NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F053289

Metagenome Family F053289

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F053289
Family Type Metagenome
Number of Sequences 141
Average Sequence Length 48 residues
Representative Sequence EYGCDVTAMVANTGTAMGDSNGYEVTLSAIEAEAPYKLQASVVTSLGI
Number of Associated Samples 116
Number of Associated Scaffolds 141

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Viruses
% of genes with valid RBS motifs 1.42 %
% of genes near scaffold ends (potentially truncated) 95.04 %
% of genes from short scaffolds (< 2000 bps) 82.98 %
Associated GOLD sequencing projects 97
AlphaFold2 3D model prediction Yes
3D model pTM-score0.21

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (68.085 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous
(33.333 % of family members)
Environment Ontology (ENVO) Unclassified
(36.170 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(43.262 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 23.68%    β-sheet: 0.00%    Coil/Unstructured: 76.32%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.21
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 141 Family Scaffolds
PF09206ArabFuran-catal 5.67
PF13392HNH_3 4.26
PF04860Phage_portal 3.55
PF01510Amidase_2 0.71



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms85.82 %
UnclassifiedrootN/A14.18 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000116|DelMOSpr2010_c10109474All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1021Open in IMG/M
3300000117|DelMOWin2010_c10042298All Organisms → Viruses → Predicted Viral2090Open in IMG/M
3300001851|RCM31_10096222All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage561Open in IMG/M
3300002408|B570J29032_109014138Not Available567Open in IMG/M
3300002408|B570J29032_109696107All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1075Open in IMG/M
3300003394|JGI25907J50239_1061643All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage751Open in IMG/M
3300004028|Ga0055447_10292525All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage550Open in IMG/M
3300005954|Ga0073925_1041793All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage515Open in IMG/M
3300005992|Ga0073924_1029105All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage780Open in IMG/M
3300006025|Ga0075474_10008367All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4033Open in IMG/M
3300006025|Ga0075474_10258727All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage522Open in IMG/M
3300006027|Ga0075462_10050506All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1321Open in IMG/M
3300006484|Ga0070744_10171662All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage620Open in IMG/M
3300006637|Ga0075461_10011693All Organisms → Viruses → Predicted Viral2896Open in IMG/M
3300006637|Ga0075461_10246743All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage524Open in IMG/M
3300006802|Ga0070749_10269320Not Available961Open in IMG/M
3300006802|Ga0070749_10351914All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage818Open in IMG/M
3300006802|Ga0070749_10703216All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage540Open in IMG/M
3300006810|Ga0070754_10111787All Organisms → Viruses → Predicted Viral1338Open in IMG/M
3300006867|Ga0075476_10227887All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage671Open in IMG/M
3300006867|Ga0075476_10252124Not Available629Open in IMG/M
3300006867|Ga0075476_10294940All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage570Open in IMG/M
3300006870|Ga0075479_10117136All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1099Open in IMG/M
3300006875|Ga0075473_10015121All Organisms → Viruses → Predicted Viral2976Open in IMG/M
3300006875|Ga0075473_10021644All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2469Open in IMG/M
3300006916|Ga0070750_10327863All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage650Open in IMG/M
3300006919|Ga0070746_10150310All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Staphylococcaceae → Staphylococcus1135Open in IMG/M
3300007234|Ga0075460_10256075Not Available582Open in IMG/M
3300007236|Ga0075463_10198270All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage647Open in IMG/M
3300007344|Ga0070745_1245141Not Available649Open in IMG/M
3300007344|Ga0070745_1334600All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage534Open in IMG/M
3300007345|Ga0070752_1055620All Organisms → Viruses → Predicted Viral1798Open in IMG/M
3300007346|Ga0070753_1077585All Organisms → Viruses → Predicted Viral1320Open in IMG/M
3300007640|Ga0070751_1219489All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage732Open in IMG/M
3300007960|Ga0099850_1333986All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage570Open in IMG/M
3300008107|Ga0114340_1146630All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage876Open in IMG/M
3300008258|Ga0114840_1042598Not Available726Open in IMG/M
