Basic Information | |
---|---|
Family ID | F053395 |
Family Type | Metagenome |
Number of Sequences | 141 |
Average Sequence Length | 50 residues |
Representative Sequence | VKVPLHSTDDASRLAALLLRRILPVFSVVAPGQPGASPVSVPRGTFTTGS |
Number of Associated Samples | 115 |
Number of Associated Scaffolds | 141 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 59.02 % |
% of genes near scaffold ends (potentially truncated) | 48.94 % |
% of genes from short scaffolds (< 2000 bps) | 76.60 % |
Associated GOLD sequencing projects | 106 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.31 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (75.177 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere (12.057 % of family members) |
Environment Ontology (ENVO) | Unclassified (45.390 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (62.411 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 28.21% β-sheet: 0.00% Coil/Unstructured: 71.79% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.31 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 141 Family Scaffolds |
---|---|---|
PF08811 | DUF1800 | 2.84 |
PF00579 | tRNA-synt_1b | 2.84 |
PF01145 | Band_7 | 2.84 |
PF00115 | COX1 | 2.13 |
PF04166 | PdxA | 2.13 |
PF14748 | P5CR_dimer | 2.13 |
PF07394 | DUF1501 | 2.13 |
PF03551 | PadR | 1.42 |
PF13545 | HTH_Crp_2 | 1.42 |
PF00072 | Response_reg | 1.42 |
PF02616 | SMC_ScpA | 1.42 |
PF13570 | PQQ_3 | 1.42 |
PF01966 | HD | 1.42 |
PF13177 | DNA_pol3_delta2 | 1.42 |
PF10173 | Mit_KHE1 | 1.42 |
PF16916 | ZT_dimer | 0.71 |
PF13517 | FG-GAP_3 | 0.71 |
PF01061 | ABC2_membrane | 0.71 |
PF01258 | zf-dskA_traR | 0.71 |
PF02776 | TPP_enzyme_N | 0.71 |
PF12838 | Fer4_7 | 0.71 |
PF00465 | Fe-ADH | 0.71 |
PF12704 | MacB_PCD | 0.71 |
PF02075 | RuvC | 0.71 |
PF00487 | FA_desaturase | 0.71 |
PF13505 | OMP_b-brl | 0.71 |
PF04962 | KduI | 0.71 |
PF00814 | TsaD | 0.71 |
PF02482 | Ribosomal_S30AE | 0.71 |
PF08239 | SH3_3 | 0.71 |
PF00583 | Acetyltransf_1 | 0.71 |
PF05201 | GlutR_N | 0.71 |
PF01313 | Bac_export_3 | 0.71 |
PF01738 | DLH | 0.71 |
PF13620 | CarboxypepD_reg | 0.71 |
PF07705 | CARDB | 0.71 |
PF02954 | HTH_8 | 0.71 |
PF05147 | LANC_like | 0.71 |
PF01408 | GFO_IDH_MocA | 0.71 |
PF03869 | Arc | 0.71 |
PF00498 | FHA | 0.71 |
PF13450 | NAD_binding_8 | 0.71 |
PF01176 | eIF-1a | 0.71 |
PF12276 | DUF3617 | 0.71 |
PF02687 | FtsX | 0.71 |
PF13577 | SnoaL_4 | 0.71 |
PF13091 | PLDc_2 | 0.71 |
PF00092 | VWA | 0.71 |
PF00034 | Cytochrom_C | 0.71 |
PF02472 | ExbD | 0.71 |
PF02618 | YceG | 0.71 |
PF13435 | Cytochrome_C554 | 0.71 |
PF13174 | TPR_6 | 0.71 |
PF08308 | PEGA | 0.71 |
PF03692 | CxxCxxCC | 0.71 |
PF00133 | tRNA-synt_1 | 0.71 |
PF01578 | Cytochrom_C_asm | 0.71 |
PF13551 | HTH_29 | 0.71 |
PF04456 | DUF503 | 0.71 |
PF07676 | PD40 | 0.71 |
PF01709 | Transcrip_reg | 0.71 |
PF00202 | Aminotran_3 | 0.71 |
PF13365 | Trypsin_2 | 0.71 |
PF00702 | Hydrolase | 0.71 |
PF14520 | HHH_5 | 0.71 |
PF01436 | NHL | 0.71 |
PF03626 | COX4_pro | 0.71 |
PF02646 | RmuC | 0.71 |
PF09586 | YfhO | 0.71 |
PF06792 | UPF0261 | 0.71 |
PF12804 | NTP_transf_3 | 0.71 |
PF01135 | PCMT | 0.71 |
PF00246 | Peptidase_M14 | 0.71 |
PF08241 | Methyltransf_11 | 0.71 |
PF12893 | Lumazine_bd_2 | 0.71 |
PF00364 | Biotin_lipoyl | 0.71 |
PF13847 | Methyltransf_31 | 0.71 |
PF00696 | AA_kinase | 0.71 |
PF13532 | 2OG-FeII_Oxy_2 | 0.71 |
PF13594 | Obsolete Pfam Family | 0.71 |
PF07238 | PilZ | 0.71 |
COG ID | Name | Functional Category | % Frequency in 141 Family Scaffolds |
---|---|---|---|
COG5267 | Uncharacterized conserved protein, DUF1800 family | Function unknown [S] | 2.84 |
COG0162 | Tyrosyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 2.84 |
COG0180 | Tryptophanyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 2.84 |
COG1995 | 4-hydroxy-L-threonine phosphate dehydrogenase PdxA | Coenzyme transport and metabolism [H] | 2.13 |
COG1354 | Chromatin segregation and condensation protein Rec8/ScpA/Scc1, kleisin family | Replication, recombination and repair [L] | 1.42 |
COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 1.42 |
COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 1.42 |
COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 1.42 |
COG0817 | Holliday junction resolvasome RuvABC endonuclease subunit RuvC | Replication, recombination and repair [L] | 0.71 |
COG0848 | Biopolymer transport protein ExbD | Intracellular trafficking, secretion, and vesicular transport [U] | 0.71 |
COG1214 | tRNA A37 threonylcarbamoyladenosine modification protein TsaB | Translation, ribosomal structure and biogenesis [J] | 0.71 |
COG1322 | DNA anti-recombination protein (rearrangement mutator) RmuC | Replication, recombination and repair [L] | 0.71 |
COG1398 | Fatty-acid desaturase | Lipid transport and metabolism [I] | 0.71 |
COG1454 | Alcohol dehydrogenase, class IV | Energy production and conversion [C] | 0.71 |
COG1544 | Ribosome-associated translation inhibitor RaiA | Translation, ribosomal structure and biogenesis [J] | 0.71 |
COG1550 | Stress-induced protein YlxP, DUF503 family | Function unknown [S] | 0.71 |
