Basic Information | |
---|---|
Family ID | F053150 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 141 |
Average Sequence Length | 40 residues |
Representative Sequence | VTDKPQEPKQKTPKGLEIPVPKRRDLMDAFRKIVKPPKKP |
Number of Associated Samples | 98 |
Number of Associated Scaffolds | 140 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 19.29 % |
% of genes near scaffold ends (potentially truncated) | 15.60 % |
% of genes from short scaffolds (< 2000 bps) | 80.85 % |
Associated GOLD sequencing projects | 92 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.33 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (75.887 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (31.915 % of family members) |
Environment Ontology (ENVO) | Unclassified (38.298 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (43.262 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 17.65% β-sheet: 8.82% Coil/Unstructured: 73.53% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.33 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 140 Family Scaffolds |
---|---|---|
PF12762 | DDE_Tnp_IS1595 | 60.71 |
PF01476 | LysM | 2.14 |
PF13643 | DUF4145 | 1.43 |
PF01694 | Rhomboid | 1.43 |
PF01471 | PG_binding_1 | 0.71 |
PF09413 | DUF2007 | 0.71 |
PF00753 | Lactamase_B | 0.71 |
PF07883 | Cupin_2 | 0.71 |
PF05157 | T2SSE_N | 0.71 |
PF01527 | HTH_Tnp_1 | 0.71 |
PF00817 | IMS | 0.71 |
PF00398 | RrnaAD | 0.71 |
PF06210 | DUF1003 | 0.71 |
PF07755 | DUF1611 | 0.71 |
PF04209 | HgmA_C | 0.71 |
PF08281 | Sigma70_r4_2 | 0.71 |
PF04029 | 2-ph_phosp | 0.71 |
PF02618 | YceG | 0.71 |
PF01636 | APH | 0.71 |
PF01609 | DDE_Tnp_1 | 0.71 |
PF14579 | HHH_6 | 0.71 |
PF00872 | Transposase_mut | 0.71 |
COG ID | Name | Functional Category | % Frequency in 140 Family Scaffolds |
---|---|---|---|
COG0705 | Membrane-associated serine protease, rhomboid family | Posttranslational modification, protein turnover, chaperones [O] | 1.43 |
COG2045 | Phosphosulfolactate phosphohydrolase or related enzyme | Coenzyme transport and metabolism [H] | 1.43 |
COG0030 | 16S rRNA A1518 and A1519 N6-dimethyltransferase RsmA/KsgA/DIM1 (may also have DNA glycosylase/AP lyase activity) | Translation, ribosomal structure and biogenesis [J] | 0.71 |
COG0389 | Nucleotidyltransferase/DNA polymerase DinP involved in DNA repair | Replication, recombination and repair [L] | 0.71 |
COG1559 | Endolytic transglycosylase MltG, terminates peptidoglycan polymerization | Cell wall/membrane/envelope biogenesis [M] | 0.71 |
COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.71 |
COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.71 |
COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.71 |
COG3367 | Uncharacterized conserved protein, NAD-dependent epimerase/dehydratase family | General function prediction only [R] | 0.71 |
COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.71 |
COG3508 | Homogentisate 1,2-dioxygenase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.71 |
COG4420 | Uncharacterized membrane protein | Function unknown [S] | 0.71 |
COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.71 |
COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.71 |
COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.71 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 82.27 % |
Unclassified | root | N/A | 17.73 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2124908009|FWIRA_GRAM18401BTZ0T | Not Available | 523 | Open in IMG/M |
2162886013|SwBSRL2_contig_8894377 | All Organisms → cellular organisms → Bacteria | 1485 | Open in IMG/M |
2199352025|deepsgr__Contig_134762 | Not Available | 538 | Open in IMG/M |
3300000858|JGI10213J12805_10050255 | Not Available | 584 | Open in IMG/M |
3300000880|AL20A1W_1036577 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3284 | Open in IMG/M |
3300001535|A3PFW1_10102877 | All Organisms → cellular organisms → Bacteria | 2835 | Open in IMG/M |
3300001535|A3PFW1_10391441 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2491 | Open in IMG/M |
3300001538|A10PFW1_11044549 | Not Available | 1967 | Open in IMG/M |
3300001538|A10PFW1_11183087 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1049 | Open in IMG/M |
3300001686|C688J18823_10105547 | All Organisms → cellular organisms → Bacteria | 1957 | Open in IMG/M |
3300002568|C688J35102_119236922 | Not Available | 659 | Open in IMG/M |
3300002568|C688J35102_120816083 | All Organisms → cellular organisms → Bacteria | 1672 | Open in IMG/M |