3300008266|Ga0114363_1024596All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2612Open in IMG/M
3300008266|Ga0114363_1105400All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1343Open in IMG/M
3300008266|Ga0114363_1182928All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1443Open in IMG/M
3300008448|Ga0114876_1234803All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage585Open in IMG/M
3300009027|Ga0102957_1106121All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage981Open in IMG/M
3300009158|Ga0114977_10127913All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1526Open in IMG/M
3300009164|Ga0114975_10098146All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1695Open in IMG/M
3300009169|Ga0105097_10170105All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1199Open in IMG/M
3300009169|Ga0105097_10808438All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage535Open in IMG/M
3300009181|Ga0114969_10002188All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage16145Open in IMG/M
3300009181|Ga0114969_10736154All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage528Open in IMG/M
3300009183|Ga0114974_10394964Not Available793Open in IMG/M
3300009183|Ga0114974_10547857Not Available643Open in IMG/M
3300009466|Ga0126448_1039428All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1100Open in IMG/M
3300009474|Ga0127390_1027072Not Available1663Open in IMG/M
3300009474|Ga0127390_1164271Not Available559Open in IMG/M
3300010354|Ga0129333_10595717All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage960Open in IMG/M
3300010368|Ga0129324_10289154All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage646Open in IMG/M
3300012266|Ga0136712_1031950All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage603Open in IMG/M
3300012665|Ga0157210_1026705All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage916Open in IMG/M
3300012665|Ga0157210_1069157Not Available533Open in IMG/M
(restricted) 3300013126|Ga0172367_10468228All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage698Open in IMG/M
(restricted) 3300013127|Ga0172365_10339039All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage888Open in IMG/M
3300017707|Ga0181363_1044025Not Available813Open in IMG/M
3300017761|Ga0181356_1017163All Organisms → Viruses → Predicted Viral2683Open in IMG/M
3300017774|Ga0181358_1051628All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1555Open in IMG/M
3300017784|Ga0181348_1276499All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage571Open in IMG/M
3300017967|Ga0181590_10239184All Organisms → Viruses → Predicted Viral1346Open in IMG/M
3300018416|Ga0181553_10242063All Organisms → Viruses → Predicted Viral1025Open in IMG/M
3300018420|Ga0181563_10285465Not Available971Open in IMG/M
3300020524|Ga0208858_1054780Not Available518Open in IMG/M
3300020530|Ga0208235_1008999All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1299Open in IMG/M
3300020532|Ga0208601_1001973All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3286Open in IMG/M
3300020536|Ga0207939_1034586All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage651Open in IMG/M
3300020549|Ga0207942_1003080All Organisms → Viruses → Predicted Viral2646Open in IMG/M
3300020549|Ga0207942_1006162All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1709Open in IMG/M
3300020550|Ga0208600_1036923All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage754Open in IMG/M
3300021373|Ga0213865_10178765All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1066Open in IMG/M
3300021956|Ga0213922_1038945All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1100Open in IMG/M
3300021961|Ga0222714_10599613All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage550Open in IMG/M
3300021962|Ga0222713_10020429All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5579Open in IMG/M
3300021963|Ga0222712_10712586All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage564Open in IMG/M
3300022065|Ga0212024_1079094Not Available585Open in IMG/M
3300022068|Ga0212021_1015435All Organisms → Viruses → Predicted Viral1370Open in IMG/M
3300022071|Ga0212028_1004825All Organisms → Viruses → Predicted Viral1880Open in IMG/M
3300022179|Ga0181353_1145082All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage550Open in IMG/M
3300022198|Ga0196905_1011386All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2929Open in IMG/M
3300022198|Ga0196905_1129977All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage656Open in IMG/M
3300022929|Ga0255752_10243956All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage803Open in IMG/M
3300024346|Ga0244775_10206417All Organisms → Viruses → Predicted Viral1647Open in IMG/M
3300025610|Ga0208149_1072942All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage854Open in IMG/M
3300025630|Ga0208004_1034722All Organisms → Viruses → Predicted Viral1449Open in IMG/M
3300025630|Ga0208004_1108271All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage650Open in IMG/M
3300025646|Ga0208161_1004293All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage6722Open in IMG/M
3300025647|Ga0208160_1123195All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage652Open in IMG/M
3300025655|Ga0208795_1028597All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1774Open in IMG/M
3300025671|Ga0208898_1052196All Organisms → Viruses → Predicted Viral1476Open in IMG/M
3300025732|Ga0208784_1006538All Organisms → cellular organisms → Bacteria4119Open in IMG/M
3300025759|Ga0208899_1019535All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3426Open in IMG/M
3300025769|Ga0208767_1016668All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4246Open in IMG/M
3300025769|Ga0208767_1021222All Organisms → Viruses → Predicted Viral3596Open in IMG/M
3300025815|Ga0208785_1062221All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1007Open in IMG/M
3300025853|Ga0208645_1016979All Organisms → Viruses → Predicted Viral4149Open in IMG/M
3300025889|Ga0208644_1123548All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1230Open in IMG/M
3300025889|Ga0208644_1227995All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage787Open in IMG/M
3300026902|Ga0209851_1015244All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage783Open in IMG/M
3300027147|Ga0255113_1032951All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1054Open in IMG/M
3300027589|Ga0255123_1029682All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1089Open in IMG/M
3300027631|Ga0208133_1002424All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage6101Open in IMG/M
3300027754|Ga0209596_1225841All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage783Open in IMG/M
3300027759|Ga0209296_1091975All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1468Open in IMG/M
3300027772|Ga0209768_10138903All Organisms → Viruses → Predicted Viral1150Open in IMG/M
3300027792|Ga0209287_10271146All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage650Open in IMG/M
3300027804|Ga0209358_10176061All Organisms → Viruses → Predicted Viral1125Open in IMG/M
3300027808|Ga0209354_10233365All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage741Open in IMG/M
3300027963|Ga0209400_1024236All Organisms → Viruses → Predicted Viral3487Open in IMG/M
3300027974|Ga0209299_1014900All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3619Open in IMG/M
3300031539|Ga0307380_10760702All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage806Open in IMG/M
3300031539|Ga0307380_11079536All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage633Open in IMG/M
3300031758|Ga0315907_10213299All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1613Open in IMG/M
3300031772|Ga0315288_10742251Not Available917Open in IMG/M
3300031786|Ga0315908_10233830All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1530Open in IMG/M
3300031787|Ga0315900_10283126Not Available1388Open in IMG/M
3300031787|Ga0315900_10686225Not Available729Open in IMG/M
3300031834|Ga0315290_10568615Not Available986Open in IMG/M
3300032116|Ga0315903_10296577All Organisms → Viruses → Predicted Viral1369Open in IMG/M
3300032116|Ga0315903_10456858All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1022Open in IMG/M
3300032116|Ga0315903_11134680All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage533Open in IMG/M
3300033521|Ga0316616_103672240All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage578Open in IMG/M
3300033984|Ga0334989_0593509All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage533Open in IMG/M
3300034050|Ga0335023_0361996All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage774Open in IMG/M
3300034062|Ga0334995_0114345All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2016Open in IMG/M
3300034066|Ga0335019_0326859All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage955Open in IMG/M
3300034092|Ga0335010_0602135All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage557Open in IMG/M
3300034105|Ga0335035_0035559All Organisms → Viruses → Predicted Viral3315Open in IMG/M
3300034106|Ga0335036_0424977All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage847Open in IMG/M
3300034111|Ga0335063_0443087Not Available645Open in IMG/M
3300034116|Ga0335068_0584285All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage505Open in IMG/M
3300034118|Ga0335053_0374590All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage871Open in IMG/M
3300034121|Ga0335058_0552738All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage648Open in IMG/M
3300034272|Ga0335049_0065826All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2672Open in IMG/M
3300034356|Ga0335048_0108107All Organisms → Viruses → environmental samples → uncultured marine virus1659Open in IMG/M
3300034374|Ga0348335_128819All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage734Open in IMG/M
3300034418|Ga0348337_052680All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1619Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous33.33%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater9.93%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake7.09%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake6.38%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater4.96%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater4.26%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton3.55%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh2.84%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment2.13%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater2.13%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment2.13%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine2.13%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water2.13%
Meromictic PondEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond2.13%
SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sand2.13%
FreshwaterEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater1.42%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater1.42%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient1.42%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine1.42%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil1.42%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.71%
Marine PlanktonEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton0.71%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater0.71%
FreshwaterEnvironmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater0.71%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater0.71%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.71%
Pond WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water0.71%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.71%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000116Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010EnvironmentalOpen in IMG/M
3300000117Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010EnvironmentalOpen in IMG/M
3300001851Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM31, ROCA_DNA206_0.2um_MCP-S_C_3bEnvironmentalOpen in IMG/M
3300002408Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)EnvironmentalOpen in IMG/M
3300003394Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SNEnvironmentalOpen in IMG/M
3300004028Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_CordC_D2EnvironmentalOpen in IMG/M
3300005954Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_21-May-14EnvironmentalOpen in IMG/M
3300005992Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_14-Oct-14EnvironmentalOpen in IMG/M
3300006025Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006027Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300006484Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535EnvironmentalOpen in IMG/M
3300006637Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNAEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01EnvironmentalOpen in IMG/M
3300006867Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300006870Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006875Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300006916Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24EnvironmentalOpen in IMG/M
3300006919Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21EnvironmentalOpen in IMG/M
3300007234Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNAEnvironmentalOpen in IMG/M
3300007236Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNAEnvironmentalOpen in IMG/M
3300007344Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4EnvironmentalOpen in IMG/M
3300007345Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30EnvironmentalOpen in IMG/M
3300007346Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31EnvironmentalOpen in IMG/M
3300007640Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28EnvironmentalOpen in IMG/M
3300007960Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaGEnvironmentalOpen in IMG/M
3300008107Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NAEnvironmentalOpen in IMG/M
3300008258Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample HABS-E2014-0110-3-NAEnvironmentalOpen in IMG/M
3300008266Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300008448Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigsEnvironmentalOpen in IMG/M
3300009027Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MGEnvironmentalOpen in IMG/M
3300009158Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaGEnvironmentalOpen in IMG/M
3300009164Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaGEnvironmentalOpen in IMG/M
3300009169Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015EnvironmentalOpen in IMG/M
3300009181Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaGEnvironmentalOpen in IMG/M
