPFEQQQDQDFGGLDQQQFEEGKWTLDHAFDL*
Ga0182147_11265172	3300015333	Switchgrass Phyllosphere	CVFGAIDDPQFEEQQDQDFGGPDQQQFEEGNWTLDHAFVL*
Ga0182147_11484601	3300015333	Switchgrass Phyllosphere	MCVFGAIDDPRLEEQQDQDFGGPDQQQFEEGNWTLDHAFDP*
Ga0182132_10658952	3300015334	Switchgrass Phyllosphere	MCLFDAIDDPQFKEQHQDQGFEGPDQQQFEEGKWILDHAFDP
Ga0182132_10788821	3300015334	Switchgrass Phyllosphere	DAIDDPQFEEQQQDQGFGGPDQQQFEEGKWTLDHVFDP*
Ga0182132_11602372	3300015334	Switchgrass Phyllosphere	MCVCDAIDDPQFEEQQQDQDFGGPDQQQFEEGKWTLDHIFDP*
Ga0182116_10335002	3300015335	Switchgrass Phyllosphere	MCVCDAIDDPQFEEQQQDQGFGGPDQQQFEEGKWTLD
Ga0182116_11356251	3300015335	Switchgrass Phyllosphere	FACMCVCDAIDDPQFEEQQQDQGFGGPDQQQFEEGKWTLDHAFVP*
Ga0182150_10221441	3300015336	Switchgrass Phyllosphere	MYVFGAIDDPQFEEQQQEQDFGGPDQQQFEKSKWTLDHVLTH
Ga0182150_10707631	3300015336	Switchgrass Phyllosphere	MCVFGAIDDQPFEQQQDQDFGGPDQQQFEEGKWTLDHVFDP*
Ga0182150_11178671	3300015336	Switchgrass Phyllosphere	MCVCDAIDDPQFEEQQQDQDFGGPDQQQFEEGKWTLDHVF*
Ga0182151_11268402	3300015337	Switchgrass Phyllosphere	MCVFGAIDDQPFEQQQDQDFGGPNQQQFEEGKWTLNHAFVP*
Ga0182149_11087631	3300015339	Switchgrass Phyllosphere	MCVFGAIDDQPFEQRQGQDFGGPDQQQFEKGKWTLEYAFDP*
Ga0182133_10445571	3300015340	Switchgrass Phyllosphere	MCVFGAIDDPQFEEQHQDQGFEGSDQQQFEEGKWTLDHAFDP*
Ga0182115_11923771	3300015348	Switchgrass Phyllosphere	MCVFGAIDDPQFEEQHQDQGFEGSDQQQFEEDKWTLDHAFDP*
Ga0182185_11091521	3300015349	Switchgrass Phyllosphere	MYVFGAIDDPQFEEQLQDQDFGGPDQQQFEEGKWTHDHAFDP*
Ga0182185_12562851	3300015349	Switchgrass Phyllosphere	MCVFGAIDDPQFEEQQQDQDFGGLDQQQFEQGKWILDHVFDP*
Ga0182169_11071911	3300015352	Switchgrass Phyllosphere	MCVFGAIDDQLFEQQQDQDFGGPDQQQFEEGKWTLDHAFDL*
Ga0182169_11528042	3300015352	Switchgrass Phyllosphere	MCVSGAIDNPQFEEQQQDQGFGGPDQQQFEEGKWTLDHVFDP*
Ga0182169_12106461	3300015352	Switchgrass Phyllosphere	MCVFGAIDDQQFEEQHQDQDFGGPDQQQFEEGKWTLDHV
Ga0182179_12266631	3300015353	Switchgrass Phyllosphere	MCVCDAIDDPQFEEQQQDQDFGGPDQQQFEEGKWTLDHAFDP*
Ga0182167_12799561	3300015354	Switchgrass Phyllosphere	MCVCDAIDDPQFEDQQQDQDFGGPDQQQFEEGKWTLDHFFDP*
Ga0182167_12992702	3300015354	Switchgrass Phyllosphere	MCVFGAIDDPQFEEQQHDQGFGGLDQQLFEEGKWTLDHVFDT
Ga0182197_11325981	3300017408	Switchgrass Phyllosphere	MCVFGAIDDQPFAEQQQDQGFGGPDQQQFEEGKWT
Ga0182195_11287461	3300017414	Switchgrass Phyllosphere	MCAFGAIDDPQFEEQQQDQGFGGPDQQQFEEGKWTLDHVFDP
Ga0182195_11735201	3300017414	Switchgrass Phyllosphere	MCVFGAIDDLQFEGQQQDQDFGGPDQQQFEEGKWTLDHAFVPXKHQTN
Ga0182195_12044351	3300017414	Switchgrass Phyllosphere	MCVFGAIDDQPFEQQQDQDFGGPDQQQFEEGKWTLDHVLTHE
Ga0182213_11479461	3300017421	Switchgrass Phyllosphere	MFACMCVFGAIDDPRLEEQQDQDFGGPDQQQFEEG
Ga0182201_10640041	3300017422	Switchgrass Phyllosphere	MCMFGAIDDPQFEEQQQDQGFEGPDQQQFEEGKWTLDHIFNP