3300004114|Ga0062593_100366779 | All Organisms → Viruses → Predicted Viral | 1268 | Open in IMG/M |
3300004479|Ga0062595_100235005 | All Organisms → Viruses → Predicted Viral | 1172 | Open in IMG/M |
3300005172|Ga0066683_10463384 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium URHD0059 | 776 | Open in IMG/M |
3300005187|Ga0066675_11210044 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 560 | Open in IMG/M |
3300005337|Ga0070682_101549649 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 571 | Open in IMG/M |
3300005435|Ga0070714_100101243 | All Organisms → cellular organisms → Bacteria | 2538 | Open in IMG/M |
3300005467|Ga0070706_101085027 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
3300005518|Ga0070699_100054909 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3449 | Open in IMG/M |
3300005529|Ga0070741_10540146 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 1049 | Open in IMG/M |
3300005538|Ga0070731_10000206 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 101192 | Open in IMG/M |
3300005552|Ga0066701_10322890 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 957 | Open in IMG/M |
3300005552|Ga0066701_10517200 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium URHD0059 | 737 | Open in IMG/M |
3300005558|Ga0066698_10639818 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 711 | Open in IMG/M |
3300005559|Ga0066700_10050254 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2558 | Open in IMG/M |
3300005985|Ga0081539_10054244 | Not Available | 2239 | Open in IMG/M |
3300006028|Ga0070717_11018863 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium URHD0059 | 754 | Open in IMG/M |
3300006800|Ga0066660_10342306 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 1211 | Open in IMG/M |
3300006918|Ga0079216_10971595 | Not Available | 651 | Open in IMG/M |
3300009012|Ga0066710_103540247 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 590 | Open in IMG/M |
3300009012|Ga0066710_103786902 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
3300009012|Ga0066710_104047522 | Not Available | 548 | Open in IMG/M |
3300009038|Ga0099829_10125929 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2022 | Open in IMG/M |
3300009089|Ga0099828_10231833 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1652 | Open in IMG/M |
3300009090|Ga0099827_10495924 | All Organisms → Viruses → Predicted Viral | 1049 | Open in IMG/M |
3300009137|Ga0066709_100757296 | Not Available | 1403 | Open in IMG/M |
3300009137|Ga0066709_102971853 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
3300009137|Ga0066709_103061793 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
3300009809|Ga0105089_1074177 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
3300009818|Ga0105072_1139329 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
3300009818|Ga0105072_1142823 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
3300009836|Ga0105068_1090418 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
3300009837|Ga0105058_1038607 | All Organisms → cellular organisms → Bacteria | 1048 | Open in IMG/M |
3300009840|Ga0126313_10539620 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → environmental samples → uncultured Rubrobacteraceae bacterium | 936 | Open in IMG/M |
3300009840|Ga0126313_11352062 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
3300010039|Ga0126309_10562131 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
3300010039|Ga0126309_10609941 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
3300010039|Ga0126309_10854636 | Not Available | 599 | Open in IMG/M |
3300010039|Ga0126309_11128130 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
3300010145|Ga0126321_1111636 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 726 | Open in IMG/M |
3300010371|Ga0134125_12763445 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 534 | Open in IMG/M |
3300010373|Ga0134128_12793439 | Not Available | 538 | Open in IMG/M |
3300011003|Ga0138514_100109040 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
3300012003|Ga0120163_1101702 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 629 | Open in IMG/M |
3300012186|Ga0136620_10002528 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 8674 | Open in IMG/M |
3300012189|Ga0137388_10577215 | Not Available | 1045 | Open in IMG/M |
3300012201|Ga0137365_10095540 | All Organisms → cellular organisms → Bacteria | 2237 | Open in IMG/M |
3300012201|Ga0137365_10461832 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 934 | Open in IMG/M |
3300012201|Ga0137365_10850588 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
3300012204|Ga0137374_10000273 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 49304 | Open in IMG/M |
3300012204|Ga0137374_10011042 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 10594 | Open in IMG/M |
3300012204|Ga0137374_10103617 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2674 | Open in IMG/M |
3300012204|Ga0137374_10117733 | All Organisms → cellular organisms → Bacteria | 2452 | Open in IMG/M |
3300012204|Ga0137374_10193425 | All Organisms → cellular organisms → Bacteria | 1760 | Open in IMG/M |
3300012204|Ga0137374_10214784 | All Organisms → Viruses → Predicted Viral | 1643 | Open in IMG/M |
3300012204|Ga0137374_10257944 | All Organisms → Viruses → Predicted Viral | 1457 | Open in IMG/M |
3300012204|Ga0137374_10324491 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Plantibacter → unclassified Plantibacter → Plantibacter sp. MMLR14_011 | 1253 | Open in IMG/M |
3300012204|Ga0137374_10371902 | All Organisms → cellular organisms → Bacteria | 1145 | Open in IMG/M |
3300012204|Ga0137374_10513024 | Not Available | 928 | Open in IMG/M |
3300012204|Ga0137374_10547297 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
3300012204|Ga0137374_11115788 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
3300012206|Ga0137380_11283718 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
3300012207|Ga0137381_10327999 | All Organisms → cellular organisms → Bacteria | 1334 | Open in IMG/M |
3300012208|Ga0137376_11258208 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
3300012209|Ga0137379_11068601 | Not Available | 712 | Open in IMG/M |
3300012209|Ga0137379_11210777 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
3300012211|Ga0137377_10942486 | Not Available | 794 | Open in IMG/M |
3300012211|Ga0137377_11134024 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
3300012285|Ga0137370_10263024 | All Organisms → cellular organisms → Bacteria | 1024 | Open in IMG/M |
3300012354|Ga0137366_10289978 | All Organisms → cellular organisms → Bacteria | 1206 | Open in IMG/M |
3300012354|Ga0137366_10503548 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → unclassified Rubrobacteraceae → Rubrobacteraceae bacterium | 874 | Open in IMG/M |
3300012355|Ga0137369_10634256 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 740 | Open in IMG/M |
3300012356|Ga0137371_10557674 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 882 | Open in IMG/M |
3300012356|Ga0137371_10998099 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
3300012358|Ga0137368_10143036 | Not Available | 1777 | Open in IMG/M |
3300012358|Ga0137368_10156960 | All Organisms → Viruses → Predicted Viral | 1673 | Open in IMG/M |
3300012358|Ga0137368_10345869 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 990 | Open in IMG/M |
3300012358|Ga0137368_10789286 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
3300012360|Ga0137375_10230250 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1728 | Open in IMG/M |
3300012360|Ga0137375_10309696 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1423 | Open in IMG/M |
3300012360|Ga0137375_10692571 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
3300012360|Ga0137375_11083349 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
3300012409|Ga0134045_1013737 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
3300012409|Ga0134045_1013737 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
3300012469|Ga0150984_122603516 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
3300012532|Ga0137373_10785030 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 705 | Open in IMG/M |
3300012532|Ga0137373_10813958 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
3300012532|Ga0137373_11042928 | Not Available | 589 | Open in IMG/M |
3300012684|Ga0136614_10076141 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2544 | Open in IMG/M |
3300012684|Ga0136614_10757709 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 680 | Open in IMG/M |
3300013758|Ga0120147_1000628 | All Organisms → cellular organisms → Bacteria | 15333 | Open in IMG/M |
3300013758|Ga0120147_1035166 | Not Available | 912 | Open in IMG/M |
3300013763|Ga0120179_1060124 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 859 | Open in IMG/M |
3300013768|Ga0120155_1036946 | All Organisms → cellular organisms → Bacteria | 1510 | Open in IMG/M |