3300009183Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaGEnvironmentalOpen in IMG/M
3300009466Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 2m depth; DNA IDBA-UDEnvironmentalOpen in IMG/M
3300009474Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 3m depth; DNA IDBA-UDEnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300010368Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNAEnvironmentalOpen in IMG/M
3300012266Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA to study Microbial Dark Matter (Phase II) - JTO19cm metaGEnvironmentalOpen in IMG/M
3300012665Freshwater microbial communities from Talbot River, Ontario, Canada - S11EnvironmentalOpen in IMG/M
3300013126 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10mEnvironmentalOpen in IMG/M
3300013127 (restricted)Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 48cmEnvironmentalOpen in IMG/M
3300017707Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.NEnvironmentalOpen in IMG/M
3300017761Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.NEnvironmentalOpen in IMG/M
3300017774Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300017784Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.NEnvironmentalOpen in IMG/M
3300017967Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018416Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018420Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300020524Freshwater microbial communities from Lake Mendota, WI - 16NOV2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020530Freshwater microbial communities from Lake Mendota, WI - 22OCT2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020532Freshwater microbial communities from Lake Mendota, WI - 09NOV2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020536Freshwater microbial communities from Lake Mendota, WI - 02JUN2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020549Freshwater microbial communities from Lake Mendota, WI - 12OCT2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020550Freshwater microbial communities from Lake Mendota, WI - 08OCT2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300021373Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282EnvironmentalOpen in IMG/M
3300021956Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MGEnvironmentalOpen in IMG/M
3300021961Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3DEnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300021963Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657DEnvironmentalOpen in IMG/M
3300022065Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2)EnvironmentalOpen in IMG/M
3300022068Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2)EnvironmentalOpen in IMG/M
3300022071Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v2)EnvironmentalOpen in IMG/M
3300022179Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.NEnvironmentalOpen in IMG/M
3300022198Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300022929Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaGEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300025610Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025630Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025646Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025647Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025655Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025671Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes)EnvironmentalOpen in IMG/M
3300025732Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025759Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes)EnvironmentalOpen in IMG/M
3300025769Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes)EnvironmentalOpen in IMG/M
3300025815Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025853Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes)EnvironmentalOpen in IMG/M
3300025889Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes)EnvironmentalOpen in IMG/M
3300026902Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_14-Oct-14 (SPAdes)EnvironmentalOpen in IMG/M
3300027147Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepC_8hEnvironmentalOpen in IMG/M
3300027589Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepA_8dEnvironmentalOpen in IMG/M
3300027631Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes)EnvironmentalOpen in IMG/M
3300027754Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027759Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027772Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes)EnvironmentalOpen in IMG/M
3300027792Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027804Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027808Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes)EnvironmentalOpen in IMG/M
3300027963Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027974Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300031539Soil microbial communities from Risofladan, Vaasa, Finland - UN-3EnvironmentalOpen in IMG/M