COG1559 | Endolytic transglycosylase MltG, terminates peptidoglycan polymerization | Cell wall/membrane/envelope biogenesis [M] | 0.71 |
COG1734 | RNA polymerase-binding transcription factor DksA | Transcription [K] | 0.71 |
COG1979 | Alcohol dehydrogenase YqhD, Fe-dependent ADH family | Energy production and conversion [C] | 0.71 |
COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.71 |
COG2518 | Protein-L-isoaspartate O-methyltransferase | Posttranslational modification, protein turnover, chaperones [O] | 0.71 |
COG2519 | tRNA A58 N-methylase Trm61 | Translation, ribosomal structure and biogenesis [J] | 0.71 |
COG3125 | Heme/copper-type cytochrome/quinol oxidase, subunit 4 | Energy production and conversion [C] | 0.71 |
COG3239 | Fatty acid desaturase | Lipid transport and metabolism [I] | 0.71 |
COG3717 | 5-keto 4-deoxyuronate isomerase | Carbohydrate transport and metabolism [G] | 0.71 |
COG4122 | tRNA 5-hydroxyU34 O-methylase TrmR/YrrM | Translation, ribosomal structure and biogenesis [J] | 0.71 |
COG4403 | Lantibiotic modifying enzyme | Defense mechanisms [V] | 0.71 |
COG5441 | ATP-binding helicase-inhibiting domain, Tm-1/UPF0261 family | Defense mechanisms [V] | 0.71 |
COG0060 | Isoleucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.71 |
COG0143 | Methionyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.71 |
COG0217 | Transcriptional and/or translational regulatory protein YebC/TACO1 | Translation, ribosomal structure and biogenesis [J] | 0.71 |
COG0337 | 3-dehydroquinate synthetase | Amino acid transport and metabolism [E] | 0.71 |
COG0361 | Translation initiation factor IF-1 | Translation, ribosomal structure and biogenesis [J] | 0.71 |
COG0371 | Glycerol dehydrogenase or related enzyme, iron-containing ADH family | Energy production and conversion [C] | 0.71 |
COG0373 | Glutamyl-tRNA reductase | Coenzyme transport and metabolism [H] | 0.71 |
COG0495 | Leucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.71 |
COG0525 | Valyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.71 |
COG0533 | tRNA A37 threonylcarbamoyltransferase TsaD | Translation, ribosomal structure and biogenesis [J] | 0.71 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 75.18 % |
Unclassified | root | N/A | 24.82 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000364|INPhiseqgaiiFebDRAFT_104061169 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300000858|JGI10213J12805_10632901 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
3300000956|JGI10216J12902_117994180 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 760 | Open in IMG/M |
3300001213|JGIcombinedJ13530_106389189 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
3300002124|C687J26631_10000269 | All Organisms → cellular organisms → Bacteria | 20714 | Open in IMG/M |
3300002561|JGI25384J37096_10074679 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1236 | Open in IMG/M |
3300002908|JGI25382J43887_10136403 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1261 | Open in IMG/M |
3300004114|Ga0062593_101112562 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
3300004643|Ga0062591_102260891 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
3300005166|Ga0066674_10083932 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1468 | Open in IMG/M |
3300005175|Ga0066673_10318287 | All Organisms → cellular organisms → Bacteria | 908 | Open in IMG/M |
3300005290|Ga0065712_10505470 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis | 646 | Open in IMG/M |
3300005328|Ga0070676_10340303 | Not Available | 1029 | Open in IMG/M |
3300005328|Ga0070676_11002987 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
3300005331|Ga0070670_100301722 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1401 | Open in IMG/M |
3300005332|Ga0066388_101109788 | All Organisms → cellular organisms → Bacteria | 1340 | Open in IMG/M |
3300005333|Ga0070677_10245064 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
3300005333|Ga0070677_10823711 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
3300005336|Ga0070680_101342976 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
3300005338|Ga0068868_100267526 | All Organisms → cellular organisms → Bacteria | 1443 | Open in IMG/M |
3300005347|Ga0070668_100059347 | All Organisms → cellular organisms → Bacteria | 2961 | Open in IMG/M |
3300005347|Ga0070668_100175782 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1746 | Open in IMG/M |
3300005347|Ga0070668_100941908 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
3300005353|Ga0070669_100161050 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus → unclassified Terriglobus → Terriglobus sp. | 1744 | Open in IMG/M |
3300005356|Ga0070674_101207651 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
3300005364|Ga0070673_100835535 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 852 | Open in IMG/M |
3300005367|Ga0070667_101981162 | Not Available | 548 | Open in IMG/M |
3300005400|Ga0066867_10310867 | Not Available | 564 | Open in IMG/M |
3300005455|Ga0070663_100559533 | Not Available | 957 | Open in IMG/M |
3300005455|Ga0070663_100740240 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
3300005456|Ga0070678_100779196 | All Organisms → cellular organisms → Bacteria | 867 | Open in IMG/M |
3300005456|Ga0070678_100957071 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
3300005457|Ga0070662_101920486 | Not Available | 511 | Open in IMG/M |
3300005467|Ga0070706_100400079 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1278 | Open in IMG/M |
3300005518|Ga0070699_100706206 | All Organisms → cellular organisms → Bacteria | 921 | Open in IMG/M |
3300005548|Ga0070665_100465422 | All Organisms → cellular organisms → Bacteria | 1274 | Open in IMG/M |
3300005553|Ga0066695_10111380 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1684 | Open in IMG/M |
3300005598|Ga0066706_10508356 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 959 | Open in IMG/M |
3300005603|Ga0066853_10029986 | All Organisms → cellular organisms → Bacteria | 1905 | Open in IMG/M |
3300005617|Ga0068859_100456046 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1374 | Open in IMG/M |
3300005719|Ga0068861_100939672 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 821 | Open in IMG/M |
3300005840|Ga0068870_11440932 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
3300005843|Ga0068860_100528678 | All Organisms → cellular organisms → Bacteria | 1180 | Open in IMG/M |
3300005938|Ga0066795_10099863 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 863 | Open in IMG/M |
3300005947|Ga0066794_10054008 | Not Available | 1191 | Open in IMG/M |
3300006038|Ga0075365_10424540 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
3300006042|Ga0075368_10014073 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2949 | Open in IMG/M |
3300006051|Ga0075364_10532958 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
3300006177|Ga0075362_10695574 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 530 | Open in IMG/M |
3300006178|Ga0075367_10019606 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3752 | Open in IMG/M |
3300006178|Ga0075367_10067642 | All Organisms → cellular organisms → Bacteria | 2142 | Open in IMG/M |
3300006178|Ga0075367_10127509 | All Organisms → cellular organisms → Bacteria | 1571 | Open in IMG/M |
3300006178|Ga0075367_10429253 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 837 | Open in IMG/M |
3300006237|Ga0097621_102151262 | Not Available | 533 | Open in IMG/M |
3300006796|Ga0066665_10196201 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1564 | Open in IMG/M |
3300006844|Ga0075428_101988587 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
3300006845|Ga0075421_100906465 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp. | 1005 | Open in IMG/M |
3300006853|Ga0075420_100320134 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1344 | Open in IMG/M |
3300006853|Ga0075420_100796866 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
3300006881|Ga0068865_100353935 | All Organisms → cellular organisms → Bacteria | 1190 | Open in IMG/M |
3300006881|Ga0068865_100799349 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
3300006894|Ga0079215_10276422 | All Organisms → cellular organisms → Bacteria | 910 | Open in IMG/M |
3300006894|Ga0079215_10411233 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
3300006894|Ga0079215_11624344 | Not Available | 515 | Open in IMG/M |
3300009038|Ga0099829_10183450 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1686 | Open in IMG/M |
3300009090|Ga0099827_10114049 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2166 | Open in IMG/M |
3300009090|Ga0099827_11158299 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 672 | Open in IMG/M |
3300009551|Ga0105238_12422978 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 560 | Open in IMG/M |
3300009789|Ga0126307_10840044 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp. | 741 | Open in IMG/M |
3300009868|Ga0130016_10443272 | Not Available | 848 | Open in IMG/M |
3300010037|Ga0126304_10940942 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
3300010166|Ga0126306_10595398 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
3300011270|Ga0137391_10244129 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1558 | Open in IMG/M |
3300012208|Ga0137376_10515351 | Not Available | 1037 | Open in IMG/M |
3300012488|Ga0157343_1038740 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300012903|Ga0157289_10125518 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 764 | Open in IMG/M |
3300012903|Ga0157289_10291444 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
3300012906|Ga0157295_10010025 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1659 | Open in IMG/M |
3300013308|Ga0157375_11947456 | Not Available | 698 | Open in IMG/M |
3300015052|Ga0137411_1241308 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 856 | Open in IMG/M |
3300015200|Ga0173480_10060833 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1728 | Open in IMG/M |
3300015371|Ga0132258_11303495 | All Organisms → cellular organisms → Bacteria | 1835 | Open in IMG/M |
3300017792|Ga0163161_11954247 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 522 | Open in IMG/M |
3300018000|Ga0184604_10117662 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 844 | Open in IMG/M |
3300018429|Ga0190272_13012097 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
3300018476|Ga0190274_13398946 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
3300018481|Ga0190271_10066047 | All Organisms → cellular organisms → Bacteria | 3168 | Open in IMG/M |
3300018481|Ga0190271_10103452 | All Organisms → cellular organisms → Bacteria | 2631 | Open in IMG/M |
3300018481|Ga0190271_10283986 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp. | 1707 | Open in IMG/M |
3300018481|Ga0190271_11228964 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis | 871 | Open in IMG/M |
3300021082|Ga0210380_10476279 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
3300023102|Ga0247754_1074013 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp. | 807 | Open in IMG/M |
3300023270|Ga0247784_1214837 | Not Available | 506 | Open in IMG/M |
3300025901|Ga0207688_10071131 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis | 1974 | Open in IMG/M |
3300025903|Ga0207680_11085592 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
3300025907|Ga0207645_10414125 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 907 | Open in IMG/M |
3300025918|Ga0207662_11114033 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 561 | Open in IMG/M |
3300025920|Ga0207649_10978898 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
3300025923|Ga0207681_11870664 | Not Available | 500 | Open in IMG/M |
3300025926|Ga0207659_10062100 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis | 2695 | Open in IMG/M |
3300025926|Ga0207659_10230691 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis | 1493 | Open in IMG/M |
3300025930|Ga0207701_10222734 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis | 1652 | Open in IMG/M |
3300025933|Ga0207706_10376895 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis | 1231 | Open in IMG/M |
3300025937|Ga0207669_10249790 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1320 | Open in IMG/M |
3300025942|Ga0207689_10078689 | All Organisms → cellular organisms → Bacteria | 2710 | Open in IMG/M |
3300025972|Ga0207668_10121592 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis | 1978 | Open in IMG/M |
3300025986|Ga0207658_10094966 | All Organisms → cellular organisms → Bacteria | 2322 | Open in IMG/M |
3300025986|Ga0207658_10611108 | Not Available | 980 | Open in IMG/M |
3300026075|Ga0207708_10049211 | All Organisms → cellular organisms → Bacteria | 3209 | Open in IMG/M |
3300026118|Ga0207675_100056986 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis | 3645 | Open in IMG/M |
3300027882|Ga0209590_10085371 | All Organisms → cellular organisms → Bacteria | 1853 | Open in IMG/M |
3300028379|Ga0268266_10246129 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1652 | Open in IMG/M |
3300028379|Ga0268266_11548370 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 638 | Open in IMG/M |
3300028592|Ga0247822_10080055 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2326 | Open in IMG/M |
3300028784|Ga0307282_10064931 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1650 | Open in IMG/M |
3300028812|Ga0247825_11452609 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 503 | Open in IMG/M |
3300031903|Ga0307407_10532951 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis | 865 | Open in IMG/M |
3300032013|Ga0310906_10632701 | Not Available | 741 | Open in IMG/M |
3300032075|Ga0310890_10521168 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 907 | Open in IMG/M |
3300032211|Ga0310896_10282237 | All Organisms → cellular organisms → Bacteria | 852 | Open in IMG/M |
3300033486|Ga0316624_10111941 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1952 | Open in IMG/M |
3300034257|Ga0370495_0024042 | Not Available | 1818 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 12.06% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.80% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.80% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 7.09% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.38% |
Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 5.67% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.55% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.55% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.55% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 3.55% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.84% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.84% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.13% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.13% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.13% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.13% |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 1.42% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.42% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 1.42% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.71% |