Ga0182196_10152332	3300017432	Switchgrass Phyllosphere	MCVSDAIDDPQFEEQQQDQDFGGPDQQQFEEGKWTLDHVFDP
Ga0182194_11153611	3300017435	Switchgrass Phyllosphere	MCGFGAIDGPQCEEQQQDQDFGGPDQQQFEEGKRTL
Ga0182200_10402311	3300017439	Switchgrass Phyllosphere	MCVFGAIDDPQFEEQQQDQDFGGPDQQQFEEGKWTLDHIFDP
Ga0182200_10537051	3300017439	Switchgrass Phyllosphere	MCVFGAIDDPQFVEQQQDQDFGGPGQQQFEEGKWTLDHAFDP
Ga0182200_10853502	3300017439	Switchgrass Phyllosphere	MFGAIDYQQYEGQQQDQGFEGPDQQHFEQGKWTFDHAFDP
Ga0182200_11477721	3300017439	Switchgrass Phyllosphere	MCVFGAIDDQQFEGQQQDQDFGGPDQQQFEEGKWTLDHVFDP
Ga0182198_10249071	3300017445	Switchgrass Phyllosphere	MCVFGAIDDPQFKEQQQDQDFGGPDQQQFEEGKWTLDHVFDP
Ga0182198_11105271	3300017445	Switchgrass Phyllosphere	MCAFGALDDQQFEEQHQDQDFGGPDQQQFEEGKWTLDHVF
Ga0182198_11624202	3300017445	Switchgrass Phyllosphere	MCVFGAIDDQPFEQQQDQDFGGPDQQQFEEGKWTLDHAFVP
Ga0182198_11746031	3300017445	Switchgrass Phyllosphere	MCVFGAIDNPQFEEQQQDQDFGGPDQQQFEEGKWTLDHVFDP
Ga0182211_10900501	3300017694	Switchgrass Phyllosphere	MCVFGAIDDPQFEEEQQDQDFGGPDQQQFEEGKWTLDHVFDP
Ga0207644_103172171	3300025931	Switchgrass Rhizosphere	MCVCDAIDDPQFEEQQQDQGFGGPDQQQFEEGKWTLDHIFDP
Ga0207668_118888512	3300025972	Switchgrass Rhizosphere	YLFACMCVCDAIDDPQFEEQQQDQGFGGPDQQQFEEGKWTLDHIFDP
Ga0207641_118499122	3300026088	Switchgrass Rhizosphere	MCVCDAIDDPQFEEQQQDQGFGGPDQQQFEEGKWTLDHV
Ga0268306_10331451	3300028054	Phyllosphere	FGAIDDQQFEGQQQDQDFGGPDQQQFEEGKWTLDHVFDP
Ga0268342_10453641	3300028062	Phyllosphere	DVIDDPQFEEQQQDQGFGGPDQQQFEEGKWTLDHIFDP
Ga0268340_10808251	3300028064	Phyllosphere	MCVFGAIDDPQFEEQQDQDFGGPDQQQFEEGKWTLDHAFVL
Ga0268353_1184852	3300028149	Phyllosphere	AIDDPQFEEQQQDQGFGGPDQQQFEEGKWTLDHVFDP
Ga0268320_10038822	3300028153	Phyllosphere	MCVCDAIDDPQFEEQQQDQDFGGPDQQQFEEGKWTLDHVFDP
Ga0268266_109228261	3300028379	Switchgrass Rhizosphere	VFGAIDDPQFEEQQQDQDFGGPDQQQFEEGKWTLDHVFDP
Ga0268309_10025241	3300028477	Phyllosphere	MCVCDAIDDPQFEEQQQDQGFGGPDQQQFEEGKWTLDHVLTHEITK
Ga0214493_10300472	3300032465	Switchgrass Phyllosphere	VFGAIDDPQFEEQQQDQGFGGPDQQQFEEGKWTLDHIFDP
Ga0214499_10921132	3300032697	Switchgrass Phyllosphere	VFGAIDDLQFEEQQQDQGFGGSDQQQFEKGKWTLDHIFDP
Ga0314733_11136542	3300032761	Switchgrass Phyllosphere	MFGAIDDPQFEEQQQDQGFEGPDQQQFEEGKWTLDHIFD
Ga0314745_10492261	3300032812	Switchgrass Phyllosphere	MCVFGAIDDPQFEEQQQDQGFEGPDQQQFEEGKWTLDHIFNP
Ga0314750_10720801	3300032914	Switchgrass Phyllosphere	MCVFGAIDDQQFEEQHQDQDFGGPDQQQFEEGKWTLEHILDP
Ga0314761_10760521	3300033526	Switchgrass Phyllosphere	MCVCDAIDDPQFEEQQQDQGFGGPDQQQFEEGKWTLDHVFDP
Ga0314760_11505761	3300033530	Switchgrass Phyllosphere	MCVCDAIDDPQFEEQQQDQGFGGPDQQQFEEGKWTLDHILDP

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign