Metagenome / Metatranscriptome Family F053123

Basic Information
Family ID	F053123
Family Type	Metagenome / Metatranscriptome
Number of Sequences	141
Average Sequence Length	44 residues
Representative Sequence	LSEKHNSFLRLLKNKGFKEESTTKVGLYAIGTSTTLESNKS
Number of Associated Samples	89
Number of Associated Scaffolds	141

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	27.54 %
% of genes near scaffold ends (potentially truncated)	63.12 %
% of genes from short scaffolds (< 2000 bps)	85.82 %
Associated GOLD sequencing projects	85
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.32

Most Common Taxonomy
Group	Bacteria (60.284 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (23.404 % of family members)
Environment Ontology (ENVO)	Unclassified (31.206 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (53.901 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 43.48% β-sheet: 0.00% Coil/Unstructured: 56.52%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 141 Family Scaffolds
PF01370	Epimerase	3.55
PF01609	DDE_Tnp_1	2.13
PF07690	MFS_1	2.13
PF13701	DDE_Tnp_1_4	1.42
PF00296	Bac_luciferase	1.42
PF13560	HTH_31	1.42
PF07719	TPR_2	1.42
PF10282	Lactonase	1.42
PF12762	DDE_Tnp_IS1595	1.42
PF07883	Cupin_2	1.42
PF13340	DUF4096	1.42
PF13676	TIR_2	1.42
PF00211	Guanylate_cyc	0.71
PF12727	PBP_like	0.71
PF03476	MOSC_N	0.71
PF00589	Phage_integrase	0.71
PF12706	Lactamase_B_2	0.71
PF01850	PIN	0.71
PF05974	DUF892	0.71
PF02683	DsbD	0.71
PF13551	HTH_29	0.71
PF13460	NAD_binding_10	0.71
PF01594	AI-2E_transport	0.71
PF00076	RRM_1	0.71
PF00158	Sigma54_activat	0.71
PF13384	HTH_23	0.71
PF13751	DDE_Tnp_1_6	0.71
PF13424	TPR_12	0.71
PF13358	DDE_3	0.71
PF08241	Methyltransf_11	0.71
PF01139	RtcB	0.71
PF16694	Cytochrome_P460	0.71
PF09471	Peptidase_M64	0.71
PF02781	G6PD_C	0.71
PF10604	Polyketide_cyc2	0.71
PF12759	HTH_Tnp_IS1	0.71
PF01797	Y1_Tnp	0.71
PF01425	Amidase	0.71
PF13419	HAD_2	0.71
PF13672	PP2C_2	0.71
PF13191	AAA_16	0.71
PF00206	Lyase_1	0.71
PF10544	T5orf172	0.71
PF00496	SBP_bac_5	0.71
PF04392	ABC_sub_bind	0.71
PF13432	TPR_16	0.71
PF13610	DDE_Tnp_IS240	0.71
PF01042	Ribonuc_L-PSP	0.71
PF00578	AhpC-TSA	0.71
PF07681	DoxX	0.71
PF13646	HEAT_2	0.71
PF03050	DDE_Tnp_IS66	0.71
PF02771	Acyl-CoA_dh_N	0.71
PF02705	K_trans	0.71
PF07978	NIPSNAP	0.71
PF01494	FAD_binding_3	0.71
PF04191	PEMT	0.71
PF13518	HTH_28	0.71
PF13714	PEP_mutase	0.71

COG ID	Name	Functional Category	% Frequency in 141 Family Scaffolds
COG3039	Transposase and inactivated derivatives, IS5 family	Mobilome: prophages, transposons [X]	2.13
COG3293	Transposase	Mobilome: prophages, transposons [X]	2.13
COG3385	IS4 transposase InsG	Mobilome: prophages, transposons [X]	2.13
COG5421	Transposase	Mobilome: prophages, transposons [X]	2.13
COG5433	Predicted transposase YbfD/YdcC associated with H repeats	Mobilome: prophages, transposons [X]	2.13
COG5659	SRSO17 transposase	Mobilome: prophages, transposons [X]	2.13
COG0654	2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases	Energy production and conversion [C]	1.42
COG2141	Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)	Coenzyme transport and metabolism [H]	1.42
COG0154	Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase	Translation, ribosomal structure and biogenesis [J]	0.71
COG0251	Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family	Defense mechanisms [V]	0.71
COG0364	Glucose-6-phosphate 1-dehydrogenase	Carbohydrate transport and metabolism [G]	0.71
COG0578	Glycerol-3-phosphate dehydrogenase	Energy production and conversion [C]	0.71
COG0628	Predicted PurR-regulated permease PerM	General function prediction only [R]	0.71
COG0644	Dehydrogenase (flavoprotein)	Energy production and conversion [C]	0.71
COG0665	Glycine/D-amino acid oxidase (deaminating)	Amino acid transport and metabolism [E]	0.71
COG1690	RNA-splicing ligase RtcB, repairs tRNA damage	Translation, ribosomal structure and biogenesis [J]	0.71
COG1943	REP element-mobilizing transposase RayT	Mobilome: prophages, transposons [X]	0.71
COG1960	Acyl-CoA dehydrogenase related to the alkylation response protein AidB	Lipid transport and metabolism [I]	0.71
COG2114	Adenylate cyclase, class 3	Signal transduction mechanisms [T]	0.71
COG2259	Uncharacterized membrane protein YphA, DoxX/SURF4 family	Function unknown [S]	0.71
COG2984	ABC-type uncharacterized transport system, periplasmic component	General function prediction only [R]	0.71
COG3158	K+ uptake protein Kup	Inorganic ion transport and metabolism [P]	0.71
COG3217	N-hydroxylaminopurine reductase subunit YcbX, contains MOSC domain	Defense mechanisms [V]	0.71
COG3436	Transposase	Mobilome: prophages, transposons [X]	0.71
COG3685	Ferritin-like metal-binding protein YciE	Inorganic ion transport and metabolism [P]	0.71
COG4270	Uncharacterized membrane protein	Function unknown [S]	0.71

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	61.70 %
Unclassified	root	N/A	37.59 %
Polyangium	genus	Polyangium	0.71 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	61.70 %
Unclassified	root	N/A	37.59 %
Polyangium fumosum	species	Polyangium → Polyangium fumosum	0.71 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	60.28 %
Unclassified	root	N/A	37.59 %
Archaea	superkingdom	All Organisms → cellular organisms → Archaea	0.71 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	0.71 %
Polyangium fumosum	species	Polyangium → Polyangium fumosum	0.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.59 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	12.77 %
Nitrospinae/Tectomicrobia group	clade	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group	4.26 %
PVC group	clade	All Organisms → cellular organisms → Bacteria → PVC group	2.84 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	2.84 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	1.42 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	1.42 %
unclassified Bacteria	no rank	All Organisms → cellular organisms → Bacteria → unclassified Bacteria	1.42 %
Bacteria incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis	1.42 %
TACK group	clade	All Organisms → cellular organisms → Archaea → TACK group	0.71 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	0.71 %
Polyangium fumosum	species	Polyangium → Polyangium fumosum	0.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.59 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	4.26 %
Candidatus Tectomicrobia	phylum	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia	4.26 %
Planctomycetes	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes	2.84 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	2.13 %
Cyanobacteria/Melainabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group	1.42 %
Bacteria candidate phyla	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	1.42 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	1.42 %
Oligoflexia	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia	0.71 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	0.71 %
Bacteroidetes/Chlorobi group	clade	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group	0.71 %
Gemmatimonadetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	0.71 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	0.71 %
Crenarchaeota	phylum	All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota	0.71 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.71 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	0.71 %
Polyangium fumosum	species	Polyangium → Polyangium fumosum	0.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.59 %
Candidatus Entotheonella	genus	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella	4.26 %
Planctomycetia	class	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia	2.84 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	2.13 %
Candidatus Rokubacteria	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	1.42 %
unclassified Alphaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria	1.42 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	1.42 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	1.42 %
unclassified Thermoproteota	no rank	All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → unclassified Thermoproteota	0.71 %
Acidobacteria bacterium RIFCSPLOWO2_12_FULL_54_10	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_12_FULL_54_10	0.71 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.71 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.71 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.71 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	0.71 %
unclassified Gemmatimonadetes	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes	0.71 %
Bdellovibrionales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bdellovibrionales	0.71 %
Sphingomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales	0.71 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	0.71 %
Polyangium fumosum	species	Polyangium → Polyangium fumosum	0.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.59 %
Isosphaerales	order	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales	1.42 %
unclassified Deltaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria	1.42 %
unclassified Candidatus Rokubacteria	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria	1.42 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1.42 %
Candidatus Entotheonella gemina	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina	1.42 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	1.42 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	0.71 %