Marine | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine | 0.71% |
Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.71% |
Hydrothermal Vent Plume | Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vent Plume | 0.71% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.71% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.71% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.71% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.71% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.71% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.71% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.71% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.71% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.71% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.71% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.71% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.71% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.71% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.71% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.71% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.71% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.71% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.71% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.71% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.71% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.71% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.71% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.71% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.71% |
Wastewater | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater | 0.71% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000858 | Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
3300001768 | Hydrothermal vent plume microbial communities from the Mid Cayman Rise - Deep Background Supr62 | Environmental | Open in IMG/M |
3300002124 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_3 | Environmental | Open in IMG/M |
3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Host-Associated | Open in IMG/M |
3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
3300005400 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV261 | Environmental | Open in IMG/M |
3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005603 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV61 | Environmental | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300005938 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191 | Environmental | Open in IMG/M |
3300005947 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190 | Environmental | Open in IMG/M |
3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
3300006042 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Host-Associated | Open in IMG/M |
3300006051 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Host-Associated | Open in IMG/M |
3300006177 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Host-Associated | Open in IMG/M |
3300006178 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Host-Associated | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006313 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_2_0770m | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
3300009868 | Activated sludge microbial diversity in wastewater treatment plant from Tai Wan - Bali plant Bali plant | Engineered | Open in IMG/M |
3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012488 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 | Host-Associated | Open in IMG/M |
3300012903 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1 | Environmental | Open in IMG/M |
3300012906 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1 | Environmental | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
3300023102 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S184-509B-5 | Environmental | Open in IMG/M |
3300023270 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L169-409R-5 | Environmental | Open in IMG/M |
3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
3300031918 | III_Fen_N3 coassembly | Environmental | Open in IMG/M |
3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
3300033407 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175 | Environmental | Open in IMG/M |
3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
3300034257 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_02D_17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
INPhiseqgaiiFebDRAFT_1040611692 | 3300000364 | Soil | VVKAPLHSTVDASGLAALLLVQIFPISSLVAPCQSGASPVSV |
JGI10213J12805_106329012 | 3300000858 | Soil | VEVTLHSTSDASRLAALLLPYILPVCAVVAPCQAGASLVSVRRVTSTMDS* |