3300013772|Ga0120158_10211588 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1002 | Open in IMG/M |
3300014058|Ga0120149_1057379 | All Organisms → cellular organisms → Bacteria | 992 | Open in IMG/M |
3300014827|Ga0120171_1055472 | Not Available | 1174 | Open in IMG/M |
3300017654|Ga0134069_1261931 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
3300017659|Ga0134083_10606515 | Not Available | 501 | Open in IMG/M |
3300017789|Ga0136617_10844827 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
3300018028|Ga0184608_10484496 | Not Available | 530 | Open in IMG/M |
3300018053|Ga0184626_10316392 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
3300018060|Ga0187765_10764020 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
3300018073|Ga0184624_10446331 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
3300018079|Ga0184627_10136961 | All Organisms → cellular organisms → Bacteria | 1297 | Open in IMG/M |
3300018422|Ga0190265_10008205 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 7634 | Open in IMG/M |
3300018422|Ga0190265_10103286 | All Organisms → Viruses → Predicted Viral | 2678 | Open in IMG/M |
3300018468|Ga0066662_10273231 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_61_28 | 1399 | Open in IMG/M |
3300018920|Ga0190273_10190815 | Not Available | 1271 | Open in IMG/M |
3300019888|Ga0193751_1014299 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 4074 | Open in IMG/M |
3300021329|Ga0210362_1009224 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
3300025325|Ga0209341_10070494 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2957 | Open in IMG/M |
3300025327|Ga0209751_11112201 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
3300025929|Ga0207664_10029636 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4170 | Open in IMG/M |
3300025941|Ga0207711_12061523 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 513 | Open in IMG/M |
3300026118|Ga0207675_102110000 | Not Available | 580 | Open in IMG/M |
3300026536|Ga0209058_1362766 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300027561|Ga0209887_1088018 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 635 | Open in IMG/M |
3300027577|Ga0209874_1034555 | All Organisms → Viruses → Predicted Viral | 1370 | Open in IMG/M |
3300027748|Ga0209689_1195743 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
3300027862|Ga0209701_10414967 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD0082 | 747 | Open in IMG/M |
3300027869|Ga0209579_10000047 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 265158 | Open in IMG/M |
3300028712|Ga0307285_10143113 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 652 | Open in IMG/M |
3300031228|Ga0299914_11129882 | Not Available | 631 | Open in IMG/M |
3300031938|Ga0308175_100000034 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 112846 | Open in IMG/M |
3300032069|Ga0315282_10097681 | All Organisms → cellular organisms → Bacteria | 2631 | Open in IMG/M |
3300032770|Ga0335085_10156344 | All Organisms → cellular organisms → Bacteria | 2852 | Open in IMG/M |
3300032955|Ga0335076_10464469 | All Organisms → cellular organisms → Bacteria | 1149 | Open in IMG/M |
3300033233|Ga0334722_10265390 | All Organisms → Viruses → Predicted Viral | 1258 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 31.91% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 9.22% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.09% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.96% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 4.96% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 4.26% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.55% |
Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 2.84% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.84% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.84% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.13% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.13% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.13% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.42% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.42% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.42% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.42% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.42% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.42% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 1.42% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.71% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.71% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.71% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.71% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.71% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.71% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.71% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.71% |
Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.71% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.71% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.71% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.71% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.71% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2124908009 | Soil microbial communities from sample at FACE Site Metagenome WIR_Amb2 | Environmental | Open in IMG/M |
2162886013 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
2199352025 | Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL | Environmental | Open in IMG/M |
3300000858 | Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil | Environmental | Open in IMG/M |
3300000880 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A35-65cm-20A)- 1 week illumina | Environmental | Open in IMG/M |
3300001535 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-PF-15A)- 1 week illumina | Environmental | Open in IMG/M |
3300001538 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-PF 4A)- 1 week illumina | Environmental | Open in IMG/M |
3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009809 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_30_40 | Environmental | Open in IMG/M |
3300009818 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 | Environmental | Open in IMG/M |
3300009836 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20 | Environmental | Open in IMG/M |
3300009837 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 | Environmental | Open in IMG/M |
3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
3300010145 | Soil microbial communities from Hawaii, USA to study soil gas exchange rates - KP-HI-INT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300011003 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015 | Environmental | Open in IMG/M |
3300012003 | Permafrost microbial communities from Nunavut, Canada - A20_80cm_0.25M | Environmental | Open in IMG/M |
3300012186 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ416 (21.06) | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
3300012409 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
3300012684 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06) | Environmental | Open in IMG/M |
3300013758 | Permafrost microbial communities from Nunavut, Canada - A24_65cm_12M | Environmental | Open in IMG/M |
3300013763 | Permafrost microbial communities from Nunavut, Canada - A15_65cm_0M | Environmental | Open in IMG/M |
3300013768 | Permafrost microbial communities from Nunavut, Canada - A35_65cm_0M | Environmental | Open in IMG/M |
3300013772 | Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M | Environmental | Open in IMG/M |
3300014058 | Permafrost microbial communities from Nunavut, Canada - A3_65cm_0.25M | Environmental | Open in IMG/M |
3300014827 | Permafrost microbial communities from Nunavut, Canada - A3_80cm_18M | Environmental | Open in IMG/M |
3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300017789 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06) | Environmental | Open in IMG/M |
3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
3300021329 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.625 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025325 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 (SPAdes) | Environmental | Open in IMG/M |
3300025327 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1 (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
3300027561 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 (SPAdes) | Environmental | Open in IMG/M |
3300027577 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 (SPAdes) | Environmental | Open in IMG/M |
3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300028712 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139 | Environmental | Open in IMG/M |
3300031228 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 | Environmental | Open in IMG/M |
3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
3300032069 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_20 | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