Bacteroidetes Order II. Incertae sedis	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis	0.71 %
Crenarchaeota archaeon 13_1_20CM_2_51_8	species	All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → unclassified Thermoproteota → Crenarchaeota archaeon 13_1_20CM_2_51_8	0.71 %
Planctomycetales	order	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales	0.71 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	0.71 %
unclassified Cyanobacteria	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria	0.71 %
Candidatus Entotheonella palauensis	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella palauensis	0.71 %
Streptomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales	0.71 %
unclassified Hyphomicrobiales	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales	0.71 %
Sphingomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	0.71 %
unclassified Bdellovibrionales	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bdellovibrionales → unclassified Bdellovibrionales	0.71 %
Acidobacteria bacterium RIFCSPLOWO2_12_FULL_54_10	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_12_FULL_54_10	0.71 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	0.71 %
Polyangium fumosum	species	Polyangium → Polyangium fumosum	0.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.59 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1.42 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1.42 %
Isosphaeraceae	family	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae	1.42 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1.42 %
Candidatus Entotheonella gemina	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina	1.42 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	1.42 %
Bdellovibrionales bacterium RIFOXYD1_FULL_55_31	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bdellovibrionales → unclassified Bdellovibrionales → Bdellovibrionales bacterium RIFOXYD1_FULL_55_31	0.71 %
Streptomycetaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae	0.71 %
Planctomycetaceae	family	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae	0.71 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.71 %
Cyanobacteria bacterium 13_1_20CM_4_61_6	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6	0.71 %
Rhodothermaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae	0.71 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	0.71 %
Crenarchaeota archaeon 13_1_20CM_2_51_8	species	All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → unclassified Thermoproteota → Crenarchaeota archaeon 13_1_20CM_2_51_8	0.71 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	0.71 %
Candidatus Entotheonella palauensis	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella palauensis	0.71 %
Sphingomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	0.71 %
Acidobacteria bacterium RIFCSPLOWO2_12_FULL_54_10	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_12_FULL_54_10	0.71 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	0.71 %
Polyangium fumosum	species	Polyangium → Polyangium fumosum	0.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.59 %
Singulisphaera	genus	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Singulisphaera	1.42 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1.42 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1.42 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1.42 %
Candidatus Entotheonella gemina	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina	1.42 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	1.42 %
unclassified Planctomycetaceae	no rank	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae	0.71 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	0.71 %
Salinibacter	genus	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → Salinibacter	0.71 %
Streptomyces	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces	0.71 %
Bdellovibrionales bacterium RIFOXYD1_FULL_55_31	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bdellovibrionales → unclassified Bdellovibrionales → Bdellovibrionales bacterium RIFOXYD1_FULL_55_31	0.71 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.71 %
Cyanobacteria bacterium 13_1_20CM_4_61_6	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6	0.71 %
Crenarchaeota archaeon 13_1_20CM_2_51_8	species	All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → unclassified Thermoproteota → Crenarchaeota archaeon 13_1_20CM_2_51_8	0.71 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	0.71 %
Candidatus Entotheonella palauensis	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella palauensis	0.71 %
Sphingomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	0.71 %
Acidobacteria bacterium RIFCSPLOWO2_12_FULL_54_10	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_12_FULL_54_10	0.71 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	0.71 %
Polyangium fumosum	species	Polyangium → Polyangium fumosum	0.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.59 %
Singulisphaera acidiphila	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Singulisphaera → Singulisphaera acidiphila	1.42 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1.42 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1.42 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1.42 %
Candidatus Entotheonella gemina	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina	1.42 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	1.42 %
Planctomycetaceae bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium	0.71 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	0.71 %
Salinibacter ruber	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → Salinibacter → Salinibacter ruber	0.71 %
Streptomyces	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces	0.71 %
Bdellovibrionales bacterium RIFOXYD1_FULL_55_31	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bdellovibrionales → unclassified Bdellovibrionales → Bdellovibrionales bacterium RIFOXYD1_FULL_55_31	0.71 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.71 %
Cyanobacteria bacterium 13_1_20CM_4_61_6	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6	0.71 %
Crenarchaeota archaeon 13_1_20CM_2_51_8	species	All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → unclassified Thermoproteota → Crenarchaeota archaeon 13_1_20CM_2_51_8	0.71 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	0.71 %
Candidatus Entotheonella palauensis	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella palauensis	0.71 %
Sphingomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	0.71 %
Acidobacteria bacterium RIFCSPLOWO2_12_FULL_54_10	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_12_FULL_54_10	0.71 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	0.71 %
Polyangium fumosum	species	Polyangium → Polyangium fumosum	0.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.59 %
Singulisphaera acidiphila	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Singulisphaera → Singulisphaera acidiphila	1.42 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1.42 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1.42 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1.42 %
Candidatus Entotheonella gemina	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina	1.42 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	1.42 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	0.71 %
Planctomycetaceae bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium	0.71 %
Salinibacter ruber	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → Salinibacter → Salinibacter ruber	0.71 %
Streptomyces	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces	0.71 %
Bdellovibrionales bacterium RIFOXYD1_FULL_55_31	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bdellovibrionales → unclassified Bdellovibrionales → Bdellovibrionales bacterium RIFOXYD1_FULL_55_31	0.71 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.71 %
Cyanobacteria bacterium 13_1_20CM_4_61_6	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6	0.71 %
Crenarchaeota archaeon 13_1_20CM_2_51_8	species	All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → unclassified Thermoproteota → Crenarchaeota archaeon 13_1_20CM_2_51_8	0.71 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	0.71 %
Candidatus Entotheonella palauensis	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella palauensis	0.71 %
Sphingomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	0.71 %
Acidobacteria bacterium RIFCSPLOWO2_12_FULL_54_10	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_12_FULL_54_10	0.71 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	0.71 %
Polyangium fumosum	species	Polyangium → Polyangium fumosum	0.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.59 %
Singulisphaera acidiphila	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Singulisphaera → Singulisphaera acidiphila	1.42 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1.42 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1.42 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1.42 %
Candidatus Entotheonella gemina	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina	1.42 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	1.42 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	0.71 %
Planctomycetaceae bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium	0.71 %
Salinibacter ruber	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → Salinibacter → Salinibacter ruber	0.71 %
Streptomyces	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces	0.71 %
Bdellovibrionales bacterium RIFOXYD1_FULL_55_31	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bdellovibrionales → unclassified Bdellovibrionales → Bdellovibrionales bacterium RIFOXYD1_FULL_55_31	0.71 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.71 %
Cyanobacteria bacterium 13_1_20CM_4_61_6	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6	0.71 %
Crenarchaeota archaeon 13_1_20CM_2_51_8	species	All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → unclassified Thermoproteota → Crenarchaeota archaeon 13_1_20CM_2_51_8	0.71 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	0.71 %
Candidatus Entotheonella palauensis	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella palauensis	0.71 %
Sphingomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	0.71 %
Acidobacteria bacterium RIFCSPLOWO2_12_FULL_54_10	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_12_FULL_54_10	0.71 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	0.71 %
Polyangium fumosum	species	Polyangium → Polyangium fumosum	0.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.59 %
Singulisphaera acidiphila	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Singulisphaera → Singulisphaera acidiphila	1.42 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1.42 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1.42 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1.42 %
Candidatus Entotheonella gemina	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina	1.42 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	1.42 %
eudicotyledons	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons	0.71 %
Planctomycetaceae bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium	0.71 %
Salinibacter ruber	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → Salinibacter → Salinibacter ruber	0.71 %
Streptomyces	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces	0.71 %
Bdellovibrionales bacterium RIFOXYD1_FULL_55_31	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bdellovibrionales → unclassified Bdellovibrionales → Bdellovibrionales bacterium RIFOXYD1_FULL_55_31	0.71 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.71 %
Cyanobacteria bacterium 13_1_20CM_4_61_6	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6	0.71 %
Crenarchaeota archaeon 13_1_20CM_2_51_8	species	All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → unclassified Thermoproteota → Crenarchaeota archaeon 13_1_20CM_2_51_8	0.71 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	0.71 %
Candidatus Entotheonella palauensis	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella palauensis	0.71 %
Sphingomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	0.71 %
Acidobacteria bacterium RIFCSPLOWO2_12_FULL_54_10	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_12_FULL_54_10	0.71 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	0.71 %
Polyangium fumosum	species	Polyangium → Polyangium fumosum	0.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.59 %
Singulisphaera acidiphila	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Singulisphaera → Singulisphaera acidiphila	1.42 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1.42 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1.42 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1.42 %
Candidatus Entotheonella gemina	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina	1.42 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	1.42 %
Gunneridae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae	0.71 %
Planctomycetaceae bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium	0.71 %
Salinibacter ruber	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → Salinibacter → Salinibacter ruber	0.71 %
Streptomyces	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces	0.71 %
Bdellovibrionales bacterium RIFOXYD1_FULL_55_31	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bdellovibrionales → unclassified Bdellovibrionales → Bdellovibrionales bacterium RIFOXYD1_FULL_55_31	0.71 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.71 %
Cyanobacteria bacterium 13_1_20CM_4_61_6	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6	0.71 %
Crenarchaeota archaeon 13_1_20CM_2_51_8	species	All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → unclassified Thermoproteota → Crenarchaeota archaeon 13_1_20CM_2_51_8	0.71 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	0.71 %
Candidatus Entotheonella palauensis	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella palauensis	0.71 %
Sphingomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	0.71 %
Acidobacteria bacterium RIFCSPLOWO2_12_FULL_54_10	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_12_FULL_54_10	0.71 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	0.71 %
Polyangium fumosum	species	Polyangium → Polyangium fumosum	0.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.59 %
Singulisphaera acidiphila	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Singulisphaera → Singulisphaera acidiphila	1.42 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1.42 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1.42 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1.42 %
Candidatus Entotheonella gemina	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina	1.42 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	1.42 %
Pentapetalae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae	0.71 %
Planctomycetaceae bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium	0.71 %
Salinibacter ruber	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → Salinibacter → Salinibacter ruber	0.71 %
Streptomyces	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces	0.71 %
Bdellovibrionales bacterium RIFOXYD1_FULL_55_31	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bdellovibrionales → unclassified Bdellovibrionales → Bdellovibrionales bacterium RIFOXYD1_FULL_55_31	0.71 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.71 %
Cyanobacteria bacterium 13_1_20CM_4_61_6	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6	0.71 %
Crenarchaeota archaeon 13_1_20CM_2_51_8	species	All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → unclassified Thermoproteota → Crenarchaeota archaeon 13_1_20CM_2_51_8	0.71 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	0.71 %
Candidatus Entotheonella palauensis	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella palauensis	0.71 %
Sphingomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	0.71 %
Acidobacteria bacterium RIFCSPLOWO2_12_FULL_54_10	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_12_FULL_54_10	0.71 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	0.71 %
Polyangium fumosum	species	Polyangium → Polyangium fumosum	0.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.59 %
Singulisphaera acidiphila	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Singulisphaera → Singulisphaera acidiphila	1.42 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1.42 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1.42 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1.42 %
Candidatus Entotheonella gemina	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina	1.42 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	1.42 %
rosids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids	0.71 %
Planctomycetaceae bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium	0.71 %
Salinibacter ruber	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → Salinibacter → Salinibacter ruber	0.71 %
Streptomyces	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces	0.71 %
Bdellovibrionales bacterium RIFOXYD1_FULL_55_31	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bdellovibrionales → unclassified Bdellovibrionales → Bdellovibrionales bacterium RIFOXYD1_FULL_55_31	0.71 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.71 %
Cyanobacteria bacterium 13_1_20CM_4_61_6	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6	0.71 %
Crenarchaeota archaeon 13_1_20CM_2_51_8	species	All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → unclassified Thermoproteota → Crenarchaeota archaeon 13_1_20CM_2_51_8	0.71 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	0.71 %
Candidatus Entotheonella palauensis	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella palauensis	0.71 %
Sphingomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	0.71 %
Acidobacteria bacterium RIFCSPLOWO2_12_FULL_54_10	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_12_FULL_54_10	0.71 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	0.71 %
Polyangium fumosum	species	Polyangium → Polyangium fumosum	0.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.59 %
Singulisphaera acidiphila	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Singulisphaera → Singulisphaera acidiphila	1.42 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1.42 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1.42 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1.42 %
Candidatus Entotheonella gemina	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina	1.42 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	1.42 %
malvids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids	0.71 %
Planctomycetaceae bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium	0.71 %
Salinibacter ruber	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → Salinibacter → Salinibacter ruber	0.71 %
Streptomyces	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces	0.71 %
Bdellovibrionales bacterium RIFOXYD1_FULL_55_31	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bdellovibrionales → unclassified Bdellovibrionales → Bdellovibrionales bacterium RIFOXYD1_FULL_55_31	0.71 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.71 %
Cyanobacteria bacterium 13_1_20CM_4_61_6	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6	0.71 %
Crenarchaeota archaeon 13_1_20CM_2_51_8	species	All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → unclassified Thermoproteota → Crenarchaeota archaeon 13_1_20CM_2_51_8	0.71 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	0.71 %
Candidatus Entotheonella palauensis	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella palauensis	0.71 %
Sphingomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	0.71 %
Acidobacteria bacterium RIFCSPLOWO2_12_FULL_54_10	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_12_FULL_54_10	0.71 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	0.71 %
Polyangium fumosum	species	Polyangium → Polyangium fumosum	0.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.59 %
Singulisphaera acidiphila	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Singulisphaera → Singulisphaera acidiphila	1.42 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1.42 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1.42 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1.42 %
Candidatus Entotheonella gemina	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina	1.42 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	1.42 %
Brassicales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales	0.71 %
Planctomycetaceae bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium	0.71 %
Salinibacter ruber	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → Salinibacter → Salinibacter ruber	0.71 %
Streptomyces	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces	0.71 %
Bdellovibrionales bacterium RIFOXYD1_FULL_55_31	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bdellovibrionales → unclassified Bdellovibrionales → Bdellovibrionales bacterium RIFOXYD1_FULL_55_31	0.71 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.71 %
Cyanobacteria bacterium 13_1_20CM_4_61_6	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6	0.71 %
Crenarchaeota archaeon 13_1_20CM_2_51_8	species	All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → unclassified Thermoproteota → Crenarchaeota archaeon 13_1_20CM_2_51_8	0.71 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	0.71 %
Candidatus Entotheonella palauensis	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella palauensis	0.71 %
Sphingomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	0.71 %
Acidobacteria bacterium RIFCSPLOWO2_12_FULL_54_10	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_12_FULL_54_10	0.71 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	0.71 %
Polyangium fumosum	species	Polyangium → Polyangium fumosum	0.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.59 %
Singulisphaera acidiphila	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Singulisphaera → Singulisphaera acidiphila	1.42 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1.42 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1.42 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1.42 %
Candidatus Entotheonella gemina	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina	1.42 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	1.42 %
Brassicaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae	0.71 %
Planctomycetaceae bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium	0.71 %
Salinibacter ruber	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → Salinibacter → Salinibacter ruber	0.71 %
Streptomyces	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces	0.71 %
Bdellovibrionales bacterium RIFOXYD1_FULL_55_31	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bdellovibrionales → unclassified Bdellovibrionales → Bdellovibrionales bacterium RIFOXYD1_FULL_55_31	0.71 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.71 %
Cyanobacteria bacterium 13_1_20CM_4_61_6	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6	0.71 %
Crenarchaeota archaeon 13_1_20CM_2_51_8	species	All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → unclassified Thermoproteota → Crenarchaeota archaeon 13_1_20CM_2_51_8	0.71 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	0.71 %
Candidatus Entotheonella palauensis	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella palauensis	0.71 %
Sphingomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	0.71 %
Acidobacteria bacterium RIFCSPLOWO2_12_FULL_54_10	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_12_FULL_54_10	0.71 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	0.71 %
Polyangium fumosum	species	Polyangium → Polyangium fumosum	0.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.59 %
Singulisphaera acidiphila	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Singulisphaera → Singulisphaera acidiphila	1.42 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1.42 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1.42 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1.42 %
Candidatus Entotheonella gemina	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina	1.42 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	1.42 %
Camelineae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae	0.71 %
Planctomycetaceae bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium	0.71 %
Salinibacter ruber	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → Salinibacter → Salinibacter ruber	0.71 %
Streptomyces	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces	0.71 %
Bdellovibrionales bacterium RIFOXYD1_FULL_55_31	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bdellovibrionales → unclassified Bdellovibrionales → Bdellovibrionales bacterium RIFOXYD1_FULL_55_31	0.71 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.71 %
Cyanobacteria bacterium 13_1_20CM_4_61_6	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6	0.71 %
Crenarchaeota archaeon 13_1_20CM_2_51_8	species	All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → unclassified Thermoproteota → Crenarchaeota archaeon 13_1_20CM_2_51_8	0.71 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	0.71 %
Candidatus Entotheonella palauensis	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella palauensis	0.71 %
Sphingomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	0.71 %
Acidobacteria bacterium RIFCSPLOWO2_12_FULL_54_10	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_12_FULL_54_10	0.71 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	0.71 %
Polyangium fumosum	species	Polyangium → Polyangium fumosum	0.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.59 %
Singulisphaera acidiphila	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Singulisphaera → Singulisphaera acidiphila	1.42 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1.42 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1.42 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1.42 %
Candidatus Entotheonella gemina	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina	1.42 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	1.42 %
Arabidopsis	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis	0.71 %
Planctomycetaceae bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium	0.71 %
Salinibacter ruber	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → Salinibacter → Salinibacter ruber	0.71 %
Streptomyces	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces	0.71 %
Bdellovibrionales bacterium RIFOXYD1_FULL_55_31	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bdellovibrionales → unclassified Bdellovibrionales → Bdellovibrionales bacterium RIFOXYD1_FULL_55_31	0.71 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.71 %
Cyanobacteria bacterium 13_1_20CM_4_61_6	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6	0.71 %
Crenarchaeota archaeon 13_1_20CM_2_51_8	species	All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → unclassified Thermoproteota → Crenarchaeota archaeon 13_1_20CM_2_51_8	0.71 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	0.71 %
Candidatus Entotheonella palauensis	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella palauensis	0.71 %
Sphingomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	0.71 %
Acidobacteria bacterium RIFCSPLOWO2_12_FULL_54_10	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_12_FULL_54_10	0.71 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	0.71 %
Polyangium fumosum	species	Polyangium → Polyangium fumosum	0.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.59 %
Singulisphaera acidiphila	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Singulisphaera → Singulisphaera acidiphila	1.42 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1.42 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1.42 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1.42 %
Candidatus Entotheonella gemina	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina	1.42 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	1.42 %
Arabidopsis thaliana	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis → Arabidopsis thaliana	0.71 %
Planctomycetaceae bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium	0.71 %