JGI10216J12902_1179941801 | 3300000956 | Soil | MQAFRTGPLAWPPVVKVWLHSTGDASPLAALRLRQILPVFSVGALAIGASPVSVRRQTFTTG |
JGIcombinedJ13530_1063891892 | 3300001213 | Wetland | VVQVPLHSTDDASRHAALLVVQILPVFSLLAPCDPGASSVSVPQGTCTTDCQRTFGP* |
supr62_10277673 | 3300001768 | Hydrothermal Vent Plume | VVKVRLHSTAAASRLPALLLGHILPVFSLVASYQTGASPVSVPRRTFTTDC* |
C687J26631_1000026912 | 3300002124 | Soil | VVKVPLHSTSDASRLAALLLRQILPVFSVVAPGQPGASLVSVRRGAFTTGC* |
JGI25384J37096_100746791 | 3300002561 | Grasslands Soil | WLHSTGDASPPAALLLAQILPVFSVVAPCPRGASPVSVRRQTFTTGC* |
JGI25382J43887_101364033 | 3300002908 | Grasslands Soil | VVKVWLHSTGDASPPAALLLAQILPVFSVVAPCPRGASPVSVRRQTFTTGC* |
Ga0062593_1011125622 | 3300004114 | Soil | MDVPLHSTDDASRLAALLLPQIFPISSVVAPCQPGATSVSVRRGPSTTGS* |
Ga0062592_1021342791 | 3300004480 | Soil | VSEVRLHSAGDASRLAALLVGHILPVCSLLAPCGTGASPPSVHNEFLRRH* |
Ga0062591_1022608912 | 3300004643 | Soil | MKVPLHSTDDASRRSALLVGRIFPIFFLLAPGSPGASPVSVRRGTFTTDS* |
Ga0066674_100839321 | 3300005166 | Soil | LHSTSDASPPAALLLLQILPVFSVVAPCRRGASLVSVRRQTFTTGC* |
Ga0066673_103182871 | 3300005175 | Soil | LAALLLPQILPVFSVVAPCHRGASPVSVQRQTFTTGCQSLKLVPF* |
Ga0066685_103012482 | 3300005180 | Soil | VVKLQLYSVGDASPLTALLLVQILAIFSLVAPCQRGASPPSVRRWSFTTGR* |
Ga0065712_105054702 | 3300005290 | Miscanthus Rhizosphere | TGDASRLAALLLRRIFPIFSVVAPGQTGASPVSVRRGSSTTSC* |
Ga0065705_109174732 | 3300005294 | Switchgrass Rhizosphere | VVEVRLHSAGAASRLAALLLVQILPVFSLVAPCQPGASPASVPRRTFTTGC* |
Ga0070676_103403032 | 3300005328 | Miscanthus Rhizosphere | MDVPLHSTDDASRLAALLLPQIFPISSVVAPCQPGASSVSVRRG |
Ga0070676_110029871 | 3300005328 | Miscanthus Rhizosphere | VDMQLHSTDEASRLAALLLPRISPISSVVAPGQSGASSVSVRRRMSTADS* |
Ga0070670_1003017222 | 3300005331 | Switchgrass Rhizosphere | MPMPLHSTGDASPLVALLLPQILPVFSVVAPCQWGASPVSVRRGTGITGS* |
Ga0066388_1011097882 | 3300005332 | Tropical Forest Soil | VVKAWLHSTGDASPLAALLLAQILPVFSVVAPCQRGASPVSVRRQTFTTGC* |
Ga0070677_102450642 | 3300005333 | Miscanthus Rhizosphere | VDMQLHSTDEASRLAALLLPRISPISSVVAPGQSGASSVSVRRRMSTADS |
Ga0070677_108237112 | 3300005333 | Miscanthus Rhizosphere | VVKRQLHSAGDASPLAALLLAQILPVFSVVAPCPRGASPVSVRRQTLITGD* |
Ga0070680_1013429762 | 3300005336 | Corn Rhizosphere | VVQVPLHSTGDASRLAALLLPQIFPIFLVVAPGQPGASPVSVQRGTCTTDC* |
Ga0068868_1002675261 | 3300005338 | Miscanthus Rhizosphere | PVVKVPRHSTGDASRRSALLVGRIFPIFSLLAPGSPGASPVSVQRGTFTTDS* |
Ga0070668_1000593474 | 3300005347 | Switchgrass Rhizosphere | MDVPLHSTDDASRLAALLLPQIFPISSVVAPCQPGASSVSVRRGTSTTGS* |
Ga0070668_1001757822 | 3300005347 | Switchgrass Rhizosphere | VKVPLHSTDDASRLAALLLRRILPVFSVVAPGQPGASPVSVPRGTFTTGS* |
Ga0070668_1009419082 | 3300005347 | Switchgrass Rhizosphere | MKMPLHSTNDASRLPALLLGRIFPIFSLVAPCQAGASSVSVRRGTFIADSL* |
Ga0070669_1001610502 | 3300005353 | Switchgrass Rhizosphere | MRVWLQSTGDASPRAALLLAQILPVFSVVAPCPRGASPVSVRRQTLITGD* |
Ga0070674_1012076512 | 3300005356 | Miscanthus Rhizosphere | VVQPPLHSTTDASRLAALLLPQIFPIFLVVAPCDPGASAVSVPRGSSTTGC* |
Ga0070673_1008355352 | 3300005364 | Switchgrass Rhizosphere | WLHSTGDASPGAALLLAQILPVFSVVAPCPRGASPVSVRRQTLITGD* |
Ga0070667_1019811621 | 3300005367 | Switchgrass Rhizosphere | EGPLHSTDDASRRSALLVGRIFPIFFLLAPGSPGASPVSVRRGTFTTGS* |
Ga0070667_1020022471 | 3300005367 | Switchgrass Rhizosphere | VKARLHSANAASRLAALLNAQILPVFSRFAPCDPGASSTSVQRRTFTTGC* |
Ga0066867_103108671 | 3300005400 | Marine | VVKVPLHSSADASRPAALLIGRILPACSLFAPGGAGASALSMLRGTFTTDC* |
Ga0066682_104741522 | 3300005450 | Soil | KQPVVKLQLHSVGDASPLTALLLVQILAIFSLVAPCQRGASPPSVRRWSFTTGR* |
Ga0070663_1005595331 | 3300005455 | Corn Rhizosphere | MELPLHSPGDASRLAALLLRRIFPIFFVVAPCQPGASPGSVRRGSSTTGS* |
Ga0070663_1007402402 | 3300005455 | Corn Rhizosphere | VDMQLHSTDEASRLAALLLPRISPISSVVAPGQSGASSVTVRRRMSTADS* |
Ga0070678_1007791962 | 3300005456 | Miscanthus Rhizosphere | MKVTLHSTSDASRLTALLLRRIFPIFSVVAPGQAGASLVSVRRATFTTDS* |
Ga0070678_1009570711 | 3300005456 | Miscanthus Rhizosphere | VHRRGTLSEQPVVTVPLHSTGDASRVAALLLGRILPVCSLVAPGHAGASPVSVPRG |
Ga0070662_1019204861 | 3300005457 | Corn Rhizosphere | VVQPPLHSTTDASRLAALLLPQIFPIFLVVAPCDPGASAVSVPRGSSTTG |
Ga0070706_1004000791 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | QVPLHSTGDASRLAALLLPQIFPIFLVVAPGQPGASPVSVQRGTCTTDC* |
Ga0070699_1001606462 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | VVKVWLHSTGDASPPAALLLPQILPVFSVVAPCRRGASPVSVRRQTFTTGC* |
Ga0070699_1007062062 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | HSTGDASPLAALLLAQILPVFSVVAPCHRGASPVSVRRPTFTTGC* |
Ga0070665_1004654222 | 3300005548 | Switchgrass Rhizosphere | MELPLHSPGDASRLAALLLRRIFPIFSVVAPCQPDASPGSVRRGSSTTGS* |
Ga0066695_101113803 | 3300005553 | Soil | HSTGDASPGAALLLLQILAVFSVVAPCPRGASPVSVRRQTLTTGCWERVREM* |
Ga0066698_107473692 | 3300005558 | Soil | HSAGAASRLAALLLVQILPVFSLVAPCHPGASPPSVRRWTFTTGC* |
Ga0066706_105083562 | 3300005598 | Soil | QLHSAGDASPLTALLLPQIFPIFSVVAPCHRGASPPSVRRRTFTTGC* |
Ga0066706_107117922 | 3300005598 | Soil | VVKLQLHSAGAASRLAALLLVQILPVFSLVAPCQPGASPPSVRRWTFTTGC* |
Ga0066853_100299861 | 3300005603 | Marine | QPVVKVPLHSSADASRPAALLIGRILPACSLFAPGGAGASALSMLRGTFTTDC* |