3300031758Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123EnvironmentalOpen in IMG/M
3300031772Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20EnvironmentalOpen in IMG/M
3300031786Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA124EnvironmentalOpen in IMG/M
3300031787Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114EnvironmentalOpen in IMG/M
3300031834Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0EnvironmentalOpen in IMG/M
3300032116Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119EnvironmentalOpen in IMG/M
3300033521Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_BEnvironmentalOpen in IMG/M
3300033984Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Mar2001-rr0030EnvironmentalOpen in IMG/M
3300034050Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07May2013-rr0095EnvironmentalOpen in IMG/M
3300034062Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045EnvironmentalOpen in IMG/M
3300034066Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087EnvironmentalOpen in IMG/M
3300034092Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069EnvironmentalOpen in IMG/M
3300034105Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127EnvironmentalOpen in IMG/M
3300034106Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131EnvironmentalOpen in IMG/M
3300034111Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Oct2011-rr0186EnvironmentalOpen in IMG/M
3300034116Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOREnvironmentalOpen in IMG/M
3300034118Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165EnvironmentalOpen in IMG/M
3300034121Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174EnvironmentalOpen in IMG/M
3300034272Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156EnvironmentalOpen in IMG/M
3300034356Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152EnvironmentalOpen in IMG/M
3300034374Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4)EnvironmentalOpen in IMG/M
3300034418Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOSpr2010_1010947433300000116MarineARVFCIVKDNNDEYWLCGYEYGADVTSMVGNTGTAMGDSVGYEVTLSAIEAQAPYKVQGSVATSLGI*
DelMOWin2010_1004229813300000117MarineMTSETGTAMGDLNGYNFTLSAIEAEQPYKLQGSVVTALGI*
RCM31_1009622223300001851Marine PlanktonVRTNNDEYYLAGKEYGCDVTKMTSNTGTAMGDFAGYDVALSAIEAEAPYKLQSSVVTTLGLS*
B570J29032_10901413823300002408FreshwaterWLVGREYGCDITAMTSETGTAMGDNYGYNFTLSAIESESPYKLQASVVTALSI*
B570J29032_10969610713300002408FreshwaterDNNDAYWLVGNEYGCDVTAMVANSGTAMGDSNGYEVTLSAIEAEAPYKLQSSVVTALGI*
JGI25907J50239_106164313300003394Freshwater LakeYLVGREYGCDVTAKQSGTGTAMGDLNGYDFTLSAIEAEEPFKLQSSVVTALGL*
Ga0055447_1029252513300004028Natural And Restored WetlandsGCDVTSMVGNSGTAMGDSVGYEVTLSAIEGEAPYKVQGSVATSLGI*
Ga0073925_104179313300005954SandMVSNTGTAMGDSTGYEVTLSAIEAEAPFILQGSVVTTLGI*
Ga0073924_102910533300005992SandANTGTAMGDSNGYEVTLSAIEAEAPYKLQSSVVTSLGI*
Ga0075474_1000836793300006025AqueousWLAGNEYGCDITAMTSESGTAMGDVQGYNFTLSAIEAESPYLVQAAVATELGI*
Ga0075474_1025872723300006025AqueousWLAGNEYGCDITAMTSESGTAMGDVQGYNFTLSAIEAESPYLVQAAVATTLGI*
Ga0075462_1005050613300006027AqueousYGCDITAMTSESGTAMGDVQGYNFTLSAIEAESPYLVQSAVATELGI*
Ga0070744_1017166213300006484EstuarineLAQGRVFTIVKTNNDEYWLVGKESGCDVSSMVANTGAAFGDSTGYEITLQSLDIEAPYKLQSSVVTTLGI*
Ga0075461_1001169373300006637AqueousGSEYGCDITAMTSESGTAMGDVQGYNFTLSAIEAESPYLVQAAVATSLGI*
Ga0075461_1024674313300006637AqueousTSMVANTGTAMGDSVGYEVTLSAIEGQPPYKVQGSVATSLGI*
Ga0070749_1026932013300006802AqueousTAMGDNYGYNFTLSAIESEAPYLVQASVVTALSI*
Ga0070749_1035191413300006802AqueousYWLAGNEYGCDITAMTSESGTAMGDVQGYNFTLSAIEAESPYLVQAAVATTLGI*
Ga0070749_1070321623300006802AqueousTDNYWLCGYEHGCDVTSMTAETGTALGDLVGYNITLSAIEQEAPYLVQSAVVTSLGI*
Ga0070754_1011178753300006810AqueousDVTSMTAETGTALGDLVGYNITLSAIEQEAPYLVQSAVVTSLGI*
Ga0075476_1022788713300006867AqueousWLVGNEYGCDVTAMTSETGTAMGDNVGYNVTLSAIEADSPVLVGSAVITELGI*
Ga0075476_1025212423300006867AqueousYEYGCDITSMTAESGAAMGDVQGYNFTLSAIETEAPYLVQSAVVTTLGI*
Ga0075476_1029494013300006867AqueousNTGTAMGDSVGYEVTLSAIEAQAPYKVQGSVATSLGI*
Ga0075479_1011713643300006870AqueousEYGCDITAMTSESGTAMGDVQGYNFTLSAIEAESPYLVQAAVATSLGI*
Ga0075473_1001512163300006875AqueousWLVGNEYGCDVTAMVANSGTAMGDSNGYEVTLSAIEAEAPYKLQSSVVTALGI*
Ga0075473_1002164443300006875AqueousTSMVANTGTAMGDSVGYEVTLSAIEGDAPYKVQGSVATSLGI*
Ga0070750_1032786323300006916AqueousYGCDITAMTSESGTAMGDVQGYNFTLSAIEAESPYLLQAAVATELGI*
Ga0070746_1015031013300006919AqueousNEYGCDITAMTSETGTAMGDLNGYNFTLSAIESESPYKLQGSVVTTLGI*
Ga0075460_1025607523300007234AqueousNYWLAGNEYGCDITAMTSESGTAMGDVQGYNFTLSAIEAESPYLVQAAVATTLGI*
Ga0075463_1019827033300007236AqueousGTALGDLVGYNITLSAIEQEAPYLVQSAVVTSLGI*
Ga0070745_124514113300007344AqueousEYWLAGYEYGCDVTSMVGNTGTAMGDSVGYEVTLSAIESEAPYKVQASVATSLGI*
Ga0070745_133460023300007344AqueousMVANTGTAMGDSVGYEVTLSAIEAQAPYKVQGSVATSLGI*
Ga0070752_105562013300007345AqueousNRVFCIVKDNTDNYWLCGYEHGCDVTSMTAETGTALGDLVGYNITLSAIEQEAPYLVQSAVVTSLGI*
Ga0070753_107758513300007346AqueousYEHGCDVTSMTAETGTALGDLVGYNITLSAIEQEAPYLVQSAVVTSLGI*
Ga0070751_121948923300007640AqueousWLVGNEYGCDVTAMTSETGTAMGDNVGYNVTLSAIEADSPVLVGSGVITELGI*
Ga0099850_133398623300007960AqueousRVFCIVKDNNDEYWLCGYEYGADVTSMVGNTGTAMGDSVGYEVTLSAIEAQAPYKVQGSVATSLGI*
Ga0114340_114663033300008107Freshwater, PlanktonYWLVGNEYGCDVTAMVANSGTAMGDSNGYEVTLSAIEAEAPYKLQSSVVTALGI*
Ga0114840_104259813300008258Freshwater, PlanktonNNANYRLVGKEYGCDITAMTQETGTAMGDNYGYNFTLSAIEAEAPYKLQTAVVTALGI*
Ga0114363_102459643300008266Freshwater, PlanktonVGNEYGCDVTAMVANSGTAMGDSNGYEVTLSAIEAEAPYKLQASVVTALKI*
Ga0114363_110540033300008266Freshwater, PlanktonMTQETGTAMGDNYGYNFTLSAIEAEAPYKLQTAVVTALGI*
Ga0114363_118292813300008266Freshwater, PlanktonTAMVANTGTAMGDSNGYEVTLSAIEAEAPYKLQSSVVTALGI*
Ga0114876_123480313300008448Freshwater LakeTGTAMGDSNGYEVTLSAIEAEAPYKLQSSVVTSLGI*
Ga0102957_110612143300009027Pond WaterAMTAESGTAMGDVQGYNFTLSAIETEAPYLVQAAVVTDLGI*
Ga0114977_1012791313300009158Freshwater LakeSNTGTAMGDSTGYEVTLSAIEAEAPFLLQSSVVTTLGI*
Ga0114975_1009814613300009164Freshwater LakeYWLAGKDLGCDVTAMVSNTGTAMGDSTGYEVTLSAIEAEAPFILQASVVTTLGI*
Ga0105097_1017010533300009169Freshwater SedimentCDVTAMVANTGTAMGDSNGYEVTLSAIEAEAPYKLQSSVVTALGI*
Ga0105097_1080843823300009169Freshwater SedimentVANTGTAMGDSTGYEVTLSAIESEAPYKVQSGVLTTLGI*
Ga0114969_1000218813300009181Freshwater LakeNDEYWLAGKDLGCDVTAMVSNTGTAMGDSTGYEVTLSAIEAEAPFILQASVVTTLGI*
Ga0114969_1073615423300009181Freshwater LakeDLGCDVTAMVSNTGTAMGDSTGYEVTLSAIEAEAPFILQASVVTTLGI*
Ga0114974_1039496433300009183Freshwater LakeGTAMGDSTGYEVTLSAIEAEAPFILQASVVTTLGI*
Ga0114974_1054785733300009183Freshwater LakeAMVSNTGTAMGDSTGYEVTLSAIEAEAPFILQASVVTTLGI*
Ga0126448_103942833300009466Meromictic PondRDNNDGYYLVGNEYGCDLTALTGETGIAMGDLNGYNFTLSAIEAESPYKLQSSVVTSLGI
Ga0127390_102707233300009474Meromictic PondETGIAMGDLNGYNFTLSAIEAESPYKLQSSVVTSLGI*
Ga0127390_116427123300009474Meromictic PondNEYGCDLTALTGETGTAMGDLNGYNFTLSAIEAESPYKLQSSVVTSLGI*
Ga0129333_1059571743300010354Freshwater To Marine Saline GradientGTAMGDSVGYEVTLSAIEAQAPYKVQGSVATSLGI*
Ga0129324_1028915413300010368Freshwater To Marine Saline GradientTAMGDVQGYNFTLSAIEAESPYLVQAAVATTLGI*
Ga0136712_103195023300012266FreshwaterAMVANTGTAMGDSNGYEVTLSAIEAEAPYKLQSSVVTALGI*
Ga0157210_102670513300012665FreshwaterLGCDVTAMVSNTGTAMGDSTGYEVTLSAIEAEAPFILQGSVVTTLGI*
Ga0157210_106915713300012665FreshwaterEYGCDVTAMVANTGTAMGDSNGYEVTLSAIEAEAPYKLQSSVVTALGI*
(restricted) Ga0172367_1046822823300013126FreshwaterFCVVEDNNAIYWLVGKEYGCDITAMTSETGTAMGDNYGYNFTLSAIEAEAPYKLQTAVVTALGI*
(restricted) Ga0172365_1033903943300013127SedimentTAMVANTGTAMGDSNGCEVTLSAIEAEAPYKLQAAVVTSLGI*
Ga0181363_104402513300017707Freshwater LakeEYGCDVTAMVANTGTAMGDSNGYEVTLSAIEAEAPYKLQASVVTSLGI
Ga0181356_101716313300017761Freshwater LakeVTAMVSNTGTAMGDSTGYEVTLSAIEAEAPFILQGSVVTTLGI
Ga0181358_105162813300017774Freshwater LakeEYGCDITAMTSETGTAMGDLNGYNFTLSAIEANEPFKLQSSVVTALAL
Ga0181348_127649923300017784Freshwater LakeRRLSTTKRNELKLLAQGRVFTIVKTNNDEYWLVGKESGCDVSSMVANTGAAFGDSTGYEITLQSLDIEAPYKLQNSVVTTLGL
Ga0181590_1023918413300017967Salt MarshYGCDITAMTAESGTAMGDVQGYNFTLSAIETEAPYLVQSAVVTSLGI
Ga0181553_1024206313300018416Salt MarshGNEYGCDITAMTSESGTAMGDVQGYNFTLSAIEAESPYLVQAAVATTLGI
Ga0181563_1028546543300018420Salt MarshLAGNEYGCDITAMTSESGTAMGDVQGYNFTLSAIEAESPYLVQAAVATTLGI
Ga0208858_105478023300020524FreshwaterNDEYWLAGKDLGCDVTAMVSNTGTAMGDSTGYEVTLSAIEAEAPCILQSSVVTTLGI
Ga0208235_100899913300020530FreshwaterAMVANTGTAMGDSNGYEVTLSAIEAEAPYKLQSSVVTALGI
Ga0208601_100197383300020532FreshwaterGTAMGDSNGYEVTLSAIEAEAPYKLQSSVVTALGI
Ga0207939_103458633300020536FreshwaterMVANTGTAMGDSNGYEVTLSAIEAEAPYKLQASVVTSLGI
Ga0207942_100308053300020549FreshwaterNNDEYWLAGKDLGCDVTAMVSNTGTAMGDSTGYEVTLSAIEAEAPCILQSSVVTTLGI
Ga0207942_100616233300020549FreshwaterDVTAMVANTGTAMGDSNGYEVTLSAIEAEAPYKLQSSVVTALGI
Ga0208600_103692313300020550FreshwaterVGKEYGCDVTAMVANTGTAMGDSNGYEVTLSAIEAEAPYKLQSSVVTALGI
Ga0213865_1017876513300021373SeawaterNEYGCDITAMTSETGTAMGDLNGYNFTLSAIESESPYKLQGSVVTALGI
Ga0213922_103894513300021956FreshwaterLAGKDLGCDVTAMVSNTGTAMGDSTGYEVTLSAMEAEAPYILQSTVVTTLGI
Ga0222714_1059961323300021961Estuarine WaterWLVGKEYGCDLTAKTSETGVAMGDLNGYNFTLSAIEAEEPFKLQTSVVTSLGI
Ga0222713_1002042913300021962Estuarine WaterLVGKEYGCDVTAMVANTGTAMGDSNGYEVTLSAIEAEAPYKLQSSVVTSLGI
Ga0222712_1071258623300021963Estuarine WaterGKESGCDVSSMVANTGAAFGDSTGYEITLQSLDIEAPYKLQSSVVTTLGI
Ga0212024_107909423300022065AqueousYWLAGNEYGCDITAMTSESGTAMGDVQGYNFTLSAIEAESPYLVQAAVATTLGI
Ga0212021_101543553300022068AqueousTSESGTAMGDVQGYNFTLSAIEAESPYLVQAAVATSLGI
Ga0212028_100482513300022071AqueousHGCDVTSMTAETGTALGDLVGYNITLSAIEQEAPYLVQSAVVTSLGI
Ga0181353_114508223300022179Freshwater LakeDANTGTAMGDSNGYEVTLSAIEAEAPYKLQAGVVTTLGI
Ga0196905_101138613300022198AqueousYWLAGYEYGCDVTSMVGNTGTAMGDSVGYEVTLSAIESEAPYKVQASVATSLGI
Ga0196905_112997733300022198AqueousYEYGADVTSMVANTGTAMGDSVGYEVTLSAIEAQAPYKVQGSVATSLGI
Ga0255752_1024395633300022929Salt MarshSESGTAMGDVQGYNFTLSAIEAESPYLVQAAVATTLGI
Ga0244775_1020641743300024346EstuarineRVFTIVKTNNDEYWLVGKESGCDVSSMVANTGAAFGDSTGYEITLQSLDIEAPYKLQSSVVTTLGI
Ga0208149_107294233300025610AqueousGCDVTAMTSETGTAMGDNVGYNVTLSAIEADSPVLVGSGVITELGI
Ga0208004_103472213300025630AqueousAMTSESGTAMGDVQGYNFTLSAIEAESPYLVQAAVATSLGI
Ga0208004_110827123300025630AqueousGSEYGCDITAMTSESGTAMGDVQGYNFTLSAIEAESPYLVQAAVATSLGI
Ga0208161_100429313300025646AqueousGYEYGCDVTSMVGNTGTAMGDSVGYEVTLSAIESEAPYKVQASVATSLGI
Ga0208160_112319513300025647AqueousYGCDITAMTGETGTAMGDLNGYNFTLSAIEAEAPYKLQSSVVTSLGI
Ga0208795_102859713300025655AqueousTSMVANTGTAMGDSVGYEVTLSAIEAQAPYKVQGSVATSLGI
Ga0208898_105219613300025671AqueousVTSMTAETGTALGDLVGYNITLSAIEQEAPYLVQSAVVTSLGI
Ga0208784_100653873300025732AqueousTSMVANTGTAMGDSVGYEVTLSAIEGDAPYKVQGSVATSLGI
Ga0208899_101953583300025759AqueousTAMTSETGTAMGDLNGYNFTLSAIESESPYKLQGSVVTALGI
Ga0208767_101666893300025769AqueousWLAGSEYGCDITAMTSESGTAMGDVQGYNFTLSAIEAESPYLVQSAVATELGI
Ga0208767_102122293300025769AqueousAMTSESGTAMGDVQGYNFTLSAIEAESPYLVQAAVATTLGI
Ga0208785_106222133300025815AqueousDNYWLAGNEYGCDITAMTSESGTAMGDVQGYNFTLSAIEAESPYLVQAAVATELGI
Ga0208645_101697913300025853AqueousEHGCDVTSMTAETGTALGDLVGYNITLSAIEQEAPYLVQSAVVTSLGI
Ga0208644_112354813300025889AqueousGTAMGDSVGYEVTLSAIEAQAPYKVQGSVLTTLGI
Ga0208644_122799533300025889AqueousMTSETGTAMGDLNGYNFTLSAIESESPYKLQGSVVTALGI
Ga0209851_101524433300026902SandANTGTAMGDSNGYEVTLSAIEAEAPYKLQSSVVTSLGI
Ga0255113_103295113300027147FreshwaterVANTGTAMGDSNGYEVTLSAIEAEAPYKLQSSVVTSLGI
Ga0255123_102968233300027589FreshwaterMVANTGTAMGDSNGYEVTLSAIEAEAPYKLQSSVVTSLGI
Ga0208133_100242413300027631EstuarineYWLAGKDLGCDVTAMVSNTGTAMGDSTGYEVTLSAIEAEAPFILQGSVVTTLGI
Ga0209596_122584113300027754Freshwater LakeMVSNTGTAMGDSTGYEVTLSAIEAEAPFILQASVATTLGI
Ga0209296_109197513300027759Freshwater LakeIVKTNNDEYWLAGKDLGCDVTAMVSNTGTAMGDSTGYEVTLSAIEAEAPFILQASVVTTLGI
Ga0209768_1013890313300027772Freshwater LakeNDEYWLAGKDLGCDVTAMVSNTGTAMGDSTGYEVTLSAIEAEAPFILQGSVVTTLGI
Ga0209287_1027114623300027792Freshwater SedimentAYWLVGKEYGCDITAMTTETGTAMGDNYGYNFTLSAIESESPYKLQASVVTALSI
Ga0209358_1017606143300027804Freshwater LakeNSGTAMGDSNGYEVTLSAIEAEAPYKLQSSVVTALAI
Ga0209354_1023336533300027808Freshwater LakeANTGAAFGDSTGYEITLQSLDIEAPYKLQSSVVTTLGL
Ga0209400_102423613300027963Freshwater LakeEYWLAGKDLGCDVTAMVSNTGTAMGDSTGYEVTLSAIEAEAPFILQASVVTTLGI
Ga0209299_101490093300027974Freshwater LakeDEYWLAGKDLGCDVTAMVSNTGTAMGDSTGYEVTLSAIEAEAPFILQASVVTTLGI
Ga0307380_1076070233300031539SoilCDVTAMTSETGTAMGDLNGYNFTLSAIEAEQPYKLQGSVVTTLGI
Ga0307380_1107953623300031539SoilTAMTSETGTAMGDLNGYNFTLSAIEAEQPYKLQGSVVTALGI
Ga0315907_1021329943300031758FreshwaterANTGTAMGDSNGYEVTLSAIEAEAPYKLQSSVVTALGI
Ga0315288_1074225143300031772SedimentDVTAMVSNTGTAMGDSTGYEVTLSAIEAEAPFILQASVATTLGI
Ga0315908_1023383013300031786FreshwaterGTAMGDSNGYEVTLSAIEAEAPYKLQSSVVTSLGI
Ga0315900_1028312643300031787FreshwaterLVGKEYGCDVTAMVANTGTAMGDSNGYEVTLSAIEAEAPYKLQSSVVTALGI
Ga0315900_1068622533300031787FreshwaterDVTAMVANSGTAMGDSNGYEVTLSAIEAEAPYKLQSSVVTALGI
Ga0315290_1056861533300031834SedimentTAMVSNTGTAMGDSTGYEVTLSAIEAEAPFILQASVATTLGI
Ga0315903_1029657713300032116FreshwaterVGYEYGCDVTSMVANTGTAMGDSTGYEVTLSAIESEAPYKVQSGVLTTLGI
Ga0315903_1045685813300032116FreshwaterVGKEYGCDVTAMVANTGTAMGDSNGYEVTLSAIEAEAPYKLQASVVTSLGI
Ga0315903_1113468013300032116FreshwaterREYGCDLTALTGETGTAMGDNVGYNFTLSAIEAEAPYKLQANVVTALGI
Ga0316616_10367224013300033521SoilEYGCDVTAMVANTGTAMGDSNGYEVTLSAIEAEAPYKLQSSVVTALGI
Ga0334989_0593509_411_5333300033984FreshwaterMVANTGTAMGDSTGYEVTLSAIEAEAPFLLQASVVTTLGI
Ga0335023_0361996_50_1723300034050FreshwaterMVSNTGTAMGDSTGYEVTLSAIEAEAPFLVQASVITTLGI
Ga0334995_0114345_1886_20083300034062FreshwaterMVANTGTAMGDSNGYEVTLSAIEAEAPYKLQGSVVTALGI
Ga0335019_0326859_3_1793300034066FreshwaterNNDAYWLVGKEYGCDITAMTSETGTAMGDNYGYNFTLSAIESESPYKLQASVVTALSI
Ga0335010_0602135_445_5553300034092FreshwaterTGTAMGDSTGYEVTLSAIEAEAPFLLQASVVTTLGI
Ga0335035_0035559_3195_33143300034105FreshwaterVSNTGTAMGDSTGYEVTLSAIEAEAPFLLQASVVTTLGI
Ga0335036_0424977_653_8383300034106FreshwaterVKTNHDEYWLAGKDLGCDVTAMVSNTGTAMGDSTGYEVTLSAIEAEAPFLLQASVVTTLG
Ga0335063_0443087_2_1363300034111FreshwaterDVTAMVSNTGTAMGDSTGYEVTLSAIEAEAPCILQSSVVTTLGI
Ga0335068_0584285_297_5033300034116FreshwaterQGRVFTIVKTNNDEYWLVGKESGCDVSSMVANTGAAFGDSTGYEVTLQAMDIEAPYKLQSSVVTTLGL
Ga0335053_0374590_35_1933300034118FreshwaterLVGKEYGCDITAMTSETGTAMGDNYGYNFTLSAIESESPYKLQASVVTALSI
Ga0335058_0552738_2_1423300034121FreshwaterGCDVTAMVSNTGTAMGDSTGYEVTLSAIEAEAPFLLQASVVTTLGI
Ga0335049_0065826_2498_26533300034272FreshwaterVGKEYGCDITAMTTETGTAMGDNYGYNFTLSAIESESPYKLQASVVTALSI
Ga0335048_0108107_1475_16573300034356FreshwaterKTNNDEYWLAGKDLGCDVTAMVSNTGTAMGDSTGYEVTLSAIEAEAPCILQSSVVTTLGI
Ga0348335_128819_572_6943300034374AqueousMTSETGTAMGDNVGYNVTLSAIEADSPVLVGSGVITELGI
Ga0348337_052680_2_2053300034418AqueousGRVFCIVKDNNDDYWLAGYEYGCDVTSMVGNTGTAMGDSVGYEVTLSAIESEAPYKVQASVATSLGI


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.