Salinibacter ruber	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → Salinibacter → Salinibacter ruber	0.71 %
Streptomyces	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces	0.71 %
Bdellovibrionales bacterium RIFOXYD1_FULL_55_31	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bdellovibrionales → unclassified Bdellovibrionales → Bdellovibrionales bacterium RIFOXYD1_FULL_55_31	0.71 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.71 %
Cyanobacteria bacterium 13_1_20CM_4_61_6	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6	0.71 %
Crenarchaeota archaeon 13_1_20CM_2_51_8	species	All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → unclassified Thermoproteota → Crenarchaeota archaeon 13_1_20CM_2_51_8	0.71 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	0.71 %
Candidatus Entotheonella palauensis	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella palauensis	0.71 %
Sphingomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	0.71 %
Acidobacteria bacterium RIFCSPLOWO2_12_FULL_54_10	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_12_FULL_54_10	0.71 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	0.71 %
Polyangium fumosum	species	Polyangium → Polyangium fumosum	0.71 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000955\|JGI1027J12803_105984621	All Organisms → cellular organisms → Bacteria	1303	Open in IMG/M
3300004153\|Ga0063455_100896329	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	628	Open in IMG/M
3300005181\|Ga0066678_10256350	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1133	Open in IMG/M
3300005187\|Ga0066675_11183972	All Organisms → cellular organisms → Bacteria	568	Open in IMG/M
3300005332\|Ga0066388_100060578	All Organisms → cellular organisms → Bacteria → Proteobacteria	4005	Open in IMG/M
3300005332\|Ga0066388_100397687	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina	2023	Open in IMG/M
3300005332\|Ga0066388_101745673	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Singulisphaera → Singulisphaera acidiphila	1104	Open in IMG/M
3300005332\|Ga0066388_105229380	All Organisms → cellular organisms → Bacteria → Proteobacteria	659	Open in IMG/M
3300005332\|Ga0066388_105452658	Not Available	645	Open in IMG/M
3300005332\|Ga0066388_106688982	All Organisms → cellular organisms → Bacteria	581	Open in IMG/M
3300005332\|Ga0066388_106876253	All Organisms → cellular organisms → Bacteria	573	Open in IMG/M
3300005332\|Ga0066388_108454957	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	513	Open in IMG/M
3300005332\|Ga0066388_108544879	Not Available	510	Open in IMG/M
3300005438\|Ga0070701_10637920	Not Available	710	Open in IMG/M
3300005556\|Ga0066707_10029005	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6	3037	Open in IMG/M
3300005559\|Ga0066700_10168768	All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bdellovibrionales → unclassified Bdellovibrionales → Bdellovibrionales bacterium RIFOXYD1_FULL_55_31	1495	Open in IMG/M
3300005564\|Ga0070664_101011510	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	781	Open in IMG/M
3300005713\|Ga0066905_100634598	All Organisms → cellular organisms → Bacteria	908	Open in IMG/M
3300005764\|Ga0066903_100471144	All Organisms → cellular organisms → Bacteria	2111	Open in IMG/M
3300005764\|Ga0066903_101445445	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Singulisphaera → Singulisphaera acidiphila	1295	Open in IMG/M
3300005844\|Ga0068862_101414583	Not Available	699	Open in IMG/M
3300005937\|Ga0081455_10331336	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1080	Open in IMG/M
3300006844\|Ga0075428_100041507	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	5060	Open in IMG/M
3300006844\|Ga0075428_100150258	All Organisms → cellular organisms → Bacteria	2530	Open in IMG/M
3300006844\|Ga0075428_100928714	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	922	Open in IMG/M
3300006844\|Ga0075428_101333439	Not Available	754	Open in IMG/M
3300006844\|Ga0075428_102328913	Not Available	551	Open in IMG/M
3300006845\|Ga0075421_100074337	All Organisms → cellular organisms → Bacteria → Proteobacteria	4288	Open in IMG/M
3300006846\|Ga0075430_100091276	All Organisms → cellular organisms → Bacteria	2547	Open in IMG/M
3300006847\|Ga0075431_100099440	All Organisms → cellular organisms → Bacteria → Proteobacteria	3002	Open in IMG/M
3300006847\|Ga0075431_100410833	All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → unclassified Thermoproteota → Crenarchaeota archaeon 13_1_20CM_2_51_8	1354	Open in IMG/M
3300006880\|Ga0075429_100930469	All Organisms → cellular organisms → Bacteria → Proteobacteria	760	Open in IMG/M
3300006904\|Ga0075424_100587867	All Organisms → cellular organisms → Bacteria	1189	Open in IMG/M
3300006969\|Ga0075419_10322154	Not Available	1046	Open in IMG/M
3300007258\|Ga0099793_10004498	All Organisms → cellular organisms → Bacteria	4969	Open in IMG/M
3300009038\|Ga0099829_11750248	Not Available	510	Open in IMG/M
3300009089\|Ga0099828_10661659	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina	939	Open in IMG/M
3300009090\|Ga0099827_11051796	Not Available	706	Open in IMG/M
3300009094\|Ga0111539_12432504	All Organisms → cellular organisms → Bacteria	608	Open in IMG/M
3300009100\|Ga0075418_10390152	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1488	Open in IMG/M
3300009100\|Ga0075418_11668622	Not Available	693	Open in IMG/M
3300009143\|Ga0099792_10387171	Not Available	852	Open in IMG/M
3300009143\|Ga0099792_10707668	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	652	Open in IMG/M
3300009147\|Ga0114129_10630365	All Organisms → cellular organisms → Bacteria	1386	Open in IMG/M
3300009147\|Ga0114129_10755168	All Organisms → cellular organisms → Bacteria	1245	Open in IMG/M
3300009147\|Ga0114129_10951483	All Organisms → cellular organisms → Bacteria	1085	Open in IMG/M
3300009147\|Ga0114129_12566389	All Organisms → cellular organisms → Bacteria	608	Open in IMG/M
3300009147\|Ga0114129_12736279	Not Available	587	Open in IMG/M
3300009156\|Ga0111538_13765461	Not Available	525	Open in IMG/M
3300009162\|Ga0075423_10462667	All Organisms → cellular organisms → Bacteria	1333	Open in IMG/M
3300009162\|Ga0075423_10666298	Polyangium → Polyangium fumosum	1098	Open in IMG/M
3300009162\|Ga0075423_11673484	Not Available	685	Open in IMG/M
3300009176\|Ga0105242_13034853	Not Available	520	Open in IMG/M
3300009792\|Ga0126374_10815582	All Organisms → cellular organisms → Bacteria	714	Open in IMG/M
3300009816\|Ga0105076_1076134	All Organisms → cellular organisms → Bacteria	630	Open in IMG/M
3300009822\|Ga0105066_1030775	All Organisms → cellular organisms → Bacteria	1088	Open in IMG/M
3300010043\|Ga0126380_10532122	Not Available	910	Open in IMG/M
3300010043\|Ga0126380_10542063	All Organisms → cellular organisms → Bacteria	903	Open in IMG/M
3300010043\|Ga0126380_10906810	Not Available	733	Open in IMG/M
3300010046\|Ga0126384_10185529	All Organisms → cellular organisms → Bacteria	1634	Open in IMG/M
3300010046\|Ga0126384_10268790	All Organisms → cellular organisms → Bacteria	1387	Open in IMG/M
3300010046\|Ga0126384_10565835	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium	990	Open in IMG/M
3300010047\|Ga0126382_10144726	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces	1617	Open in IMG/M
3300010047\|Ga0126382_10181100	Not Available	1479	Open in IMG/M
3300010047\|Ga0126382_10687001	All Organisms → cellular organisms → Bacteria	856	Open in IMG/M
3300010047\|Ga0126382_11884237	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella	565	Open in IMG/M
3300010358\|Ga0126370_11062129	Not Available	744	Open in IMG/M
3300010358\|Ga0126370_11167619	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	714	Open in IMG/M
3300010359\|Ga0126376_10066993	All Organisms → cellular organisms → Bacteria	2610	Open in IMG/M
3300010359\|Ga0126376_11900729	Not Available	635	Open in IMG/M
3300010359\|Ga0126376_12525660	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	562	Open in IMG/M
3300010361\|Ga0126378_11217614	Not Available	850	Open in IMG/M
3300010362\|Ga0126377_10911284	Not Available	942	Open in IMG/M
3300010362\|Ga0126377_11415261	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	768	Open in IMG/M
3300010362\|Ga0126377_12998092	Not Available	545	Open in IMG/M
3300010366\|Ga0126379_10485689	Not Available	1304	Open in IMG/M
3300010366\|Ga0126379_12385697	Not Available	629	Open in IMG/M
3300010375\|Ga0105239_11154455	Not Available	892	Open in IMG/M
3300010398\|Ga0126383_10046516	All Organisms → cellular organisms → Bacteria	3584	Open in IMG/M
3300010398\|Ga0126383_10747460	All Organisms → cellular organisms → Bacteria	1058	Open in IMG/M
3300011270\|Ga0137391_11393245	Not Available	547	Open in IMG/M
3300012189\|Ga0137388_10682015	Not Available	954	Open in IMG/M
3300012202\|Ga0137363_10444621	All Organisms → cellular organisms → Bacteria	1084	Open in IMG/M
3300012202\|Ga0137363_10572421	All Organisms → cellular organisms → Bacteria	952	Open in IMG/M
3300012203\|Ga0137399_10078642	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis → Arabidopsis thaliana	2497	Open in IMG/M
3300012203\|Ga0137399_10241903	All Organisms → cellular organisms → Bacteria → Acidobacteria	1478	Open in IMG/M
3300012205\|Ga0137362_10353540	All Organisms → cellular organisms → Bacteria	1272	Open in IMG/M
3300012205\|Ga0137362_11478081	Not Available	566	Open in IMG/M
3300012206\|Ga0137380_10270339	All Organisms → cellular organisms → Bacteria	1528	Open in IMG/M