Ga0068859_1004560461 | 3300005617 | Switchgrass Rhizosphere | LHSTGDASPPAALLLAQILPVFSLGAPCRRGASPVSVQRQTFITGC* |
Ga0068859_1011569431 | 3300005617 | Switchgrass Rhizosphere | VVKVRLHSARAASRLAASRNAQVLPVFSRFAPGNPGASPASVQRRTFTS |
Ga0068861_1009396721 | 3300005719 | Switchgrass Rhizosphere | VVQSPLHSTTDASRLAALLLPQIFPIFLVVAPCDPGASAVSVPR |
Ga0068870_114409322 | 3300005840 | Miscanthus Rhizosphere | MRVWLQSTGDASPRAALLLAQILPVFSVVAPCPRGASPVSVRRQTFTTAC* |
Ga0068860_1005286782 | 3300005843 | Switchgrass Rhizosphere | VVNVPLHSTGDASRLAALLLRRILPVSIVAPGHAGASPVSVPRGTFTTGC* |
Ga0066795_100998631 | 3300005938 | Soil | VKVRLHSAGAASRLAALLLPQIFPIFSVVAPCQPGAAPASVRRRTFTTGC* |
Ga0066794_100540082 | 3300005947 | Soil | VVNVRLHSAGAASRLAALLLPQIFPIFSVVAPCQPGAAPASVRRRTFTTGC* |
Ga0075365_104245402 | 3300006038 | Populus Endosphere | MEGPLHSTVDASRPAALLLHRIFPIFSVVAPSQPGASPVSVRRGTSTTGS* |
Ga0075368_100140732 | 3300006042 | Populus Endosphere | VKVPLHSSADASRPAALLLGRICPIFGLVAPGEPGASAVSVRRGTFTTGSW* |
Ga0075364_105329582 | 3300006051 | Populus Endosphere | MKVPLHSTDDASRRSALLVGRIFPIFFLLAPGSPGASPVSVRRGTSTT |
Ga0075362_106955741 | 3300006177 | Populus Endosphere | PLHSTNDASRLAALLLGRILPIFSLVAPGQAGASSVSLRRGTFTTASYA* |
Ga0075367_100196063 | 3300006178 | Populus Endosphere | VKVPLHSTADASRLAALLLGRIFPIFSLVAPGEPGASAVSVRRGTFTPDS* |
Ga0075367_100676423 | 3300006178 | Populus Endosphere | MPMPLHSTGDASPLAALLLPQILPVFSVVAPCQWGASPVSVRRGTGITGS* |
Ga0075367_101275091 | 3300006178 | Populus Endosphere | PLHSTGDASRLAALLLRRILPVFSIVAPGHAGASPVSVPRGTFTTGC* |
Ga0075367_104292532 | 3300006178 | Populus Endosphere | VELPLHSTADSSRLAALLLRRILPVSFVVAPCQPGASAVSVRRVSSTTGS* |
Ga0097621_1021512622 | 3300006237 | Miscanthus Rhizosphere | VDMQLHSTTDASRLAALLLPRISPIFLVVAPYHPGASAVSVRRCMST |
Ga0068472_102417192 | 3300006313 | Marine | VQRHSTGAASRLPALLLGHRLPVFSLVASYQTGASPVSVPRQTFTTDC* |
Ga0066665_101962012 | 3300006796 | Soil | VVKVWLHSTSDASPPAALLLLQILPVFSVVAPCRRGASLVSVRRQIFTTAC* |
Ga0075428_1019885872 | 3300006844 | Populus Rhizosphere | VVKVWLHSTGDASPLAALLLAQILPVFSVVAPCQRGASPVSVRRQTFTTGC* |
Ga0075421_1009064651 | 3300006845 | Populus Rhizosphere | LWLHSTGDASSLAALLLHQIFPIFSVVAPWQRGASPISMRRQTFTTDC* |
Ga0075420_1003201342 | 3300006853 | Populus Rhizosphere | VVKRQLHSAGDASPRAALLLLHILPVFSVVAPCPRGASPASVRRWRFTTGC* |
Ga0075420_1007968662 | 3300006853 | Populus Rhizosphere | VNPQLHSTGDASSLASLLLAQILPVFSVVAPCQRGASPVSVRRRGSTTGCKEFRV* |
Ga0068865_1003539352 | 3300006881 | Miscanthus Rhizosphere | MKVPLHSTDDASRRSALLVGRIFPIFFLLAPGSPGASPVSVRRGTFTTGC* |
Ga0068865_1007993492 | 3300006881 | Miscanthus Rhizosphere | MKVPLHSTADASRRSALLVGRIFPIFSLLAPGSAGASPVSVRRGTFITSS* |
Ga0079215_102764222 | 3300006894 | Agricultural Soil | VVKVPLHSTGAASRLTALLLPQIHWVFSVVAPCQPGASPVSVQRGTFTTGC* |
Ga0079215_104112332 | 3300006894 | Agricultural Soil | VEKVPLHSTGAASRLTALLLPQIHWVFSVAAPCQPGASPVSVQRGTFTRLLAQT* |
Ga0079215_116243442 | 3300006894 | Agricultural Soil | QLHSAGDASPRAALLLPQILPVFSVVAPCPRGASPASVRRRRFTTGC* |
Ga0099829_101834501 | 3300009038 | Vadose Zone Soil | STGDASPPAALLLLQILPVFSVVAPCRRDASPVSVRRQTFTTGC* |
Ga0099827_101140492 | 3300009090 | Vadose Zone Soil | HSTGDASPLAALLLPQMLPVFSVVAPCYQNDSPVSVQRQTFTTCC* |
Ga0099827_111582991 | 3300009090 | Vadose Zone Soil | DASPLAALLLPQILPIFSVVAPSHRNASPVSVQRQTFTTGSWGPTKVGPYDASES* |
Ga0066709_1029443561 | 3300009137 | Grasslands Soil | PVVKLQLHSAGAASRLAALLLVQILPVFSLVAPCHPGTSPPSVRRWTFTTGR* |
Ga0105238_124229781 | 3300009551 | Corn Rhizosphere | TGDASRRSALLVGRIFPIFSLLAPGSPGASPVSVQRGTFTTDS* |
Ga0126307_108400442 | 3300009789 | Serpentine Soil | VVNVPLHSTVDASRLAALLLGRIFPIFSVVAPCQPGASPVSVRRGTFT |
Ga0130016_104432721 | 3300009868 | Wastewater | ALHSTGGASRLAALLLPQILAVFSVVAPGQPGAAPVSVRRGTSTTDC* |
Ga0126304_109409423 | 3300010037 | Serpentine Soil | VKVPLHSTDDASRLAALLLPQIFPIFLVVAPGQAGASPVSVPRG |
Ga0126306_105953982 | 3300010166 | Serpentine Soil | MKVPLHSTADASGRSALLVGRIFPIFSLLAPGSTGASSVSVPRGTFITGS* |
Ga0137391_102441291 | 3300011270 | Vadose Zone Soil | TGDASPLAALLLPQILPVFSVVAPCQRGASPVSVLAGTFTTAC* |
Ga0137383_100515341 | 3300012199 | Vadose Zone Soil | MDAVASATTQQPVVKVRLHSAGDASPLTALLLPHIFPICSVVAPCHRGASPPSVRRRTFTTGC |
Ga0137376_105153511 | 3300012208 | Vadose Zone Soil | VNVWLHSTGDASPLAALLLRQMLPVFSVVAPCHRGASPVSVRRQTFTTGC* |
Ga0137377_103858911 | 3300012211 | Vadose Zone Soil | QPVVKLQLHSAGAASRLAALLLVQILPVFSLVAPCQPGASPPSVQRWTFTTGC* |
Ga0157343_10387402 | 3300012488 | Arabidopsis Rhizosphere | VKPWEPVVKVPLHSTDDASHLAALLLRRIFPIFSIVAPCQPGASPVSMRRGTFTTGS* |
Ga0157289_101255181 | 3300012903 | Soil | VVEVPLHSTGDASRLAALLLIQILPVFSIVAPCQPGASPVSVQRGTSTTGC* |
Ga0157289_102914441 | 3300012903 | Soil | VVKVPLHSTGDASRRSALLVGRIFPIFFLLAPGSPGASPVSVRRGTSTTDS* |
Ga0157295_100100251 | 3300012906 | Soil | MDVPLHSTDDASRLAALLLPQIFPISSVVAPCQPGAS |
Ga0157375_119474562 | 3300013308 | Miscanthus Rhizosphere | MDDASRRSALLVGRIFPIFFLLAPGSAGVSPVSVLRGRFTTGCLALH* |
Ga0163163_122168121 | 3300014325 | Switchgrass Rhizosphere | RLHSANAASRLAALLNAQILAVFSRFAPCDPGASSASLQRRTFTTGC* |