FWIRA_09676070 | 2124908009 | Soil | MAGKSQEPKQTTPKGLEIPVPKRSEVMDAFRKIIKPKPKG |
SwBSRL2_0247.00000600 | 2162886013 | Switchgrass Rhizosphere | MSEKPKQKTPKGLEIPVPKRKEVMDALRKLVQPAKKP |
deepsgr_02183460 | 2199352025 | Soil | MSGKPQQPAKTQRTDKGLEIPVPKRKEVMDAFRKIVHAPPKKR |
JGI10213J12805_100502552 | 3300000858 | Soil | VTDKPQEPKQKTSKGLEVPVPKRREFMDALRKIAKPKKG* |
AL20A1W_10365775 | 3300000880 | Permafrost | VTEKPQEPKQTTPKGLEIPVPKRRDLMAAFKKIIQPVKKP* |
A3PFW1_101028775 | 3300001535 | Permafrost | MAGNKQEPTQRTPKGLEIPVPTRESIFTAFKKIVQPVKKKP* |
A3PFW1_103914412 | 3300001535 | Permafrost | MTGKDQKPIQRTPKGLEIPVPKRKDLMDAFRKIVQPAKKP* |
A10PFW1_110445493 | 3300001538 | Permafrost | MTDKPQEPTQKTPKGLEIPVPTRESIFSALRKVIKPVKKS* |
A10PFW1_111830872 | 3300001538 | Permafrost | VTDKPQEPTQKTAKGLEIPVPKRRDLMDAFKKLVQPVKKP* |
C688J18823_101055473 | 3300001686 | Soil | MADEPKQTTPKGLEIPVPKRRDVMDALKKLVQPIKKH* |
C688J35102_1192369222 | 3300002568 | Soil | MAGKEQEPKQITPKGLEIPVPKRKDLMDSFRKIVGPVKKK* |
C688J35102_1208160832 | 3300002568 | Soil | MAGKDNEPKQTTPKGLQIPVRSRGEIMDAFKKIAKPKKP* |
Ga0062593_1003667793 | 3300004114 | Soil | VTDKPQEPTQKTPKGLEIPVPTRESIFSALRKVIKPAKKP* |
Ga0062595_1002350052 | 3300004479 | Soil | MAGKKQEPTTQRTPKGLEIPVPTRGSVFKAFQKIVGKPQKGR* |
Ga0066683_104633841 | 3300005172 | Soil | VTDKPQEPTQKTPKGLEIPVPKRKDLMDAFRKIVGAPAKKP* |
Ga0066675_112100442 | 3300005187 | Soil | VTADKPREPTQRTPKGLEIPVPKRKDLMDAFRKIVGAPPKKP* |
Ga0070682_1015496492 | 3300005337 | Corn Rhizosphere | MAEKPPHGEPTQTTPKGLEIPVPKRKDLMEALRKIVHAPKKS* |
Ga0070714_1001012432 | 3300005435 | Agricultural Soil | MADKEQPAPTQRTPKGLEIPVPKRRDLMDAFRKIVHAPKKP* |
Ga0070706_1010850272 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MADKPQEPKQTTPKGLEIPVPKRREIMDAFRKIIKPAKPKV* |
Ga0070699_1000549093 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MADKPQEPKQKTPKGLEIPVPTRESIFAALRKIAKPVKKP* |
Ga0070741_105401462 | 3300005529 | Surface Soil | MASKDQEPTQRTPKGLEIPVPKRREVLDGLRKLMQPVKKKP* |
Ga0070731_1000020689 | 3300005538 | Surface Soil | VKRSPQPPAETQRTPKGLEIPVPKRTDVLDALRKLVQPKKG* |
Ga0066701_103228902 | 3300005552 | Soil | VAEKPEEPKQKTPKGLEIPVPKRKDLMDAFRKIVQPVKKQP* |
Ga0066701_105172002 | 3300005552 | Soil | VSDKPQEPTQKTPKGLEIPVPSRESIFAALRKIAKPAKKP* |
Ga0066698_106398182 | 3300005558 | Soil | MAGNKQEPTQRTPKGLEIPVPKRRDLMNAFRKIVGAPVKKP* |
Ga0066700_100502542 | 3300005559 | Soil | MADKPQEPKQTTPKGLEIPVPKRRDVMAALRKLVQPVKKP* |
Ga0081539_100542443 | 3300005985 | Tabebuia Heterophylla Rhizosphere | VTKQPQEPKQTTRKGLEIPVPKRRDLMADIRKLIKPAPKKP* |
Ga0070717_110188631 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | QPATEPTQKTPKGLEIPVPKRRDLMDAFRKIVGAPAKKQP* |
Ga0066660_103423062 | 3300006800 | Soil | MSEKPKEPAATQRTPKGLEIPVPKRRDVLEALRKLIQPARKP* |
Ga0079216_109715952 | 3300006918 | Agricultural Soil | VSDKSQEPKQTTPKGLEIPVPKRREVIDALGTLIQPARKP* |
Ga0066710_1035402472 | 3300009012 | Grasslands Soil | MGDKPQEPKQKAPKGLETPVPKRRELMDAFRKIVGAPTKKP |
Ga0066710_1037869021 | 3300009012 | Grasslands Soil | MADKPQEPKQTTPKGLEIPVPKRKELMDAFKRIAGTVKKS |
Ga0066710_1040475222 | 3300009012 | Grasslands Soil | MSGKRQQPADTQRTPKGLEIPVPKRKEVMDAFRKIIKPTKEA |
Ga0099829_101259292 | 3300009038 | Vadose Zone Soil | VTDKPQEPTQKTPKGLEIPVPKREAIFDALRKVIKPVKKP* |
Ga0099828_102318334 | 3300009089 | Vadose Zone Soil | VTDKPQEPTQKTPKGLEIPVPKREAIFDALRKVIKPVK |
Ga0099827_104959241 | 3300009090 | Vadose Zone Soil | VTDKPQEPLQKTPKGLEIPVPKRKELMDAFRKIVGAPVKKQP* |
Ga0066709_1007572963 | 3300009137 | Grasslands Soil | MSGKRQQPADTQRTPKGLEIPVPKRKEVMDAFRKIIKPTK |
Ga0066709_1029718532 | 3300009137 | Grasslands Soil | MTDKPQEPKQTTPKGLEIPVPKRREVMDAFRKIIRTAKPKARAAS* |
Ga0066709_1030617931 | 3300009137 | Grasslands Soil | SNEPKQKTPKGLEIPVPKRRDLMDAFRKIVGPVKKPKS* |
Ga0105089_10741772 | 3300009809 | Groundwater Sand | VPDKPQEPKQKTPKGLDIPVPKRRDVMDALRKIVRPAKKP* |
Ga0105072_11393291 | 3300009818 | Groundwater Sand | KSQEPKQKTPKGLEIPVPKRKELMDAFRKIVGAPGKKQP* |
Ga0105072_11428231 | 3300009818 | Groundwater Sand | VTDKPQEPKQKTPKGLDIPVPKRKDIMDALRRVARPVKKKG* |
Ga0105068_10904182 | 3300009836 | Groundwater Sand | MSDKQPPESAGPKQTTPKGLEIPVPKHREVMDALRKLAQPVKRKS* |
Ga0105058_10386072 | 3300009837 | Groundwater Sand | VADKSQEPKQKTPKGLEIPVPKRKELMDAFRKIVGAPGKKQP* |
Ga0126313_105396203 | 3300009840 | Serpentine Soil | VTDKPQDPKQKTPKGLEIPVPKRREVMDAFRKIIRPAKKS* |
Ga0126313_113520622 | 3300009840 | Serpentine Soil | VTEQPQEPKQKTPRGLEIPVPKRKDVMDAFRKIAGKPPKKP* |
Ga0126309_105621311 | 3300010039 | Serpentine Soil | VTDKSQEPKQTTPKGLEIPVPKRRDVMDALKKLVQPAKKS* |
Ga0126309_106099412 | 3300010039 | Serpentine Soil | EPKQTTPKGLEIPVPKRKKVMDDLRKLVQPVKKS* |
Ga0126309_108546362 | 3300010039 | Serpentine Soil | MTDKPQEPKQKTPKGLEIPVPKRSEVLDAFKKIVRAPKR* |
Ga0126309_111281301 | 3300010039 | Serpentine Soil | VAGKEQESKQKTPKGLEIPVPKRSDVMEAFRKIVRPAKPKG* |
Ga0126321_11116361 | 3300010145 | Soil | SPRMSDSGQEPKQKTPKGLEIPVPKRKDVLDALRKGIQPKKK* |
Ga0134125_127634451 | 3300010371 | Terrestrial Soil | VTDKPQEPTQKTPKGLEIPVPKRSEVTDALDKIAKPKPKNEPPKGDGG* |
Ga0134128_127934392 | 3300010373 | Terrestrial Soil | MSDKPQEPKQTTPKGLEIPVPKRSEVMDFFRKVTKPKKP |
Ga0138514_1001090403 | 3300011003 | Soil | MASKSEESTQVTPKGLEIPVPKRVELMDAFKKLIQPKKS* |
Ga0120163_11017022 | 3300012003 | Permafrost | MAGKDQEPTQRTAKGLEIPVPSRESIFAAFKKIVQPVKKKP* |
Ga0136620_100025288 | 3300012186 | Polar Desert Sand | MSGKPQEQPTETQRTRKGYEIPVPKRKELMDAFRKIVAPVKKRP* |
Ga0137388_105772152 | 3300012189 | Vadose Zone Soil | MTDKPQEPTQKTPKGLEIPVPKRKELMDAFRKIVGAPVKKQP* |
Ga0137365_100955402 | 3300012201 | Vadose Zone Soil | VTDKPQDEPKQKTPKGLEIPVPKRSEIMDAFKKIVRPAKP* |
Ga0137365_104618322 | 3300012201 | Vadose Zone Soil | VTDKPQEPTQKTPKGLEIPVPKRKDLMDAFRKIVGPVKKQP* |
Ga0137365_108505882 | 3300012201 | Vadose Zone Soil | MADKPQQPKQTTPKGLEIPVPKRKELMDAFKRIVGPVKKP* |
Ga0137374_100002739 | 3300012204 | Vadose Zone Soil | MSDKPQEPKQKTPKGLEIPIPKRKDVMAALKKIAKPKA* |
Ga0137374_1001104212 | 3300012204 | Vadose Zone Soil | MAEKPQEPQQTTPKGLEIPVPKRRDLMDAFRKAIKPVKKP* |
Ga0137374_101036173 | 3300012204 | Vadose Zone Soil | VTDKPQEPKQKTPEGLEIPIPKRSEVMDAFRKIIRPVKPKG* |
Ga0137374_101177333 | 3300012204 | Vadose Zone Soil | VAHKPQEPTQKTPKGLEIPIPKRKELMDAFRKIVGAPVKKQP* |
Ga0137374_101934252 | 3300012204 | Vadose Zone Soil | VSEKSQEPKQTTPKGLEIPVPKRKELMDAFRKIIGPPVKKQP* |
Ga0137374_102147844 | 3300012204 | Vadose Zone Soil | VADKTQEPKQKTDKGLEIPVPKRKDLLDAFRKVVKPVKKP* |
Ga0137374_102579442 | 3300012204 | Vadose Zone Soil | MAGKEQEPTQRTPKGLEIPVPTRESIFAAFKKIVQPVKKKP* |
Ga0137374_103244912 | 3300012204 | Vadose Zone Soil | MVDKPKEPKQTTPKGLEIPVPKRKELMDAFRKIVRAPKKS* |
Ga0137374_103719021 | 3300012204 | Vadose Zone Soil | VTDKSQEPTQKTPKGLEIPVPKRKDLMDAFRKIVGAPAKKQP* |
Ga0137374_105130242 | 3300012204 | Vadose Zone Soil | MAGKEQEPTQKTPKGLEIPVPKRKELMDAFRKIVGAPVKKP* |
Ga0137374_105472971 | 3300012204 | Vadose Zone Soil | VIDKPQEPKQKTPKGLEIPVPKRSEVMDAFKKIVRAPKR* |
Ga0137374_111157882 | 3300012204 | Vadose Zone Soil | MSAKDQPASDQPKQTTAKGLEIPVPKRKDLMDAFRKIVGPVKKP* |
Ga0137380_112837182 | 3300012206 | Vadose Zone Soil | MSDKPQEPTQKTPKGLEIPIPSRESIFSALRKIAKPIKKP* |
Ga0137381_103279992 | 3300012207 | Vadose Zone Soil | VTDKPQEPKQKTPKGLEIPVPKRKEVMAAFRKIVGAPKKPGA* |
Ga0137381_117432382 | 3300012207 | Vadose Zone Soil | MADKPQEPKQITPKGLEIPVPKRSEVMDAFRKILRPAKPKD* |
Ga0137376_112582083 | 3300012208 | Vadose Zone Soil | PQDEPKQKTPKGLEIPGPKRKDVTAALRKLVQPAKKP* |
Ga0137379_110686011 | 3300012209 | Vadose Zone Soil | MNGKRQQPDDTQRTPKGLEIPVPKRKDIMDAFRKI |
Ga0137379_112107772 | 3300012209 | Vadose Zone Soil | MTDKPQEPKQKTPKGLEIPVPRRKDLMDAFRKIVGAPAKKP* |
Ga0137377_109424861 | 3300012211 | Vadose Zone Soil | MTGKEQEPVQDQPTQKTPKGLEIPLPKRDSIFDALRKVIKPAKKP* |
Ga0137377_111340242 | 3300012211 | Vadose Zone Soil | MSDKPQEPKQKTPKGLEIPVPKRKDVMDALRKLVQPVKKP* |
Ga0137370_102630241 | 3300012285 | Vadose Zone Soil | VTDKPQEPKQKTPKGLEIPVPKRRDLMDAFRKIIHAPRKP* |
Ga0137366_102899781 | 3300012354 | Vadose Zone Soil | TQVTPKDLEIPVPKRKDQMYAFRKIVGAPVKKRP* |
Ga0137366_105035482 | 3300012354 | Vadose Zone Soil | VTDKPQEPTQQTPKGLEILVPRRRDLMDAFRKIVRPVKKQP* |
Ga0137369_106342562 | 3300012355 | Vadose Zone Soil | VTDKPQEPKQKTPKGLEIPVPKRRDLMDAFRKIVKPPKKP* |
Ga0137371_105576742 | 3300012356 | Vadose Zone Soil | MAKEQPKQRTPKGLEIPVPKRKDVMDALRKLVQPTKKP* |
Ga0137371_109980992 | 3300012356 | Vadose Zone Soil | SDEPKQTTPKGLEIPVPKRRDLMDAFRKIVGAPPKKP* |
Ga0137368_101430361 | 3300012358 | Vadose Zone Soil | VTDKPQEPKQKTPKGLEIPVPKRRDLMDAFRKVIKPVKKP* |
Ga0137368_101569602 | 3300012358 | Vadose Zone Soil | VTDKPQEPTQKTPKGLEIPVPKRKELMDAFRKIVGAPKKP* |
Ga0137368_103458692 | 3300012358 | Vadose Zone Soil | VTDKPQEPKQKTPKGLEIPVPKRREFMYALRKIIGPANPKG* |
Ga0137368_107892862 | 3300012358 | Vadose Zone Soil | MANDDKPEPKQKTAKGLEIPVPKRKDVMAALRKLVQPVKKP* |
Ga0137375_102302502 | 3300012360 | Vadose Zone Soil | MTDKSQEPTQKTPKGLEIPVPKRKELMDAFRKIVGAPKKP* |
Ga0137375_103096962 | 3300012360 | Vadose Zone Soil | VTDKPQEPKQKTSKGLEIPVPKRRDLMDAFRKVIKPVKKP* |
Ga0137375_106925712 | 3300012360 | Vadose Zone Soil | VTDKSQEPTQKTPKGLEIPVPRRKELMDAFRKIVGAPAKKP* |
Ga0137375_110833492 | 3300012360 | Vadose Zone Soil | VTDKPQEPKQKTSKGLEIPVPKRKDVMDALKKIAKPKR* |
Ga0134045_10137371 | 3300012409 | Grasslands Soil | PQPPSSDKPKQRTPKGLEIPVPNRKDLMDSFRKIVGAPPRKKP* |
Ga0134045_10137373 | 3300012409 | Grasslands Soil | PQEPKQKTPKGLEIPVPKRRDLMDAFRKIVGPVKKQP* |
Ga0150984_1226035161 | 3300012469 | Avena Fatua Rhizosphere | PQEPKQTTPKGLEIPVPKRKDVMDALRKLVQPVKKP* |
Ga0137373_107850302 | 3300012532 | Vadose Zone Soil | MTDKPQEPTQKTPKGLEIPVPRRKELMDAFRKIVGAPVKQP* |
Ga0137373_108139582 | 3300012532 | Vadose Zone Soil | MPEEQQEPKQKTPKGLEIPVPKRRDLMDAFRKVIKPAKKP* |
Ga0137373_110429281 | 3300012532 | Vadose Zone Soil | VATKDQEPTQRTPKGLEIPAPKRRDVLDGLRKLMQPVKKKP* |
Ga0136614_100761413 | 3300012684 | Polar Desert Sand | MSDKSQEPKQTTPKGLEIPVPKRSEVMDAFNKIVRPAKPTKD* |
Ga0136614_107577092 | 3300012684 | Polar Desert Sand | VTEKPQEPTQKTPKGLEIPVPKRQDVMDALKKLVQPAKKP* |
Ga0120147_10006282 | 3300013758 | Permafrost | MTDKPQEPTQKTPKGLEIPVPTRESIFSTLRKVIKPVKKS* |
Ga0120147_10351663 | 3300013758 | Permafrost | VTEKPQEPKQTTPKGLEIPVPKRRDLMDAFRKILKPVKKG* |
Ga0120179_10601242 | 3300013763 | Permafrost | MTPKEQEPKQRTAKGLEIPVPKRRDLMDAFRKIISPVKKG* |
Ga0120155_10369462 | 3300013768 | Permafrost | MADKPQEPTQKTPKGLEIPVPKRKELMDAFRKIVGPPVKKQP* |
Ga0120158_102115882 | 3300013772 | Permafrost | MADKRQETQVTPKGLEIPVPKRRDLTDAFKKLIRPVKKP* |
Ga0120149_10573793 | 3300014058 | Permafrost | MADKPQEPTQKTPKGLEIPVPSRESIFTALRKLAKPAKKP* |
Ga0120171_10554722 | 3300014827 | Permafrost | MTGKDQKPIQRTPKGLEIPVPKRKDLMDAFRKIVGPVKKKP* |
Ga0134069_12619312 | 3300017654 | Grasslands Soil | MPDKPQEPKQKTPKGLEIPVPKRKDLMDAFRKIVGAPAKKR |
Ga0134083_106065152 | 3300017659 | Grasslands Soil | MAGKPQEPTQRTPKGLEIPLPSRESIFAALRKVAKPVKKP |
Ga0136617_108448272 | 3300017789 | Polar Desert Sand | MTKKPQEPKQTTPQGVEIPIPKRSEVMDALKKVAPPGSPKR |
Ga0184608_104844961 | 3300018028 | Groundwater Sediment | KREPTQKMSKGLEIPVPKRKDVLGALRRIARPEKKTR |
Ga0184626_103163921 | 3300018053 | Groundwater Sediment | MPKPLKVEPTQRTETGLEIPVPKRRDLMDAFRKIIQPAKKR |
Ga0187765_107640201 | 3300018060 | Tropical Peatland | MSGKPQDRPAPTQRTPKGLEIPVPKRRDLMDAFRKIVRAPTKKA |
Ga0184624_104463312 | 3300018073 | Groundwater Sediment | VIHKSQEPKQITPKGLEIPVPKRKDLMDAFRKIVGAEPKKKP |
Ga0184627_101369613 | 3300018079 | Groundwater Sediment | MTDKPQEPKQKTPKGLEIPVPKREDVLDALDKIAKPKPAKT |
Ga0190265_100082057 | 3300018422 | Soil | MSEKPQEPTQKTPKGLEIPVPKRKDVMDALRKLVQP |
Ga0190265_101032864 | 3300018422 | Soil | MTGKAQEPKQTTPKGLEIPVPKREDVLDALGKVAKPPEKPKP |
Ga0066662_102732312 | 3300018468 | Grasslands Soil | MSEKPKEPAATQRTPKGLEIPVPKRRDVLEALRKLIQPARKP |
Ga0190273_101908152 | 3300018920 | Soil | MKADPQEPKQKAPKGLEIPVPKRKDVMDALTKIAKPKR |
Ga0193751_10142996 | 3300019888 | Soil | MSGKPQEPVVTQRTPKGLEIPVPKRRDVLDALRKLVQPARKP |
Ga0210362_10092242 | 3300021329 | Estuarine | MAEKPKQTTPKGLEIPVPKRREFMNAIRWVVKPKTKPKL |
Ga0209341_100704944 | 3300025325 | Soil | MADKSQEPKQTTPKGLEIPVPKRREVMGALRKVTQPPKKPKR |
Ga0209751_111122012 | 3300025327 | Soil | MAGKSQEPKQTTPKGLEIPVPKRREVMGALRKVTQPPKKPKR |
Ga0207664_100296363 | 3300025929 | Agricultural Soil | MADKEQPAPTQRTPKGLEIPVPKRRDLMDAFRKIVHAPKKP |
Ga0207711_120615233 | 3300025941 | Switchgrass Rhizosphere | MTDKAQEPANPQRMEKGLEIPVPKRKDVLDAFRKIV |
Ga0207675_1021100002 | 3300026118 | Switchgrass Rhizosphere | VTDKPQEPKQTTPKGLEIPIPKRRDVMDALKKLVQPAKK |
Ga0209058_13627662 | 3300026536 | Soil | MAETPKQKTPKGLEIPVPKRRDLMNAFRKIVGAPVKKP |
Ga0209887_10880182 | 3300027561 | Groundwater Sand | MSDKPQEPKQKTPKGLEIPVPKRKDVMDALKKIAKPKR |
Ga0209874_10345552 | 3300027577 | Groundwater Sand | VADKSQEPKQKTPKGLEIPVPKRKELMDAFRKIVGAPGKKQP |
Ga0209689_11957432 | 3300027748 | Soil | MADKPQEPKQTTPKGLEIPVPKRRDVMAALRKLVQPVKKP |
Ga0209701_104149671 | 3300027862 | Vadose Zone Soil | VTDKPQEPTQKTPKGLEIPVPKREAIFDALRKVIKP |
Ga0209579_1000004792 | 3300027869 | Surface Soil | VKRSPQPPAETQRTPKGLEIPVPKRTDVLDALRKLVQPKKG |
Ga0307285_101431132 | 3300028712 | Soil | LGPEPKQTTPKGLEIPVPKRRDVMDALRKLVQPKKP |
Ga0299914_111298821 | 3300031228 | Soil | VTDKPQEPKQTTPKGLEIPVPKRSTVLDALRKAAQPAKPKP |
Ga0308175_100000034122 | 3300031938 | Soil | MPDEQKQKTPKGLEILVPKRKDVLDALRKLVQPARKP |
Ga0315282_100976812 | 3300032069 | Sediment | MNKPERSGEEPKQKTRKGYEIPVPKRKDLVDAFRKLVQPTKKG |
Ga0335085_101563444 | 3300032770 | Soil | MSDEQKQKSRKGLEIPVPKRGDLMDAFRKIVQPVKKKP |
Ga0335076_104644693 | 3300032955 | Soil | MAGKESPTTQRTPKGVEIPVPKRGDLMDAFRKIIRPKKRG |
Ga0334722_102653902 | 3300033233 | Sediment | MADKPQEPKQKTPKGLEIPVPKRKDLLDAFKKIVQPVKKP |
⦗Top⦘ |