3300012206\|Ga0137380_10770436	All Organisms → cellular organisms → Bacteria	832	Open in IMG/M
3300012207\|Ga0137381_11475751	Not Available	572	Open in IMG/M
3300012209\|Ga0137379_10896411	All Organisms → cellular organisms → Bacteria	791	Open in IMG/M
3300012212\|Ga0150985_101779893	All Organisms → cellular organisms → Bacteria	879	Open in IMG/M
3300012212\|Ga0150985_117920431	All Organisms → cellular organisms → Bacteria	698	Open in IMG/M
3300012359\|Ga0137385_11592992	All Organisms → cellular organisms → Bacteria	517	Open in IMG/M
3300012361\|Ga0137360_11731852	Not Available	530	Open in IMG/M
3300012362\|Ga0137361_10293990	All Organisms → cellular organisms → Bacteria → Proteobacteria	1486	Open in IMG/M
3300012362\|Ga0137361_11889272	Not Available	514	Open in IMG/M
3300012363\|Ga0137390_10845124	All Organisms → cellular organisms → Bacteria	872	Open in IMG/M
3300012685\|Ga0137397_10437800	Not Available	974	Open in IMG/M
3300012922\|Ga0137394_10176830	Not Available	1820	Open in IMG/M
3300012925\|Ga0137419_10380601	All Organisms → cellular organisms → Bacteria	1098	Open in IMG/M
3300012925\|Ga0137419_11320889	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → Salinibacter → Salinibacter ruber	607	Open in IMG/M
3300012927\|Ga0137416_11341091	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella	647	Open in IMG/M
3300012944\|Ga0137410_10602146	Not Available	908	Open in IMG/M
3300012948\|Ga0126375_11274823	All Organisms → cellular organisms → Bacteria	616	Open in IMG/M
3300012948\|Ga0126375_11431005	Not Available	587	Open in IMG/M
3300012948\|Ga0126375_11550481	Not Available	568	Open in IMG/M
3300012971\|Ga0126369_10186773	All Organisms → cellular organisms → Bacteria	1986	Open in IMG/M
3300012971\|Ga0126369_10570517	All Organisms → cellular organisms → Bacteria	1198	Open in IMG/M
3300012971\|Ga0126369_12189071	Not Available	640	Open in IMG/M
3300013306\|Ga0163162_10197168	Not Available	2142	Open in IMG/M
3300013306\|Ga0163162_11139772	All Organisms → cellular organisms → Bacteria → Proteobacteria	884	Open in IMG/M
3300013308\|Ga0157375_13127807	Not Available	552	Open in IMG/M
3300014968\|Ga0157379_12576543	Not Available	509	Open in IMG/M
3300015245\|Ga0137409_10069381	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	3304	Open in IMG/M
3300015245\|Ga0137409_10109101	All Organisms → cellular organisms → Bacteria	2560	Open in IMG/M
3300015264\|Ga0137403_10504227	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_12_FULL_54_10	1081	Open in IMG/M
3300016319\|Ga0182033_10535238	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1011	Open in IMG/M
3300016319\|Ga0182033_11302621	All Organisms → cellular organisms → Bacteria	653	Open in IMG/M
3300016387\|Ga0182040_10845303	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella	756	Open in IMG/M
3300016422\|Ga0182039_10148604	Not Available	1811	Open in IMG/M
3300021560\|Ga0126371_13669709	Not Available	518	Open in IMG/M
3300025945\|Ga0207679_10952135	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	786	Open in IMG/M
3300025961\|Ga0207712_10736581	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia	863	Open in IMG/M
3300026023\|Ga0207677_10577496	Not Available	983	Open in IMG/M
3300027873\|Ga0209814_10009801	All Organisms → cellular organisms → Bacteria → Proteobacteria	3756	Open in IMG/M
3300027880\|Ga0209481_10057291	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	1817	Open in IMG/M
3300027880\|Ga0209481_10277193	Not Available	848	Open in IMG/M
3300027961\|Ga0209853_1155043	All Organisms → cellular organisms → Bacteria	552	Open in IMG/M
3300028587\|Ga0247828_10362290	Not Available	822	Open in IMG/M
3300028592\|Ga0247822_11129722	All Organisms → cellular organisms → Bacteria	652	Open in IMG/M
3300031941\|Ga0310912_10972465	All Organisms → cellular organisms → Bacteria	652	Open in IMG/M
3300031946\|Ga0310910_11064332	Not Available	631	Open in IMG/M
3300031954\|Ga0306926_12492044	Not Available	567	Open in IMG/M
3300033551\|Ga0247830_10447792	Not Available	1010	Open in IMG/M
3300034659\|Ga0314780_070838	Not Available	742	Open in IMG/M
3300034660\|Ga0314781_094705	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella palauensis	594	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	70.92%
Host-Associated	Host-Associated	29.08%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	70.92%
Plants	Host-Associated → Plants	29.08%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	70.92%
Rhizosphere	Host-Associated → Plants → Rhizosphere	24.11%
Rhizoplane	Host-Associated → Plants → Rhizoplane	4.96%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	58.87%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	22.70%
Loam	Environmental → Terrestrial → Soil → Loam	9.93%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	3.55%
Sand	Environmental → Terrestrial → Soil → Sand	2.13%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	1.42%
Soil	Host-Associated → Plants → Rhizosphere → Soil	1.42%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	46.10%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	22.70%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	8.51%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	5.67%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	3.55%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	3.55%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	3.55%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	2.13%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	1.42%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	1.42%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	0.71%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	0.71%

Habitat	Taxonomy	Distribution
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	23.40%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	21.99%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	19.15%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	8.51%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	3.55%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	3.55%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	3.55%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	2.13%
Groundwater Sand	Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand	2.13%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere	1.42%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	1.42%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	1.42%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere	0.71%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	0.71%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	0.71%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere	0.71%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.71%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.71%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.71%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.71%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.71%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.71%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.71%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000955	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300004153	Grasslands soil microbial communities from Hopland, California, USA (version 2)	Environmental	Open in IMG/M
3300005181	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127	Environmental	Open in IMG/M
3300005187	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124	Environmental	Open in IMG/M
3300005294	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil	Environmental	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Environmental	Open in IMG/M
3300005556	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156	Environmental	Open in IMG/M
3300005559	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149	Environmental	Open in IMG/M
3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Host-Associated	Open in IMG/M
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Host-Associated	Open in IMG/M
3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Host-Associated	Open in IMG/M
3300006844	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Host-Associated	Open in IMG/M
3300006845	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5	Host-Associated	Open in IMG/M
3300006846	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Host-Associated	Open in IMG/M
3300006847	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Host-Associated	Open in IMG/M
3300006880	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Host-Associated	Open in IMG/M
3300006904	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3	Host-Associated	Open in IMG/M
3300006969	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3	Host-Associated	Open in IMG/M
3300007258	Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3	Environmental	Open in IMG/M
3300009038	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG	Environmental	Open in IMG/M
3300009089	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG	Environmental	Open in IMG/M
3300009090	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG	Environmental	Open in IMG/M
3300009094	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)	Host-Associated	Open in IMG/M
3300009100	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2	Host-Associated	Open in IMG/M
3300009143	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2	Environmental	Open in IMG/M