Ga0137411_12413081 | 3300015052 | Vadose Zone Soil | QPVVVVKVWLHSTGDASPPAALLLAQILPVFSVVAPCRRGASPVSVRRQTFTTGC* |
Ga0173480_100608332 | 3300015200 | Soil | MKVTLHSTSDASRLTALLLRRIFPIFSVVAPGQAGASLVSVRRATSTTDS* |
Ga0132258_113034952 | 3300015371 | Arabidopsis Rhizosphere | MLKEPVVKVPLHSTDDASRLAALLLPRIFSIFSVVAPCQAGASSVSVRRGTFTTGS* |
Ga0163161_119542471 | 3300017792 | Switchgrass Rhizosphere | LTQQPVVKRPRHSTSDPSRRSALLVGRIFPIFFLLAPGSAGVSPVSVLRGRFTTGCLALH |
Ga0184604_101176621 | 3300018000 | Groundwater Sediment | PAVKVWLHSTGDASSLAALLLAQIFPIFSLVAPCHRGASPGSVRRQTFTTGC |
Ga0190272_130120972 | 3300018429 | Soil | VVKVPLDSTSDASRLAALLLRQILPVFSVVAPGQPGASLVSVRRGTFTTDC |
Ga0190274_133989462 | 3300018476 | Soil | AKVPLHSTADASRLAAFLLGRIFPIVFLVAPGDPGASAVSMRRGIFTTDSSCPLFC |
Ga0190271_100660471 | 3300018481 | Soil | VKVPLHSTDDASRLAALLLPHIFPIFSVVAPCQAGASSVSVPRGTFTTGSYGPTGT |
Ga0190271_101034523 | 3300018481 | Soil | MDMPLHSTADASRLAALLLPRILPIFSVVAPCQSGASAVSVRRCMSTADSSQ |
Ga0190271_102839861 | 3300018481 | Soil | EPVVKVPLHSTDDASRLAALLLPQIFPIFSVVAPCQAGASSVSVPRGTVTTGS |
Ga0190271_112289642 | 3300018481 | Soil | MDVPLHSTDDASRLAALLLPQIFPISSVVAPCQPGASSVSVRRGTSTTGS |
Ga0210380_104762791 | 3300021082 | Groundwater Sediment | VVKAPLHSTVDASRLAALLLVQIFPISSLVAPGHAGASPVSVRRS |
Ga0247754_10740132 | 3300023102 | Soil | VKVPLHSTDDASRLAALLLPQIFPIFSVVAPCQAGASPVSVPRGTVTT |
Ga0247784_12148372 | 3300023270 | Plant Litter | MELPLHSPGDASRLAALLLRRIFPIFFVVAPCQPGASPGSVRRGSSTTGS |
Ga0207688_100711312 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MDVPLHSTDDASRLAALLLPQIFPISSVVAPCQPGATSVSVRRGPSTTGS |
Ga0207680_106027371 | 3300025903 | Switchgrass Rhizosphere | MNSRSRLPAWQPVAKVHLHSPNAASRLAALLNAQILPVFSRLAPGDPGASSASV |
Ga0207680_110855921 | 3300025903 | Switchgrass Rhizosphere | LAKVWLHSTGDASSLAALLLAQIFPIFSVVAPCQRGASPVSVRRQTFTTGC |
Ga0207645_104141253 | 3300025907 | Miscanthus Rhizosphere | MKVTLHSTSDASRLTALLLRRIFPIFSVVAPGQAGASLVSVRRATFTTDS |
Ga0207662_111140331 | 3300025918 | Switchgrass Rhizosphere | MKVTLHSTSDASRLTALLLRRIFPIFSVVAPGQAGASLVSVRRA |
Ga0207649_109788981 | 3300025920 | Corn Rhizosphere | MKVPLHSTDDASRRSALLVGRIFPIFFLLAPGSPGASPVSVRRGTFT |
Ga0207681_118706641 | 3300025923 | Switchgrass Rhizosphere | MKMPLHSTNDASRLPALLLGRIFPIFSLVAPCQAGASSVSVRRGTFIADSL |
Ga0207659_100621002 | 3300025926 | Miscanthus Rhizosphere | MKVPLHSTDDASRRSALLVGRIFPIFFLLAPGSPGASPVSVRRGTFTTDS |
Ga0207659_102306912 | 3300025926 | Miscanthus Rhizosphere | MKVTLHSTSDASRLTALRLRRIFPIFSVVAPGQAGASLVSVRRATFTTDS |
Ga0207701_102227342 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MDVPLHSTDDASRLAALLLPQIFPIFSVVAPCQSGASPVSMRRGSSTTNSCR |
Ga0207706_103768952 | 3300025933 | Corn Rhizosphere | MKVTLHSTSDASRLTALLLRRIFPIFSVVAPGQAGASLVSVRRATSTTDS |
Ga0207669_102497903 | 3300025937 | Miscanthus Rhizosphere | MKMPLHSTNDASRLPALLLGRIFPIFSLVAPCQAGASSVSVRRGTFIA |
Ga0207691_106138402 | 3300025940 | Miscanthus Rhizosphere | MDLLEQPVVKLWLHSAGAASRLAALLVARIFPIFGLLAPCQAGASPASVPRPTFTTGC |
Ga0207689_100786892 | 3300025942 | Miscanthus Rhizosphere | MPMPLHSTGDASPLVALLLPQILPVFSVVAPCQWGASPVSVRRGTGITGS |
Ga0207668_101215923 | 3300025972 | Switchgrass Rhizosphere | MELPLHSPGDESRLAALLLRRIFPIFFVVAPCQPGASPGS |
Ga0207658_100949663 | 3300025986 | Switchgrass Rhizosphere | MKVPLHSTADASRRSALLVGRIFPIFSLLAPGSAGASPVSVRRGTFITSS |
Ga0207658_106111081 | 3300025986 | Switchgrass Rhizosphere | MELPLHSPGDESRLAALLLRRIFPIFFVVAPCQPGASPGSVRRGSSTTGS |
Ga0207708_100492113 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MELPLHSPGDASRLTALLLGQMFPTFSLVAPCQPGASPGSVQRGHSTTDCYP |
Ga0207675_1000569865 | 3300026118 | Switchgrass Rhizosphere | MQLHSTDEASRLAALLLPRISPISSVVAPGQSGASSVSVRRRMSTADS |
Ga0209590_100853711 | 3300027882 | Vadose Zone Soil | VVKVWLHSTSDASPPAALLLLQILPVFSVVAPCRRGASLVSVRRQTFT |
Ga0268266_102461291 | 3300028379 | Switchgrass Rhizosphere | MDRPDWDVTWQPVVKVWLDSTGDASPLTALLLAQIFPISTVVAPCQRGASSVSVRR |
Ga0268266_115483702 | 3300028379 | Switchgrass Rhizosphere | MKVTLHSTSDASRLTALLLRRIFPIFSVVAPGQAGASLVSVR |
Ga0247822_100800551 | 3300028592 | Soil | PDPSAIWEPAVTVPLHSTLDASRRAALLLDRIFPIFSLVAPGPPGASPVSVLRGSVTAGSLPA |
Ga0307282_100649311 | 3300028784 | Soil | STGDASPPAALLLPQILPVFSVVAPCQRGASPVSVLAGTFTTGC |
Ga0247825_114526091 | 3300028812 | Soil | PFVATDDASRLAALLLPQIFPIFSVVAPCQAGASSVSVPRGTFTTGS |
Ga0307407_105329511 | 3300031903 | Rhizosphere | VKLPLHSTGDPSRLAALLLPRMFPIFSVVAPGQSGASPVSMRLG |
Ga0311367_116330291 | 3300031918 | Fen | VVKVRLHSANAASRLAALLNAQILPVFSRFAPGDPGASSASSASVRQRTFTKGCWGLVLVLGAAAS |
Ga0310906_106327011 | 3300032013 | Soil | VKLPLHSTVDASRLAALLLPQIFPIFSVVAPCQAGASSVSVPRGTFTTGS |
Ga0310890_105211681 | 3300032075 | Soil | DASRLTALLLPQILPVFSVVAPGQAGASPVSVQRGTFTPDS |
Ga0310896_102822371 | 3300032211 | Soil | PALHSTSDASPLAALLLPRIFPIFSVVAPGDRGASLVSVRRGGFTTGCKAAAKPMT |
Ga0214472_110288972 | 3300033407 | Soil | VEKVGLHSPNAASRLAALLLGRIQAVFSLVAPCHPGASPGSVQRPTFTTG |
Ga0316624_101119412 | 3300033486 | Soil | VVKVQLHSTGDASRLAALLLPQVFPILSVVAPGQPRASPVSVLTLDFHHGLI |
Ga0370495_0024042_541_696 | 3300034257 | Untreated Peat Soil | VVKLPLHSTSDASRLAALLLSQILPVSSVVAPCQTGASLVSVPRGTFTTGS |
⦗Top⦘ |