3300009147	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)	Host-Associated	Open in IMG/M
3300009156	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)	Host-Associated	Open in IMG/M
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated	Open in IMG/M
3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Host-Associated	Open in IMG/M
3300009792	Tropical forest soil microbial communities from Panama - MetaG Plot_12	Environmental	Open in IMG/M
3300009816	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10	Environmental	Open in IMG/M
3300009822	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40	Environmental	Open in IMG/M
3300010043	Tropical forest soil microbial communities from Panama - MetaG Plot_26	Environmental	Open in IMG/M
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental	Open in IMG/M
3300010047	Tropical forest soil microbial communities from Panama - MetaG Plot_30	Environmental	Open in IMG/M
3300010358	Tropical forest soil microbial communities from Panama - MetaG Plot_3	Environmental	Open in IMG/M
3300010359	Tropical forest soil microbial communities from Panama - MetaG Plot_15	Environmental	Open in IMG/M
3300010361	Tropical forest soil microbial communities from Panama - MetaG Plot_23	Environmental	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental	Open in IMG/M
3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Host-Associated	Open in IMG/M
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental	Open in IMG/M
3300011270	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG	Environmental	Open in IMG/M
3300012189	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG	Environmental	Open in IMG/M
3300012202	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG	Environmental	Open in IMG/M
3300012203	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG	Environmental	Open in IMG/M
3300012205	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG	Environmental	Open in IMG/M
3300012206	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG	Environmental	Open in IMG/M
3300012207	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG	Environmental	Open in IMG/M
3300012209	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG	Environmental	Open in IMG/M
3300012212	Combined assembly of Hopland grassland soil	Host-Associated	Open in IMG/M
3300012359	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG	Environmental	Open in IMG/M
3300012361	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG	Environmental	Open in IMG/M
3300012362	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG	Environmental	Open in IMG/M
3300012363	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG	Environmental	Open in IMG/M
3300012685	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG	Environmental	Open in IMG/M
3300012922	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG	Environmental	Open in IMG/M
3300012925	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012927	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012944	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012948	Tropical forest soil microbial communities from Panama - MetaG Plot_14	Environmental	Open in IMG/M
3300012971	Tropical forest soil microbial communities from Panama - MetaG Plot_1	Environmental	Open in IMG/M
3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Host-Associated	Open in IMG/M
3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Host-Associated	Open in IMG/M
3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Host-Associated	Open in IMG/M
3300015245	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300015264	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300016319	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H	Environmental	Open in IMG/M
3300016387	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176	Environmental	Open in IMG/M
3300016422	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111	Environmental	Open in IMG/M
3300021560	Tropical forest soil microbial communities from Panama - MetaG Plot_4	Environmental	Open in IMG/M
3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300027873	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)	Host-Associated	Open in IMG/M
3300027880	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)	Host-Associated	Open in IMG/M
3300027961	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 (SPAdes)	Environmental	Open in IMG/M
3300028587	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3	Environmental	Open in IMG/M
3300028592	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30	Environmental	Open in IMG/M
3300031941	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080	Environmental	Open in IMG/M
3300031946	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172	Environmental	Open in IMG/M
3300031947	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H	Environmental	Open in IMG/M
3300031954	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)	Environmental	Open in IMG/M
3300033551	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5	Environmental	Open in IMG/M
3300034659	Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R1 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300034660	Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R2 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.32
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.32
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F053123

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
JGI1027J12803_1059846211	3300000955	Soil	MLSENHDSFFRLLKNKDFKEERMTKVELYAIDKSTTLESNKSLGRKQDMTPW*
Ga0063455_1008963291	3300004153	Soil	LSEKCNSFLRLLKNKGFKEERMTKVGLYAIGTSTTLESNKSLEEK*
Ga0066678_102563501	3300005181	Soil	LSEKWNSFLRLLKNKSFKKERMTKVGLYVLGKSTTLESNKS
Ga0066675_111839722	3300005187	Soil	LSEKGNSFLRLLKNKGFREESMTKVGLYAIGTSTTLESNKS
Ga0065705_107832262	3300005294	Switchgrass Rhizosphere	KRNLCLRLLKNKGFRDESMTKGGSYAIGTSTTLESNKSQGEMYG*
Ga0066388_1000605781	3300005332	Tropical Forest Soil	VWSEKGNAFSGLLKNKGFKEERKTKVGLDAIDKSTTLKSNKSPLCMSKGHAQYGR*
Ga0066388_1003976871	3300005332	Tropical Forest Soil	LSKNRNSFLNLLKNKGFKEERMTKVGWYAVDTSTTLESNKSLL*
Ga0066388_1017456733	3300005332	Tropical Forest Soil	ALSEKHKSFLRLLKNKGFKEESMTKAGLYAIGTSTTLESNKSL*
Ga0066388_1052293802	3300005332	Tropical Forest Soil	VRSEKGKAFSGLLQNKGFKEERKTKVGLDAIDKSTTLESNKS
Ga0066388_1054526581	3300005332	Tropical Forest Soil	MLSEKRNLFLRLLKNKDFKDESMTKVESYAIGTSTTLESNKSPVR*
Ga0066388_1066889822	3300005332	Tropical Forest Soil	MLSEKHNSFLRLLKNKGFKAERRTKNGLYAIGKFTTLESNKSLPS*
Ga0066388_1068762532	3300005332	Tropical Forest Soil	LSEKPNSFLRLLKNKGFKEKRITKIRFYAIGTSTTLESNKSL
Ga0066388_1084549572	3300005332	Tropical Forest Soil	VLSEKRNLCLRPLKNKGFKDESMTKGGSYAIGTSTTLESNKSL
Ga0066388_1085448791	3300005332	Tropical Forest Soil	LSEKHKSFLRLLKNKGFQEESMTKVRLDAIGTSTTLESNKS
Ga0070701_106379201	3300005438	Corn, Switchgrass And Miscanthus Rhizosphere	VLSEKRSVCLRLLKKKGFKDESMTKGGPYAIATSTTLESNKSL
Ga0066707_100290054	3300005556	Soil	LSEKRNSFSGLLKNKGFKEERKTKVGLDAIDKSTTLESNKSYFGSSS*
Ga0066700_101687681	3300005559	Soil	NSFLRLLKNKGFKEERMTKVGLYAIGKSTTLESNKSLFGKNQHPS*
Ga0070664_1010115102	3300005564	Corn Rhizosphere	VLSKKGNAFLRLLKKKSFKEESLSKARVYAIRTSTPLESNKSLDA*
Ga0066905_1006345982	3300005713	Tropical Forest Soil	MLSEKHNSFLRLLKNKGFKAERRTKNGLYPIGTFTTLESNKSLWR*
Ga0066903_1004711444	3300005764	Tropical Forest Soil	MLSEKHNSFLRLLKKKGFKEERMTKIGLYTIATFTTLESNKSLS*
Ga0066903_1014454451	3300005764	Tropical Forest Soil	ALSEKHKSFLRLLKNKGFKEESMTKVGLYAIGTSTTLESNKSL*
Ga0068862_1014145832	3300005844	Switchgrass Rhizosphere	LSEKHNSFLRPLKKKGFKDKRVTTMGLYAIGKSTTLESNKTQGRTSF*
Ga0081455_103313363	3300005937	Tabebuia Heterophylla Rhizosphere	LSKKRTSLLRPLKNEGFKEERMTKIGLYAISTSTTLESNKSLHTM*
Ga0075428_1000415077	3300006844	Populus Rhizosphere	LSEKHNSFLWLLKNKGFKEERVTKIKLYAIGASKTLESNKSLDR*
Ga0075428_1001502582	3300006844	Populus Rhizosphere	EKRNSFSGLLKNKGFKEERKTKVGLDAIDTSTTLESNKSPGGM*
Ga0075428_1009287141	3300006844	Populus Rhizosphere	VLSEKRNSFSGLLKNKGFKEERKTKVGLDAIDTSTTLESNKS
Ga0075428_1013334392	3300006844	Populus Rhizosphere	LSEKRHSFFRLGKDNGFKEERMTKVGVYALSPSTTLE
Ga0075428_1023289131	3300006844	Populus Rhizosphere	LCENRNSFLRLLKNKGFKEEKTTKVGLCAIGKSTTLESNKSL
Ga0075421_1000743371	3300006845	Populus Rhizosphere	RNSFSGLLKNKGFKEERKTKVGLDAIDTSTTLESNKSPGGM*
Ga0075430_1000912762	3300006846	Populus Rhizosphere	LSEKRNSFSGLLKNKGFKEERKTKVGLDAIDTSTTLESNKSPGGM*
Ga0075431_1000994405	3300006847	Populus Rhizosphere	LSEKHNAFLRPLINKGFKEESMTKFGVDAIGLSTTLESNKS
Ga0075431_1004108331	3300006847	Populus Rhizosphere	HSFLRLLKNKGFKEEKRTKVGWYAIGKFTTLESNKSVPNC*
Ga0075429_1009304691	3300006880	Populus Rhizosphere	VNSFPGLLKNKGFKEERKTKVGLDAIDKSTTLESNKS
Ga0075424_1005878671	3300006904	Populus Rhizosphere	MLSEKHNSFLRLLKKKGFKEERRTKIGLYAIGTSTTLESNKS
Ga0075419_103221543	3300006969	Populus Rhizosphere	RALYEKDNSFLRLLNNKGFREESMTKVGLYTIGTYTTLESNKSLHALSLLP*
Ga0099793_100044984	3300007258	Vadose Zone Soil	MLSKNRNSFLRLLKNKGFKEERMTKVGLYAIDKSTTLESNKSQSVNCSQP*
Ga0099829_111122582	3300009038	Vadose Zone Soil	MLLKNKGFKEERRTKIGLYAIGKSMTLESNKSHT*
Ga0099829_117502482	3300009038	Vadose Zone Soil	LSEKGNSFLRLLKNKGFREKSMTKVGLYAIGTSTTLESNKSHYFNRDEEEK
Ga0099828_106616591	3300009089	Vadose Zone Soil	LSEKHNSFLRLLKKKDFKEERVTTIGLYDIGKSTTLESNKSLIGL*
Ga0099827_110517962	3300009090	Vadose Zone Soil	LPEKHDAFFRLLKTEGFKEESMTQVGLYAIGTSTTLESNKS
Ga0111539_124325042	3300009094	Populus Rhizosphere	LSKKHHSFLRLLKNKGFKEESMTKVGLDAIGTSTTLESNKS
Ga0075418_103901523	3300009100	Populus Rhizosphere	YKLSDSFLRLLINKSFQEVRMTKVGLDSIGTSTTLESNKSLAIN*
Ga0075418_116686221	3300009100	Populus Rhizosphere	MFSERCDSFLRLWKNNDFKEERMTKVRLYALGTSMTLESNKSHI*
Ga0099792_103871711	3300009143	Vadose Zone Soil	LPEKHDAFFRLLKTEGFKEESMTQVGLYAIGTSTTLESNKSL
Ga0099792_107076681	3300009143	Vadose Zone Soil	LSEKHNSFLRPLKKKDFKEERVTTIGLYDIGKSTTLESNKSLWCL
Ga0114129_106303651	3300009147	Populus Rhizosphere	VFSETRNAFLRLLKNKSFKEESMAKVRLYASGTSTTLESNKSLFGLRDGN*
Ga0114129_107551682	3300009147	Populus Rhizosphere	SGLLKNKGFKEERKTKVGLDAIDTSTTLESNKSPGGM*
Ga0114129_109514832	3300009147	Populus Rhizosphere	LSEKYNSLLRLLKNKGFKEERMTKVGLYAIGKSTTLES
Ga0114129_125663893	3300009147	Populus Rhizosphere	VLSEKRNLCLRLLTNKGFKDESMTKGGSYAIGTSTTLESNKSQ
Ga0114129_127362792	3300009147	Populus Rhizosphere	LSEKHDSFLRLLKNKGFKEEKMTQVELYAIGTSTTLESNKSL
Ga0111538_137654612	3300009156	Populus Rhizosphere	LSDNHDSFLRLLKDKHFKEEGMTKVALDAIGTSTTLA
Ga0075423_104626672	3300009162	Populus Rhizosphere	MLSKNWNSFLRLLKKKGFKEERMTKVGLYAIGKSTPLESNKSLRVDKW*
Ga0075423_106662981	3300009162	Populus Rhizosphere	LSEKHSAFLRPLKNKGCKEESRTKFGVDAIGMSTPLESNKSL*
Ga0075423_116734841	3300009162	Populus Rhizosphere	LSEKRDSFLKLLKNKGFKKDSMTQVGLYAISKSTTLESNKS
Ga0105242_130348532	3300009176	Miscanthus Rhizosphere	VLSEKRNSFSGLLKNKGFKEERKTKVGLDAIDTSTTLESNKSPG
Ga0126374_108155821	3300009792	Tropical Forest Soil	LSEKGDSFLRLLKNKGFREENMTKVGLYAIGTYTTLESNKSHS
Ga0105076_10761342	3300009816	Groundwater Sand	LSEKRNSFLRLLKNKGFKEERMTKIELYAIDKSTTLESNKSPDSNLHD*
Ga0105066_10307751	3300009822	Groundwater Sand	LSKKRNSFLSLLKNKGFKEESMTKIRLYALGKSTTLESNKSLAQIALV*
Ga0126380_105321221	3300010043	Tropical Forest Soil	QLLFLKLQKKKDFTEESMTQVGLDAIGTSTLLDSNKSHVDRCS*
Ga0126380_105420632	3300010043	Tropical Forest Soil	VKRNSFLRLLKNKGFKKESMTKVGLYAISKSTTLESNKSQGVLPHAQ*
Ga0126380_109068102	3300010043	Tropical Forest Soil	LSENHDSFLRLLKKKDFKEERMTKVELYAIGTSTTLESNKSLLKYHDPGIQ*
Ga0126384_101855292	3300010046	Tropical Forest Soil	MLSEKHNSFLRLLKKKGFKEESMTKIGLYTIATFTTLESNKSL*
Ga0126384_102687901	3300010046	Tropical Forest Soil	LSEKGDSFLRLLKHKGFREENMTKVGLYAIGTYTT
Ga0126384_105658353	3300010046	Tropical Forest Soil	SYALALSEKGDSFLRLLKHKGFREENMTKVGLYAIGTSTTLESNKSHHFLRQKIFL*
Ga0126382_101447261	3300010047	Tropical Forest Soil	MLSEKHNAFLRLLKKKGFKERMTKIGLDAIGTSKTLESNKS
Ga0126382_101811001	3300010047	Tropical Forest Soil	LSEKRNSFLRLLKNKGFQEENMTQVGWYAVGTATTLESNKS
Ga0126382_106870011	3300010047	Tropical Forest Soil	LSEKHDSFLRLLKNKDFKEERRTKVALDAIGTSTTLESNKSL
Ga0126382_118842371	3300010047	Tropical Forest Soil	MLSEKHNAFLRLLKKKGFKEESMTKIELDAIGKSKTLEPNKSHP*
Ga0126370_110621291	3300010358	Tropical Forest Soil	VWSEKGNAFSGLLKNKGFKEERKTKVGLDAIDKSTTLKSNKSPLC
Ga0126370_111676192	3300010358	Tropical Forest Soil	LSEKHNAFLRLLKKKGFKERMTKIGLDAIGTATTLESNKSLRG*
Ga0126376_100669931	3300010359	Tropical Forest Soil	LSEKCNSLLRLLKNKGFKEESMTKVGVYAIDTSTTLES
Ga0126376_119007291	3300010359	Tropical Forest Soil	APTLSENHDSFLRLLKDKDFKGESMTKVELYAIGTSTTLESNKSQGVL*
Ga0126376_125256601	3300010359	Tropical Forest Soil	FLRLLKNKGFKKASMTKVGLYAISTSTTLEANKSLQRFAPE*
Ga0126378_112176142	3300010361	Tropical Forest Soil	LSEKHNSFLRLLKKKGFKEESMTKVALDAIGTFTTLESNKSPRPMKIVVDWGHG*
Ga0126377_109112843	3300010362	Tropical Forest Soil	SKKHHSFLRLLKNKGFKAESMTQVGLDAIGTSTTLESNKSLVP*
Ga0126377_114152612	3300010362	Tropical Forest Soil	MLSEKRNAIFRLLKKKGFKERMTKIGLDAIGTSKTLESNKSLRG*
Ga0126377_129980921	3300010362	Tropical Forest Soil	LSAKHNSFLRLLKKKGFKEESTTKVGVYAIGTSTTLESNKSLR
Ga0126379_104856891	3300010366	Tropical Forest Soil	LSDSFLRLLKNKAFKKERRTKTGVYAIGEGTPLESNKSL*
Ga0126379_123856971	3300010366	Tropical Forest Soil	LSEHHASFLRLWKNKDFKEESMIKVELYAIGLSTTLESNKSHGGLAHG*
Ga0105239_111544553	3300010375	Corn Rhizosphere	MVSEKHNSFLRLWKKKGFKEESMTKVRLYALGTSTTLESNKSEVGL*
Ga0126383_100465163	3300010398	Tropical Forest Soil	LSEKGDSFLRLLKNKGFREENMTKVGLYVIGTYTTLESNKSHNG*
Ga0126383_107474602	3300010398	Tropical Forest Soil	LSEKGNSLLRLLNNKGFREESMTKVELDAIGTSTTLKSNKRPKELATNV*
Ga0137391_113932451	3300011270	Vadose Zone Soil	VLSEKCNAFSGLLKNKGFKEERKTKVGLDAIDKSTTLESNKS
Ga0137388_106820152	3300012189	Vadose Zone Soil	LSEKGNSFLRLLKNKGFREKSMTKVGLYAIGTSTTLESNKSHYFNRDEEEKSGTKM*
Ga0137363_104446213	3300012202	Vadose Zone Soil	LSEKHNSFLRLLKNKGFKEESTTKVGLYAIGTSTTLESNKS
Ga0137363_105724212	3300012202	Vadose Zone Soil	FLSLLKNKGFKEESMTKIRLYALGKSTTLESNKSLAQIALV*
Ga0137399_100786424	3300012203	Vadose Zone Soil	LPEKHDAFFRLLKTKGFKEESLTQIGWYAIGTSTTLESNKSLAQIALV*
Ga0137399_102419034	3300012203	Vadose Zone Soil	LPEKHDAFFRLLKTEGFKEESMTQVGLYAIGTSTTLES
Ga0137362_103535403	3300012205	Vadose Zone Soil	LSEKRNSFLRLLKNKGFKEERRIKIGLYAIGKSTTLESNKSQRR
Ga0137362_114780811	3300012205	Vadose Zone Soil	LPEKHDAFFRLLKTEGFKEESMTQVGLYAIGTSTTLESNK
Ga0137380_102703395	3300012206	Vadose Zone Soil	LSEKHNSFLRLLKKKGFKEETRTKVGLYAIGTSTTLESNKSL
Ga0137380_107704362	3300012206	Vadose Zone Soil	LSEKRNSFVRLLKNKGFKEERTTKVELDAIGTSTTLESNKSLP*
Ga0137381_114757511	3300012207	Vadose Zone Soil	LSEKRNSFLRLLKNTGFKEERRTKIGLYAIGKSTTLE
Ga0137379_108964111	3300012209	Vadose Zone Soil	LSEKHNSFLRLLKNKGFKEESMTKVGLDAIGTSTTLESNKSLRPF
Ga0150985_1017798932	3300012212	Avena Fatua Rhizosphere	VLSEKRNLCLRLLKNKGFKDEGMTKGGSYAIGTSTTLESNKSLTRLV*
Ga0150985_1179204312	3300012212	Avena Fatua Rhizosphere	LFAKRNPFFRLLKNKGFKEERRIKVGMNALGSSTTLESNKSLSVLHHD*
Ga0137385_115929922	3300012359	Vadose Zone Soil	LPEKHDAFFRLLKTEGFKEESMTQVGLYAIGTSTTLESNKSLAQIALV*
Ga0137360_117318521	3300012361	Vadose Zone Soil	LSEKRNSFLRLLKNKGFKEERRIKIGLYAIGKSTTLESNKSQ
Ga0137361_102939901	3300012362	Vadose Zone Soil	VVSEKRNSFVSLLKKKGFKAERMTKVGLYAIGTSTTLESNKSLAGN*
Ga0137361_118892721	3300012362	Vadose Zone Soil	MLSEKRGSFLRLLKNKGFKEESMTKVGLYAIGQSTTLESNK
Ga0137390_108451242	3300012363	Vadose Zone Soil	LSEKRNSFLRLLKNKGFKEERRIKIGLYAIGKSTTLESNKSQR
Ga0137397_104378002	3300012685	Vadose Zone Soil	LPEKHDAFFRLLKTEGFKEESMTQVGLYAIGTSTTLE
Ga0137394_101768301	3300012922	Vadose Zone Soil	KNRNSFLRLLKNKGFKEERMTKVGLYAIDKSTTLESNKSQSVNGSQP*
Ga0137419_103806012	3300012925	Vadose Zone Soil	LSEKHKSFLSLLKNKGFKEENMTKIRLYALGTSTTLESNKSLAQIALV*
Ga0137419_113208892	3300012925	Vadose Zone Soil	LPEKHDAFFRLLKTEGFKEESMTQVGWYAIGTSTTLES
Ga0137416_113410912	3300012927	Vadose Zone Soil	SENRHSFLRPLKKKGFKEERATKVWLYDIGKSTTLESNKSQSVYRTS*
Ga0137410_106021462	3300012944	Vadose Zone Soil	MLSEKHNAFLRLLKNKGFKEERMTKVGLYAIDKSTTLESNKSQSVNGSQP*
Ga0126375_112748231	3300012948	Tropical Forest Soil	LSEKRNSFLRLLTNKGFKEESMTKVGVDAIDKSTTLESDKSP*
Ga0126375_114310052	3300012948	Tropical Forest Soil	WSEKHNSFLRLLKNQGFREESMTKFGWYTIGKTTTLESNKSLVGM*
Ga0126375_115504811	3300012948	Tropical Forest Soil	MLSEKHNSFLRRLKKKGFKEESMTKFGWYAIGTSKTLESNKSLLN*
Ga0126369_101867731	3300012971	Tropical Forest Soil	HNSFLRLLKNKSFKEESMTKVALDAVGTSTTLESNKSLARM*
Ga0126369_105705172	3300012971	Tropical Forest Soil	LTEQHNLFVRLLKNKGFKEERMTKVGLYVIGTSTTLESNKSLI
Ga0126369_121890711	3300012971	Tropical Forest Soil	VRSEKGKAFSGLLKNKGFKEERKTKVGLDAIDKSTTLESNKS
Ga0163162_101971683	3300013306	Switchgrass Rhizosphere	LSEKHNAFLRLLKNKGFKEERRTKNGMYAISKATTLESNKSLTG*
Ga0163162_111397723	3300013306	Switchgrass Rhizosphere	APTLSEKRDSFLRLLKNNDFKEERMTKVELYALGTSTTLESNKSLCWKR*
Ga0157375_131278072	3300013308	Miscanthus Rhizosphere	LSEKHNSFLRPLKKKGFKDKRVTTMGLYAIGKSTTLESNKT
Ga0157379_125765431	3300014968	Switchgrass Rhizosphere	LSEKHNAFLRLVKKKGFQEERMTKVEVDAIGMSTPLAPNKSLRKMPR*
Ga0137409_100693813	3300015245	Vadose Zone Soil	PEKHDAFFRLLKTEGFKEESMTQVGWYAIGTSTTLESNKSLFS*
Ga0137409_101091012	3300015245	Vadose Zone Soil	LPEKRNSFLRLLKNKGFKEERMTKVGLYAIDKSTTLESNKSQSVNGSQP*
Ga0137403_105042271	3300015264	Vadose Zone Soil	LSEKHNSFLRLLKNEGFKEESTTKVGLYAIGTSTT
Ga0182033_105352382	3300016319	Soil	SYAATGSEKRISFLRPLKNNGFKEETGAKILLYAIGTSTTLESNKSQL
Ga0182033_113026211	3300016319	Soil	LSEKGNSFLRLLKNKGFREESMTKVGVDAIGTSTTLESNKS
Ga0182040_108453031	3300016387	Soil	LSEKGDSFLRLLKHKGFREENMTKIGLYAIGTSTTLESNKSL
Ga0182039_101486043	3300016422	Soil	LSEKRNSFLRLLKNKDFKKENLTKVRLYAISKSTTLESNKSLQEM
Ga0126371_136697091	3300021560	Tropical Forest Soil	LSAKHNAFVRLLKKKGFKEESTTKVGVYAIGTSTTLESNKSQGRFGFVGIW
Ga0207679_109521351	3300025945	Corn Rhizosphere	LSKKGNAFLRLLKKKSFKEESLSKARVYAIRTSTPLESNKSLDA
Ga0207712_107365811	3300025961	Switchgrass Rhizosphere	TLSENHDSFLRLLKNKDFKEERMTKVELDAIGTSTPLESNKSLGGYAYTK
Ga0207677_105774961	3300026023	Miscanthus Rhizosphere	LSEKHNAFLRLLKKKGFKEERMTKVEVDAIGMSTPLA
Ga0209814_100098014	3300027873	Populus Rhizosphere	LSEHDDSFSRLLKNKDFKEESMTKVALYTIGKSTTLESNKSQIFMRMPR
Ga0209481_100572912	3300027880	Populus Rhizosphere	LSEKHNSFLWLLKNKGFKEERVTKIKLYAIGASKTLESNKSLDR
Ga0209481_102771931	3300027880	Populus Rhizosphere	RALYEKDNSFLRLLNNKGFREESMTKVGLYTIGTYTTLESNKSLHALSLLP
Ga0209853_11550432	3300027961	Groundwater Sand	LSEKHKSFLSLLKNKGFKEESMTKIRLYALGKSTTLESNKSLAQIALV
Ga0247828_103622902	3300028587	Soil	SYALALSEKRNSFLRLLKSKGFKEESMTKVGLYAIGKSTTLESNKSQP
Ga0247822_111297221	3300028592	Soil	VLSEKRNPFSGLLKKKGSKEKRKTKVVLDAIGKSTTLESNKSLEEIQWV
Ga0310912_109724651	3300031941	Soil	LSEKGDLFLSPLKNKGFREESIRQVGLYAIGTSTTLESNKS
Ga0310910_110643321	3300031946	Soil	LSEKHKSFLRLLKNKGFQEESMTKVRLDAIGTSTTLESNKSLDG
Ga0310909_111081401	3300031947	Soil	WIPGSYAPTLSEHHDSFLRLWKNKDFKEERMIKVELYAIGQSTTLESNKSL
Ga0306926_124920441	3300031954	Soil	LSEKPNSCLRLLKNQGFKEKRLTKVGFYALGTSTTLATN
Ga0247830_104477921	3300033551	Soil	LSEKHNAFLRPLINKGFKEESMTKFGVDAIGLSTTLESNK
Ga0314780_070838_499_669	3300034659	Soil	LSEKHNAFLRPLINKGFKEESMTKVGLDAIGTSTTLESNKSLRQIHICGIKTYSEP
Ga0314781_094705_445_576	3300034660	Soil	LSEKGDAFLRPLENKGFRKESMIKVGVDAIGQTTTLESNKSLG

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign